data_1AX2 # _entry.id 1AX2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AX2 pdb_00001ax2 10.2210/pdb1ax2/pdb WWPDB D_1000171361 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AX2 _pdbx_database_status.recvd_initial_deposition_date 1997-10-24 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shaanan, B.' 1 'Elgavish, S.' 2 # _citation.id primary _citation.title 'Structures of the Erythrina corallodendron lectin and of its complexes with mono- and disaccharides.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 277 _citation.page_first 917 _citation.page_last 932 _citation.year 1998 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9545381 _citation.pdbx_database_id_DOI 10.1006/jmbi.1998.1664 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Elgavish, S.' 1 ? primary 'Shaanan, B.' 2 ? # _cell.entry_id 1AX2 _cell.length_a 83.930 _cell.length_b 73.170 _cell.length_c 71.310 _cell.angle_alpha 90.00 _cell.angle_beta 113.36 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AX2 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat LECTIN 26221.180 1 ? ? ? ? 2 branched man ;beta-D-xylopyranose-(1-2)-[alpha-D-mannopyranose-(1-3)][alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-3)]2-acetamido-2-deoxy-beta-D-glucopyranose ; 1189.079 1 ? ? ? ? 3 branched man 'beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose' 383.349 1 ? ? ? ? 4 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 5 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 6 water nat water 18.015 154 ? ? ? ? # _entity_name_com.entity_id 3 _entity_name_com.name N-acetyl-alpha-lactosamine # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQ PYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQL DNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE ; _entity_poly.pdbx_seq_one_letter_code_can ;VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQ PYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQL DNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 GLU n 1 3 THR n 1 4 ILE n 1 5 SER n 1 6 PHE n 1 7 SER n 1 8 PHE n 1 9 SER n 1 10 GLU n 1 11 PHE n 1 12 GLU n 1 13 PRO n 1 14 GLY n 1 15 ASN n 1 16 ASP n 1 17 ASN n 1 18 LEU n 1 19 THR n 1 20 LEU n 1 21 GLN n 1 22 GLY n 1 23 ALA n 1 24 ALA n 1 25 LEU n 1 26 ILE n 1 27 THR n 1 28 GLN n 1 29 SER n 1 30 GLY n 1 31 VAL n 1 32 LEU n 1 33 GLN n 1 34 LEU n 1 35 THR n 1 36 LYS n 1 37 ILE n 1 38 ASN n 1 39 GLN n 1 40 ASN n 1 41 GLY n 1 42 MET n 1 43 PRO n 1 44 ALA n 1 45 TRP n 1 46 ASP n 1 47 SER n 1 48 THR n 1 49 GLY n 1 50 ARG n 1 51 THR n 1 52 LEU n 1 53 TYR n 1 54 ALA n 1 55 LYS n 1 56 PRO n 1 57 VAL n 1 58 HIS n 1 59 ILE n 1 60 TRP n 1 61 ASP n 1 62 MET n 1 63 THR n 1 64 THR n 1 65 GLY n 1 66 THR n 1 67 VAL n 1 68 ALA n 1 69 SER n 1 70 PHE n 1 71 GLU n 1 72 THR n 1 73 ARG n 1 74 PHE n 1 75 SER n 1 76 PHE n 1 77 SER n 1 78 ILE n 1 79 GLU n 1 80 GLN n 1 81 PRO n 1 82 TYR n 1 83 THR n 1 84 ARG n 1 85 PRO n 1 86 LEU n 1 87 PRO n 1 88 ALA n 1 89 ASP n 1 90 GLY n 1 91 LEU n 1 92 VAL n 1 93 PHE n 1 94 PHE n 1 95 MET n 1 96 GLY n 1 97 PRO n 1 98 THR n 1 99 LYS n 1 100 SER n 1 101 LYS n 1 102 PRO n 1 103 ALA n 1 104 GLN n 1 105 GLY n 1 106 TYR n 1 107 GLY n 1 108 TYR n 1 109 LEU n 1 110 GLY n 1 111 ILE n 1 112 PHE n 1 113 ASN n 1 114 ASN n 1 115 SER n 1 116 LYS n 1 117 GLN n 1 118 ASP n 1 119 ASN n 1 120 SER n 1 121 TYR n 1 122 GLN n 1 123 THR n 1 124 LEU n 1 125 GLY n 1 126 VAL n 1 127 GLU n 1 128 PHE n 1 129 ASP n 1 130 THR n 1 131 PHE n 1 132 SER n 1 133 ASN n 1 134 PRO n 1 135 TRP n 1 136 ASP n 1 137 PRO n 1 138 PRO n 1 139 GLN n 1 140 VAL n 1 141 PRO n 1 142 HIS n 1 143 ILE n 1 144 GLY n 1 145 ILE n 1 146 ASP n 1 147 VAL n 1 148 ASN n 1 149 SER n 1 150 ILE n 1 151 ARG n 1 152 SER n 1 153 ILE n 1 154 LYS n 1 155 THR n 1 156 GLN n 1 157 PRO n 1 158 PHE n 1 159 GLN n 1 160 LEU n 1 161 ASP n 1 162 ASN n 1 163 GLY n 1 164 GLN n 1 165 VAL n 1 166 ALA n 1 167 ASN n 1 168 VAL n 1 169 VAL n 1 170 ILE n 1 171 LYS n 1 172 TYR n 1 173 ASP n 1 174 ALA n 1 175 SER n 1 176 SER n 1 177 LYS n 1 178 ILE n 1 179 LEU n 1 180 HIS n 1 181 ALA n 1 182 VAL n 1 183 LEU n 1 184 VAL n 1 185 TYR n 1 186 PRO n 1 187 SER n 1 188 SER n 1 189 GLY n 1 190 ALA n 1 191 ILE n 1 192 TYR n 1 193 THR n 1 194 ILE n 1 195 ALA n 1 196 GLU n 1 197 ILE n 1 198 VAL n 1 199 ASP n 1 200 VAL n 1 201 LYS n 1 202 GLN n 1 203 VAL n 1 204 LEU n 1 205 PRO n 1 206 GLU n 1 207 TRP n 1 208 VAL n 1 209 ASP n 1 210 VAL n 1 211 GLY n 1 212 LEU n 1 213 SER n 1 214 GLY n 1 215 ALA n 1 216 THR n 1 217 GLY n 1 218 ALA n 1 219 GLN n 1 220 ARG n 1 221 ASP n 1 222 ALA n 1 223 ALA n 1 224 GLU n 1 225 THR n 1 226 HIS n 1 227 ASP n 1 228 VAL n 1 229 TYR n 1 230 SER n 1 231 TRP n 1 232 SER n 1 233 PHE n 1 234 GLN n 1 235 ALA n 1 236 SER n 1 237 LEU n 1 238 PRO n 1 239 GLU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Erythrina corallodendron' _entity_src_nat.pdbx_ncbi_taxonomy_id 3843 _entity_src_nat.genus Erythrina _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LEC_ERYCO _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P16404 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MATYKLCSVLALSLTLFLLILNKVNSVETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYA KPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNP WDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSG ATGAQRDAAETHDVYSWSFQASLPETNDAVIPTSNHNTFAI ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AX2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 239 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16404 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 265 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 239 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMA 'D-saccharide, beta linking' . beta-D-mannopyranose 'beta-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose 'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5' 164.156 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose 'beta-D-galactose; D-galactose; galactose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose 'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 180.156 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose ;N-acetyl-alpha-D-glucosamine; 2-acetamido-2-deoxy-alpha-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; 2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XYP 'D-saccharide, beta linking' . beta-D-xylopyranose 'beta-D-xylose; D-xylose; xylose' 'C5 H10 O5' 150.130 # _exptl.entry_id 1AX2 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.83 _exptl_crystal.density_percent_sol 67.89 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7. _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.' # _diffrn.id 1 _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS II' _diffrn_detector.pdbx_collection_date 1993-09 _diffrn_detector.details 'FRANCKS MIRRORS (SUPPER 2 X 6 CM MIRRORS)' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH3R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1AX2 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20. _reflns.d_resolution_high 1.95 _reflns.number_obs 27182 _reflns.number_all ? _reflns.percent_possible_obs 94.0 _reflns.pdbx_Rmerge_I_obs 0.052 _reflns.pdbx_Rsym_value 0.052 _reflns.pdbx_netI_over_sigmaI 13. _reflns.B_iso_Wilson_estimate 25.1 _reflns.pdbx_redundancy 2.4 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.04 _reflns_shell.percent_possible_all 82. _reflns_shell.Rmerge_I_obs 0.052 _reflns_shell.pdbx_Rsym_value 0.267 _reflns_shell.meanI_over_sigI_obs 3.5 _reflns_shell.pdbx_redundancy 2.1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1AX2 _refine.ls_number_reflns_obs 26190 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 0.0 _refine.pdbx_data_cutoff_low_absF 0.0 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.0 _refine.ls_d_res_high 1.95 _refine.ls_percent_reflns_obs 96.0 _refine.ls_R_factor_obs 0.169 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.169 _refine.ls_R_factor_R_free 0.177 _refine.ls_R_factor_R_free_error 0.003 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.9 _refine.ls_number_reflns_R_free 2604 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 27.5 _refine.aniso_B[1][1] -2.77 _refine.aniso_B[2][2] 1.91 _refine.aniso_B[3][3] 0.86 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.12 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'COMPLEX WITH LACTOSE, PDB ENTRY 1LTE' _refine.pdbx_method_to_determine_struct 'DIFFERENCE FOURIER FROM PREVIOUSLY DETERMINED, RELATED STRUCTURE' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1AX2 _refine_analyze.Luzzati_coordinate_error_obs 0.20 _refine_analyze.Luzzati_sigma_a_obs 0.22 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.20 _refine_analyze.Luzzati_sigma_a_free 0.23 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1855 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 108 _refine_hist.number_atoms_solvent 154 _refine_hist.number_atoms_total 2117 _refine_hist.d_res_high 1.95 _refine_hist.d_res_low 6.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.5 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 27.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.24 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.56 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.45 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 3.34 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.93 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 1.95 _refine_ls_shell.d_res_low 2.02 _refine_ls_shell.number_reflns_R_work 1504 _refine_ls_shell.R_factor_R_work 0.346 _refine_ls_shell.percent_reflns_obs 60.6 _refine_ls_shell.R_factor_R_free 0.349 _refine_ls_shell.R_factor_R_free_error 0.026 _refine_ls_shell.percent_reflns_R_free 11.0 _refine_ls_shell.number_reflns_R_free 185 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 3 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' # _struct.entry_id 1AX2 _struct.title 'ERYTHRINA CORALLODENDRON LECTIN IN COMPLEX WITH N-ACETYLLACTOSAMINE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AX2 _struct_keywords.pdbx_keywords LECTIN _struct_keywords.text 'LECTIN, GLYCOPROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 106 ? TYR A 108 ? TYR A 106 TYR A 108 5 ? 3 HELX_P HELX_P2 2 ASN A 119 ? TYR A 121 ? ASN A 119 TYR A 121 5 ? 3 HELX_P HELX_P3 3 VAL A 200 ? GLN A 202 ? VAL A 200 GLN A 202 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A ASN 17 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 17 B NAG 1 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation covale2 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.385 ? ? covale3 covale both ? B NAG . O3 ? ? ? 1_555 B FUC . C1 ? ? B NAG 1 B FUC 7 1_555 ? ? ? ? ? ? ? 1.399 ? ? covale4 covale both ? B NAG . O4 ? ? ? 1_555 B BMA . C1 ? ? B NAG 2 B BMA 3 1_555 ? ? ? ? ? ? ? 1.388 ? ? covale5 covale both ? B BMA . O2 ? ? ? 1_555 B XYP . C1 ? ? B BMA 3 B XYP 4 1_555 ? ? ? ? ? ? ? 1.378 ? ? covale6 covale both ? B BMA . O3 ? ? ? 1_555 B MAN . C1 ? ? B BMA 3 B MAN 5 1_555 ? ? ? ? ? ? ? 1.392 ? ? covale7 covale both ? B BMA . O6 ? ? ? 1_555 B MAN . C1 ? ? B BMA 3 B MAN 6 1_555 ? ? ? ? ? ? ? 1.396 ? ? covale8 covale both ? C NDG . O4 ? ? ? 1_555 C GAL . C1 ? ? C NDG 1 C GAL 2 1_555 ? ? ? ? ? ? ? 1.390 ? ? metalc1 metalc ? ? A GLU 127 OE2 ? ? ? 1_555 D MN . MN ? ? A GLU 127 A MN 289 1_555 ? ? ? ? ? ? ? 2.213 ? ? metalc2 metalc ? ? A ASP 129 OD2 ? ? ? 1_555 D MN . MN ? ? A ASP 129 A MN 289 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc3 metalc ? ? A ASP 129 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 129 A CA 290 1_555 ? ? ? ? ? ? ? 2.476 ? ? metalc4 metalc ? ? A ASP 129 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 129 A CA 290 1_555 ? ? ? ? ? ? ? 2.465 ? ? metalc5 metalc ? ? A PHE 131 O ? ? ? 1_555 E CA . CA ? ? A PHE 131 A CA 290 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc6 metalc ? ? A ASN 133 OD1 ? ? ? 1_555 E CA . CA ? ? A ASN 133 A CA 290 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc7 metalc ? ? A ASP 136 OD1 ? ? ? 1_555 D MN . MN ? ? A ASP 136 A MN 289 1_555 ? ? ? ? ? ? ? 2.169 ? ? metalc8 metalc ? ? A ASP 136 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 136 A CA 290 1_555 ? ? ? ? ? ? ? 2.363 ? ? metalc9 metalc ? ? A HIS 142 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 142 A MN 289 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc10 metalc ? ? D MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 289 A HOH 535 1_555 ? ? ? ? ? ? ? 2.367 ? ? metalc11 metalc ? ? D MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 289 A HOH 536 1_555 ? ? ? ? ? ? ? 2.157 ? ? metalc12 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 290 A HOH 533 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc13 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 290 A HOH 534 1_555 ? ? ? ? ? ? ? 2.346 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 84 A . ? ARG 84 A PRO 85 A ? PRO 85 A 1 -0.19 2 ALA 88 A . ? ALA 88 A ASP 89 A ? ASP 89 A 1 -0.13 3 VAL 140 A . ? VAL 140 A PRO 141 A ? PRO 141 A 1 -0.04 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 2 ? PHE A 8 ? GLU A 2 PHE A 8 A 2 ASP A 227 ? LEU A 237 ? ASP A 227 LEU A 237 A 3 SER A 69 ? SER A 77 ? SER A 69 SER A 77 A 4 VAL A 165 ? ASP A 173 ? VAL A 165 ASP A 173 A 5 ILE A 178 ? TYR A 185 ? ILE A 178 TYR A 185 A 6 ALA A 190 ? ILE A 197 ? ALA A 190 ILE A 197 B 1 LEU A 18 ? GLY A 22 ? LEU A 18 GLY A 22 B 2 THR A 48 ? TYR A 53 ? THR A 48 TYR A 53 B 3 VAL A 208 ? THR A 216 ? VAL A 208 THR A 216 B 4 ASP A 89 ? PRO A 97 ? ASP A 89 PRO A 97 B 5 LEU A 124 ? ASP A 129 ? LEU A 124 ASP A 129 B 6 HIS A 142 ? VAL A 147 ? HIS A 142 VAL A 147 B 7 LYS A 154 ? PRO A 157 ? LYS A 154 PRO A 157 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 2 ? O GLU A 2 N LEU A 237 ? N LEU A 237 A 2 3 O ASP A 227 ? O ASP A 227 N SER A 77 ? N SER A 77 A 3 4 O PHE A 70 ? O PHE A 70 N TYR A 172 ? N TYR A 172 A 4 5 O ASN A 167 ? O ASN A 167 N VAL A 184 ? N VAL A 184 A 5 6 O LEU A 179 ? O LEU A 179 N GLU A 196 ? N GLU A 196 B 1 2 O THR A 19 ? O THR A 19 N LEU A 52 ? N LEU A 52 B 2 3 O GLY A 49 ? O GLY A 49 N GLY A 214 ? N GLY A 214 B 3 4 O ASP A 209 ? O ASP A 209 N GLY A 96 ? N GLY A 96 B 4 5 O LEU A 91 ? O LEU A 91 N PHE A 128 ? N PHE A 128 B 5 6 O GLY A 125 ? O GLY A 125 N ASP A 146 ? N ASP A 146 B 6 7 O ILE A 143 ? O ILE A 143 N GLN A 156 ? N GLN A 156 # _database_PDB_matrix.entry_id 1AX2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AX2 _atom_sites.fract_transf_matrix[1][1] 0.011915 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005146 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013667 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015275 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA MN N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 TRP 135 135 135 TRP TRP A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 PHE 158 158 158 PHE PHE A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 HIS 180 180 180 HIS HIS A . n A 1 181 ALA 181 181 181 ALA ALA A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 ILE 194 194 194 ILE ILE A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 GLU 196 196 196 GLU GLU A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 LYS 201 201 201 LYS LYS A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 TRP 207 207 207 TRP TRP A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 GLY 211 211 211 GLY GLY A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 GLN 219 219 219 GLN GLN A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 THR 225 225 225 THR THR A . n A 1 226 HIS 226 226 226 HIS HIS A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 TYR 229 229 229 TYR TYR A . n A 1 230 SER 230 230 230 SER SER A . n A 1 231 TRP 231 231 231 TRP TRP A . n A 1 232 SER 232 232 232 SER SER A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 GLN 234 234 234 GLN GLN A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 GLU 239 239 239 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 MN 1 289 289 MN MN A . E 5 CA 1 290 290 CA CA A . F 6 HOH 1 500 500 HOH HOH A . F 6 HOH 2 501 501 HOH HOH A . F 6 HOH 3 502 502 HOH HOH A . F 6 HOH 4 503 503 HOH HOH A . F 6 HOH 5 504 504 HOH HOH A . F 6 HOH 6 505 505 HOH HOH A . F 6 HOH 7 506 506 HOH HOH A . F 6 HOH 8 507 507 HOH HOH A . F 6 HOH 9 508 508 HOH HOH A . F 6 HOH 10 509 509 HOH HOH A . F 6 HOH 11 510 510 HOH HOH A . F 6 HOH 12 511 511 HOH HOH A . F 6 HOH 13 512 512 HOH HOH A . F 6 HOH 14 513 513 HOH HOH A . F 6 HOH 15 514 514 HOH HOH A . F 6 HOH 16 515 515 HOH HOH A . F 6 HOH 17 516 516 HOH HOH A . F 6 HOH 18 517 517 HOH HOH A . F 6 HOH 19 518 518 HOH HOH A . F 6 HOH 20 519 519 HOH HOH A . F 6 HOH 21 520 520 HOH HOH A . F 6 HOH 22 521 521 HOH HOH A . F 6 HOH 23 522 522 HOH HOH A . F 6 HOH 24 523 523 HOH HOH A . F 6 HOH 25 524 524 HOH HOH A . F 6 HOH 26 525 525 HOH HOH A . F 6 HOH 27 526 526 HOH HOH A . F 6 HOH 28 527 527 HOH HOH A . F 6 HOH 29 528 528 HOH HOH A . F 6 HOH 30 529 529 HOH HOH A . F 6 HOH 31 530 530 HOH HOH A . F 6 HOH 32 531 531 HOH HOH A . F 6 HOH 33 532 532 HOH HOH A . F 6 HOH 34 533 533 HOH HOH A . F 6 HOH 35 534 534 HOH HOH A . F 6 HOH 36 535 535 HOH HOH A . F 6 HOH 37 536 536 HOH HOH A . F 6 HOH 38 537 537 HOH HOH A . F 6 HOH 39 538 538 HOH HOH A . F 6 HOH 40 539 539 HOH HOH A . F 6 HOH 41 540 540 HOH HOH A . F 6 HOH 42 541 541 HOH HOH A . F 6 HOH 43 542 542 HOH HOH A . F 6 HOH 44 543 543 HOH HOH A . F 6 HOH 45 544 544 HOH HOH A . F 6 HOH 46 545 545 HOH HOH A . F 6 HOH 47 546 546 HOH HOH A . F 6 HOH 48 547 547 HOH HOH A . F 6 HOH 49 548 548 HOH HOH A . F 6 HOH 50 549 549 HOH HOH A . F 6 HOH 51 550 550 HOH HOH A . F 6 HOH 52 551 551 HOH HOH A . F 6 HOH 53 552 552 HOH HOH A . F 6 HOH 54 553 553 HOH HOH A . F 6 HOH 55 554 554 HOH HOH A . F 6 HOH 56 555 555 HOH HOH A . F 6 HOH 57 556 556 HOH HOH A . F 6 HOH 58 557 557 HOH HOH A . F 6 HOH 59 558 558 HOH HOH A . F 6 HOH 60 559 559 HOH HOH A . F 6 HOH 61 560 560 HOH HOH A . F 6 HOH 62 561 561 HOH HOH A . F 6 HOH 63 562 562 HOH HOH A . F 6 HOH 64 563 563 HOH HOH A . F 6 HOH 65 564 564 HOH HOH A . F 6 HOH 66 565 565 HOH HOH A . F 6 HOH 67 566 566 HOH HOH A . F 6 HOH 68 567 567 HOH HOH A . F 6 HOH 69 568 568 HOH HOH A . F 6 HOH 70 569 569 HOH HOH A . F 6 HOH 71 570 570 HOH HOH A . F 6 HOH 72 571 571 HOH HOH A . F 6 HOH 73 572 572 HOH HOH A . F 6 HOH 74 573 573 HOH HOH A . F 6 HOH 75 574 574 HOH HOH A . F 6 HOH 76 575 575 HOH HOH A . F 6 HOH 77 576 576 HOH HOH A . F 6 HOH 78 577 577 HOH HOH A . F 6 HOH 79 578 578 HOH HOH A . F 6 HOH 80 579 579 HOH HOH A . F 6 HOH 81 580 580 HOH HOH A . F 6 HOH 82 581 581 HOH HOH A . F 6 HOH 83 582 582 HOH HOH A . F 6 HOH 84 583 583 HOH HOH A . F 6 HOH 85 584 584 HOH HOH A . F 6 HOH 86 585 585 HOH HOH A . F 6 HOH 87 586 586 HOH HOH A . F 6 HOH 88 587 587 HOH HOH A . F 6 HOH 89 588 588 HOH HOH A . F 6 HOH 90 590 590 HOH HOH A . F 6 HOH 91 591 591 HOH HOH A . F 6 HOH 92 592 592 HOH HOH A . F 6 HOH 93 593 593 HOH HOH A . F 6 HOH 94 594 594 HOH HOH A . F 6 HOH 95 595 595 HOH HOH A . F 6 HOH 96 596 596 HOH HOH A . F 6 HOH 97 597 597 HOH HOH A . F 6 HOH 98 598 598 HOH HOH A . F 6 HOH 99 599 599 HOH HOH A . F 6 HOH 100 600 600 HOH HOH A . F 6 HOH 101 601 601 HOH HOH A . F 6 HOH 102 602 602 HOH HOH A . F 6 HOH 103 603 603 HOH HOH A . F 6 HOH 104 604 604 HOH HOH A . F 6 HOH 105 605 605 HOH HOH A . F 6 HOH 106 606 606 HOH HOH A . F 6 HOH 107 607 607 HOH HOH A . F 6 HOH 108 608 608 HOH HOH A . F 6 HOH 109 609 609 HOH HOH A . F 6 HOH 110 610 610 HOH HOH A . F 6 HOH 111 611 611 HOH HOH A . F 6 HOH 112 612 612 HOH HOH A . F 6 HOH 113 613 613 HOH HOH A . F 6 HOH 114 614 614 HOH HOH A . F 6 HOH 115 615 615 HOH HOH A . F 6 HOH 116 616 616 HOH HOH A . F 6 HOH 117 617 617 HOH HOH A . F 6 HOH 118 618 618 HOH HOH A . F 6 HOH 119 619 619 HOH HOH A . F 6 HOH 120 620 620 HOH HOH A . F 6 HOH 121 621 621 HOH HOH A . F 6 HOH 122 622 622 HOH HOH A . F 6 HOH 123 623 623 HOH HOH A . F 6 HOH 124 624 624 HOH HOH A . F 6 HOH 125 625 625 HOH HOH A . F 6 HOH 126 626 626 HOH HOH A . F 6 HOH 127 627 627 HOH HOH A . F 6 HOH 128 628 628 HOH HOH A . F 6 HOH 129 629 629 HOH HOH A . F 6 HOH 130 630 630 HOH HOH A . F 6 HOH 131 631 631 HOH HOH A . F 6 HOH 132 632 632 HOH HOH A . F 6 HOH 133 633 633 HOH HOH A . F 6 HOH 134 634 634 HOH HOH A . F 6 HOH 135 635 635 HOH HOH A . F 6 HOH 136 636 636 HOH HOH A . F 6 HOH 137 637 637 HOH HOH A . F 6 HOH 138 638 638 HOH HOH A . F 6 HOH 139 639 639 HOH HOH A . F 6 HOH 140 640 640 HOH HOH A . F 6 HOH 141 641 641 HOH HOH A . F 6 HOH 142 642 642 HOH HOH A . F 6 HOH 143 643 643 HOH HOH A . F 6 HOH 144 644 644 HOH HOH A . F 6 HOH 145 645 645 HOH HOH A . F 6 HOH 146 646 646 HOH HOH A . F 6 HOH 147 647 647 HOH HOH A . F 6 HOH 148 648 648 HOH HOH A . F 6 HOH 149 649 649 HOH HOH A . F 6 HOH 150 650 650 HOH HOH A . F 6 HOH 151 651 651 HOH HOH A . F 6 HOH 152 652 652 HOH HOH A . F 6 HOH 153 653 653 HOH HOH A . F 6 HOH 154 654 654 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_900019 _pdbx_molecule_features.name N-acetyl-alpha-lactosamine _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class 'Glycan component' _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900019 _pdbx_molecule.asym_id C # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ASN _pdbx_struct_mod_residue.label_seq_id 17 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ASN _pdbx_struct_mod_residue.auth_seq_id 17 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ASN _pdbx_struct_mod_residue.details 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -28.2749198967 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 65.4648379272 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 606 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 127 ? A GLU 127 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 96.0 ? 2 OE2 ? A GLU 127 ? A GLU 127 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 165.4 ? 3 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 92.8 ? 4 OE2 ? A GLU 127 ? A GLU 127 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 91.6 ? 5 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 94.1 ? 6 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 99.4 ? 7 OE2 ? A GLU 127 ? A GLU 127 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 O ? F HOH . ? A HOH 535 ? 1_555 82.1 ? 8 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 O ? F HOH . ? A HOH 535 ? 1_555 88.5 ? 9 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 O ? F HOH . ? A HOH 535 ? 1_555 86.4 ? 10 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 O ? F HOH . ? A HOH 535 ? 1_555 173.5 ? 11 OE2 ? A GLU 127 ? A GLU 127 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 O ? F HOH . ? A HOH 536 ? 1_555 88.7 ? 12 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 O ? F HOH . ? A HOH 536 ? 1_555 175.3 ? 13 OD1 ? A ASP 136 ? A ASP 136 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 O ? F HOH . ? A HOH 536 ? 1_555 82.5 ? 14 NE2 ? A HIS 142 ? A HIS 142 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 O ? F HOH . ? A HOH 536 ? 1_555 86.6 ? 15 O ? F HOH . ? A HOH 535 ? 1_555 MN ? D MN . ? A MN 289 ? 1_555 O ? F HOH . ? A HOH 536 ? 1_555 91.3 ? 16 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 52.5 ? 17 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? A PHE 131 ? A PHE 131 ? 1_555 106.8 ? 18 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? A PHE 131 ? A PHE 131 ? 1_555 77.0 ? 19 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 OD1 ? A ASN 133 ? A ASN 133 ? 1_555 154.3 ? 20 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 OD1 ? A ASN 133 ? A ASN 133 ? 1_555 152.8 ? 21 O ? A PHE 131 ? A PHE 131 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 OD1 ? A ASN 133 ? A ASN 133 ? 1_555 89.9 ? 22 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 OD2 ? A ASP 136 ? A ASP 136 ? 1_555 78.9 ? 23 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 OD2 ? A ASP 136 ? A ASP 136 ? 1_555 116.3 ? 24 O ? A PHE 131 ? A PHE 131 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 OD2 ? A ASP 136 ? A ASP 136 ? 1_555 81.7 ? 25 OD1 ? A ASN 133 ? A ASN 133 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 OD2 ? A ASP 136 ? A ASP 136 ? 1_555 84.5 ? 26 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 533 ? 1_555 114.5 ? 27 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 533 ? 1_555 72.0 ? 28 O ? A PHE 131 ? A PHE 131 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 533 ? 1_555 89.5 ? 29 OD1 ? A ASN 133 ? A ASN 133 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 533 ? 1_555 84.4 ? 30 OD2 ? A ASP 136 ? A ASP 136 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 533 ? 1_555 165.8 ? 31 OD2 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 534 ? 1_555 75.5 ? 32 OD1 ? A ASP 129 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 534 ? 1_555 108.5 ? 33 O ? A PHE 131 ? A PHE 131 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 534 ? 1_555 173.9 ? 34 OD1 ? A ASN 133 ? A ASN 133 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 534 ? 1_555 86.1 ? 35 OD2 ? A ASP 136 ? A ASP 136 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 534 ? 1_555 93.3 ? 36 O ? F HOH . ? A HOH 533 ? 1_555 CA ? E CA . ? A CA 290 ? 1_555 O ? F HOH . ? A HOH 534 ? 1_555 94.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-05-06 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 5 'Structure model' 2 1 2023-08-02 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other 8 4 'Structure model' 'Structure summary' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Refinement description' 11 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' entity 4 4 'Structure model' entity_name_com 5 4 'Structure model' pdbx_branch_scheme 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_database_status 8 4 'Structure model' pdbx_entity_branch 9 4 'Structure model' pdbx_entity_branch_descriptor 10 4 'Structure model' pdbx_entity_branch_link 11 4 'Structure model' pdbx_entity_branch_list 12 4 'Structure model' pdbx_entity_nonpoly 13 4 'Structure model' pdbx_molecule_features 14 4 'Structure model' pdbx_nonpoly_scheme 15 4 'Structure model' pdbx_struct_assembly_gen 16 4 'Structure model' pdbx_struct_conn_angle 17 4 'Structure model' pdbx_struct_special_symmetry 18 4 'Structure model' struct_asym 19 4 'Structure model' struct_conn 20 4 'Structure model' struct_site 21 4 'Structure model' struct_site_gen 22 5 'Structure model' chem_comp 23 5 'Structure model' database_2 24 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_asym_id' 6 4 'Structure model' '_atom_site.auth_atom_id' 7 4 'Structure model' '_atom_site.auth_comp_id' 8 4 'Structure model' '_atom_site.auth_seq_id' 9 4 'Structure model' '_atom_site.label_asym_id' 10 4 'Structure model' '_atom_site.label_atom_id' 11 4 'Structure model' '_atom_site.label_comp_id' 12 4 'Structure model' '_atom_site.label_entity_id' 13 4 'Structure model' '_atom_site.occupancy' 14 4 'Structure model' '_atom_site.type_symbol' 15 4 'Structure model' '_chem_comp.name' 16 4 'Structure model' '_chem_comp.type' 17 4 'Structure model' '_pdbx_database_status.process_site' 18 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 32 4 'Structure model' '_pdbx_struct_conn_angle.value' 33 4 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 34 4 'Structure model' '_struct_conn.conn_type_id' 35 4 'Structure model' '_struct_conn.id' 36 4 'Structure model' '_struct_conn.pdbx_dist_value' 37 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 38 4 'Structure model' '_struct_conn.pdbx_role' 39 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 40 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 41 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 42 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 43 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 44 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 45 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 46 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 47 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 48 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 49 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 50 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 51 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 52 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 53 5 'Structure model' '_chem_comp.pdbx_synonyms' 54 5 'Structure model' '_database_2.pdbx_DOI' 55 5 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 CNS refinement 0.1 ? 2 X-PLOR refinement . ? 3 DENZO 'data reduction' . ? 4 SCALEPACK 'data scaling' . ? 5 X-PLOR phasing . ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 103 ? ? -98.46 -146.57 2 1 TYR A 106 ? ? 54.21 -134.79 3 1 LEU A 109 ? ? 56.18 17.35 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 ? NAG 301 n B 2 NAG 2 B NAG 2 ? NAG 303 n B 2 BMA 3 B BMA 3 ? MAN 304 n B 2 XYP 4 B XYP 4 ? XYS 305 n B 2 MAN 5 B MAN 5 ? MAN 306 n B 2 MAN 6 B MAN 6 ? MAN 307 n B 2 FUC 7 B FUC 7 ? FUC 302 n C 3 NDG 1 C NDG 1 ? NAG 401 n C 3 GAL 2 C GAL 2 ? GAL 402 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpb BMA 'COMMON NAME' GMML 1.0 b-D-mannopyranose BMA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Manp BMA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc NDG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAca NDG 'COMMON NAME' GMML 1.0 N-acetyl-a-D-glucopyranosamine NDG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-GlcpNAc NDG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc XYP 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DXylpb XYP 'COMMON NAME' GMML 1.0 b-D-xylopyranose XYP 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Xylp XYP 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Xyl # loop_ _pdbx_entity_branch.entity_id _pdbx_entity_branch.type 2 oligosaccharide 3 oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'DXylpb1-2[DManpa1-3][DManpa1-6]DManpb1-4DGlcpNAcb1-4[LFucpa1-3]DGlcpNAcb1-' 'Glycam Condensed Sequence' GMML 1.0 2 2 ;WURCS=2.0/5,7,6/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5][a1122h-1b_1-5][a212h-1b_1-5][a1122h-1a_1-5]/1-2-1-3-4-5-5/a3-b1_a4-c1_c4-d1_d2-e1_d3-f1_d6-g1 ; WURCS PDB2Glycan 1.1.0 3 2 ;[]{[(4+1)][b-D-GlcpNAc]{[(3+1)][a-L-Fucp]{}[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(2+1)][b-D-Xylp]{}[(3+1)][a-D-Manp]{}[(6+1)][a-D-Manp]{}}}}} ; LINUCS PDB-CARE ? 4 3 DGalpb1-4DGlcpNAca1-ROH 'Glycam Condensed Sequence' GMML 1.0 5 3 'WURCS=2.0/2,2,1/[a2122h-1a_1-5_2*NCC/3=O][a2112h-1b_1-5]/1-2/a4-b1' WURCS PDB2Glycan 1.1.0 6 3 '[][a-D-GlcpNAc]{[(4+1)][b-D-Galp]{}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 3 2 4 XYP C1 O1 3 BMA O2 HO2 sing ? 4 2 5 MAN C1 O1 3 BMA O3 HO3 sing ? 5 2 6 MAN C1 O1 3 BMA O6 HO6 sing ? 6 2 7 FUC C1 O1 1 NAG O3 HO3 sing ? 7 3 2 GAL C1 O1 1 NDG O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 BMA 3 n 2 XYP 4 n 2 MAN 5 n 2 MAN 6 n 2 FUC 7 n 3 NDG 1 n 3 GAL 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'MANGANESE (II) ION' MN 5 'CALCIUM ION' CA 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1LTE _pdbx_initial_refinement_model.details 'COMPLEX WITH LACTOSE, PDB ENTRY 1LTE' #