data_1AZJ # _entry.id 1AZJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AZJ pdb_00001azj 10.2210/pdb1azj/pdb WWPDB D_1000171446 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-29 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AZJ _pdbx_database_status.recvd_initial_deposition_date 1997-11-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Mattinen, M.-L.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Three-dimensional structures of three engineered cellulose-binding domains of cellobiohydrolase I from Trichoderma reesei.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 6 _citation.page_first 294 _citation.page_last 303 _citation.year 1997 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9041630 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mattinen, M.L.' 1 ? primary 'Kontteli, M.' 2 ? primary 'Kerovuo, J.' 3 ? primary 'Linder, M.' 4 ? primary 'Annila, A.' 5 ? primary 'Lindeberg, G.' 6 ? primary 'Reinikainen, T.' 7 ? primary 'Drakenberg, T.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CELLOBIOHYDROLASE I' _entity.formula_weight 3654.030 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.91 _entity.pdbx_mutation Y31A _entity.pdbx_fragment 'CELLULOSE-BINDING DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name CBD # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TQSHYGQCGGIGYSGPTVCASGTTCQVLNPAYSQCL _entity_poly.pdbx_seq_one_letter_code_can TQSHYGQCGGIGYSGPTVCASGTTCQVLNPAYSQCL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLN n 1 3 SER n 1 4 HIS n 1 5 TYR n 1 6 GLY n 1 7 GLN n 1 8 CYS n 1 9 GLY n 1 10 GLY n 1 11 ILE n 1 12 GLY n 1 13 TYR n 1 14 SER n 1 15 GLY n 1 16 PRO n 1 17 THR n 1 18 VAL n 1 19 CYS n 1 20 ALA n 1 21 SER n 1 22 GLY n 1 23 THR n 1 24 THR n 1 25 CYS n 1 26 GLN n 1 27 VAL n 1 28 LEU n 1 29 ASN n 1 30 PRO n 1 31 ALA n 1 32 TYR n 1 33 SER n 1 34 GLN n 1 35 CYS n 1 36 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Hypocrea _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hypocrea jecorina' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 51453 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n # _cell.entry_id 1AZJ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AZJ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1AZJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1AZJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1AZJ _struct.title ;THREE-DIMENSIONAL STRUCTURES OF THREE ENGINEERED CELLULOSE-BINDING DOMAINS OF CELLOBIOHYDROLASE I FROM TRICHODERMA REESEI, NMR, 18 STRUCTURES ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AZJ _struct_keywords.pdbx_keywords CELLULASE _struct_keywords.text 'CELLULASE, NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY, PROTEIN-CARBOHYDRATE INTERACTION, CELLULOSE DEGRADATION, HYDROLASE, GLYCOSIDASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GUX1_TRIRE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P62694 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MYRKLAVISAFLATARAQSACTLQSETHPPLTWQKCSSGGTCTQQTGSVVIDANWRWTHATNSSTNCYDGNTWSSTLCPD NETCAKNCCLDGAAYASTYGVTTSGNSLSIGFVTQSAQKNVGARLYLMASDTTYQEFTLLGNEFSFDVDVSQLPCGLNGA LYFVSMDADGGVSKYPTNTAGAKYGTGYCDSQCPRDLKFINGQANVEGWEPSSNNANTGIGGHGSCCSEMDIWEANSISE ALTPHPCTTVGQEICEGDGCGGTYSDNRYGGTCDPDGCDWNPYRLGNTSFYGPGSSFTLDTTKKLTVVTQFETSGAINRY YVQNGVTFQQPNAELGSYSGNELNDDYCTAEEAEFGGSSFSDKGGLTQFKKATSGGMVLVMSLWDDYYANMLWLDSTYPT NETSSTPGAVRGSCSTSSGVPAQVESQSPNAKVTFSNIKFGPIGSTGNPSGGNPPGGNRGTTTTRRPATTTGSSPGPTQS HYGQCGGIGYSGPTVCASGTTCQVLNPYYSQCL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AZJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62694 _struct_ref_seq.db_align_beg 478 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 513 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 36 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1AZJ _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 31 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P62694 _struct_ref_seq_dif.db_mon_id TYR _struct_ref_seq_dif.pdbx_seq_db_seq_num 508 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 31 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 8 A CYS 25 1_555 ? ? ? ? ? ? ? 2.145 ? ? disulf2 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 19 A CYS 35 1_555 ? ? ? ? ? ? ? 2.142 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 8 ? CYS A 25 ? CYS A 8 ? 1_555 CYS A 25 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 19 ? CYS A 35 ? CYS A 19 ? 1_555 CYS A 35 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 6 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 6 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLN _struct_mon_prot_cis.pdbx_label_seq_id_2 7 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLN _struct_mon_prot_cis.pdbx_auth_seq_id_2 7 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 16 _struct_mon_prot_cis.pdbx_omega_angle -6.53 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 7 ? GLY A 10 ? GLN A 7 GLY A 10 A 2 TYR A 32 ? GLN A 34 ? TYR A 32 GLN A 34 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 8 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 8 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id SER _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id SER _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # _pdbx_entry_details.entry_id 1AZJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 4 ? ? -38.59 132.55 2 1 TYR A 5 ? ? 70.05 -23.12 3 1 ILE A 11 ? ? -59.77 71.88 4 1 THR A 17 ? ? -71.76 32.04 5 1 VAL A 27 ? ? -140.37 50.75 6 2 TYR A 5 ? ? 69.83 -12.06 7 2 PRO A 16 ? ? -65.38 88.89 8 2 THR A 17 ? ? -72.90 31.88 9 2 ALA A 20 ? ? -67.23 96.47 10 2 SER A 21 ? ? -37.09 -13.71 11 2 PRO A 30 ? ? -65.82 17.76 12 2 SER A 33 ? ? 153.63 81.62 13 2 CYS A 35 ? ? -62.92 79.27 14 3 TYR A 5 ? ? 67.19 -13.73 15 3 ILE A 11 ? ? -54.19 109.04 16 3 TYR A 13 ? ? -65.97 -177.43 17 3 CYS A 25 ? ? -67.30 82.33 18 3 GLN A 26 ? ? -54.23 173.59 19 3 PRO A 30 ? ? -58.26 -9.31 20 3 CYS A 35 ? ? -64.67 84.13 21 4 TYR A 5 ? ? 67.53 -15.49 22 4 SER A 14 ? ? -157.98 85.07 23 4 GLN A 26 ? ? -66.40 93.30 24 4 VAL A 27 ? ? -61.59 68.23 25 4 CYS A 35 ? ? -67.55 78.79 26 5 TYR A 5 ? ? 65.37 -21.25 27 5 PRO A 16 ? ? -60.82 75.10 28 5 THR A 17 ? ? -60.71 32.96 29 5 SER A 21 ? ? -35.17 114.29 30 5 CYS A 25 ? ? -63.23 77.19 31 5 VAL A 27 ? ? -63.98 59.30 32 5 TYR A 32 ? ? -130.11 -158.02 33 5 SER A 33 ? ? 136.53 76.98 34 6 TYR A 5 ? ? 65.87 -8.00 35 6 PRO A 16 ? ? -61.61 84.28 36 6 THR A 17 ? ? -68.51 42.50 37 6 CYS A 25 ? ? -67.60 74.12 38 6 CYS A 35 ? ? -68.66 87.88 39 7 CYS A 8 ? ? -31.09 -39.16 40 7 ILE A 11 ? ? -74.01 27.30 41 7 PRO A 16 ? ? -65.54 69.64 42 7 THR A 17 ? ? -60.95 32.19 43 7 SER A 21 ? ? -34.04 103.04 44 7 VAL A 27 ? ? 30.49 63.08 45 8 TYR A 5 ? ? 73.08 -23.55 46 8 SER A 14 ? ? -151.60 4.82 47 8 CYS A 25 ? ? -58.08 81.17 48 8 VAL A 27 ? ? -53.91 76.50 49 9 ILE A 11 ? ? -53.23 108.49 50 9 TYR A 13 ? ? -62.01 -179.84 51 9 SER A 21 ? ? -39.30 113.01 52 9 CYS A 25 ? ? -68.84 84.03 53 9 GLN A 26 ? ? -55.63 171.23 54 9 CYS A 35 ? ? -63.90 85.80 55 10 CYS A 8 ? ? -154.80 -13.89 56 10 ASN A 29 ? ? -171.82 144.79 57 10 SER A 33 ? ? 158.79 112.94 58 11 TYR A 5 ? ? 66.89 -11.11 59 11 PRO A 16 ? ? -65.98 80.46 60 11 THR A 17 ? ? -63.79 33.15 61 11 CYS A 35 ? ? -66.46 84.24 62 12 CYS A 8 ? ? -16.07 -59.62 63 12 CYS A 25 ? ? -63.46 75.81 64 12 VAL A 27 ? ? -56.18 94.37 65 12 CYS A 35 ? ? -65.30 79.67 66 13 TYR A 5 ? ? 67.10 -13.16 67 13 THR A 17 ? ? -71.18 25.82 68 13 GLN A 26 ? ? -57.79 178.28 69 13 VAL A 27 ? ? -145.59 49.95 70 13 CYS A 35 ? ? -67.27 84.97 71 14 HIS A 4 ? ? -38.16 132.03 72 14 TYR A 5 ? ? 67.65 -27.52 73 14 CYS A 8 ? ? -144.67 28.36 74 14 CYS A 25 ? ? -69.46 77.32 75 14 VAL A 27 ? ? -56.90 93.86 76 15 GLN A 7 ? ? -67.73 63.93 77 15 CYS A 8 ? ? -66.24 43.73 78 15 ILE A 11 ? ? -50.63 108.45 79 15 VAL A 18 ? ? -50.22 107.29 80 15 VAL A 27 ? ? 39.45 46.24 81 15 CYS A 35 ? ? -66.07 95.13 82 16 TYR A 5 ? ? 63.39 65.57 83 16 ILE A 11 ? ? -51.43 108.49 84 16 CYS A 25 ? ? -64.76 86.42 85 16 LEU A 28 ? ? -152.68 -53.43 86 17 GLN A 7 ? ? -66.72 72.73 87 17 PRO A 16 ? ? -67.73 80.97 88 17 THR A 17 ? ? -70.73 33.00 89 17 SER A 33 ? ? -163.74 111.18 90 17 CYS A 35 ? ? -61.79 88.88 91 18 TYR A 5 ? ? 58.39 -11.49 92 18 GLN A 7 ? ? -68.42 76.51 93 18 TYR A 13 ? ? -55.69 171.50 94 18 PRO A 16 ? ? -47.03 100.26 95 18 CYS A 25 ? ? -57.52 88.85 96 18 VAL A 27 ? ? 34.53 52.93 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 2 ILE A 11 ? ? GLY A 12 ? ? -145.93 2 5 ILE A 11 ? ? GLY A 12 ? ? -145.07 3 5 GLY A 12 ? ? TYR A 13 ? ? 137.60 4 6 ILE A 11 ? ? GLY A 12 ? ? -147.00 5 6 GLY A 12 ? ? TYR A 13 ? ? 144.34 6 7 GLY A 10 ? ? ILE A 11 ? ? -128.43 7 7 ILE A 11 ? ? GLY A 12 ? ? 138.23 8 7 TYR A 32 ? ? SER A 33 ? ? 146.08 9 8 ILE A 11 ? ? GLY A 12 ? ? -142.11 10 8 GLY A 12 ? ? TYR A 13 ? ? 141.98 11 8 TYR A 32 ? ? SER A 33 ? ? 149.22 12 9 TYR A 32 ? ? SER A 33 ? ? 148.94 13 10 THR A 1 ? ? GLN A 2 ? ? 147.52 14 11 GLY A 12 ? ? TYR A 13 ? ? 140.11 15 12 GLY A 12 ? ? TYR A 13 ? ? 137.99 16 12 TYR A 32 ? ? SER A 33 ? ? 148.62 17 13 ILE A 11 ? ? GLY A 12 ? ? -148.57 18 13 GLY A 12 ? ? TYR A 13 ? ? 145.55 19 14 ILE A 11 ? ? GLY A 12 ? ? -149.66 20 14 TYR A 32 ? ? SER A 33 ? ? 145.01 21 15 GLY A 9 ? ? GLY A 10 ? ? 148.70 22 15 GLY A 12 ? ? TYR A 13 ? ? 145.89 23 16 ILE A 11 ? ? GLY A 12 ? ? -147.75 24 16 GLY A 12 ? ? TYR A 13 ? ? 139.66 25 17 GLY A 12 ? ? TYR A 13 ? ? 139.57 26 18 CYS A 25 ? ? GLN A 26 ? ? -149.23 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 TYR A 13 ? ? 0.167 'SIDE CHAIN' 2 3 TYR A 32 ? ? 0.085 'SIDE CHAIN' 3 4 TYR A 13 ? ? 0.162 'SIDE CHAIN' 4 4 TYR A 32 ? ? 0.083 'SIDE CHAIN' 5 5 TYR A 32 ? ? 0.113 'SIDE CHAIN' 6 6 TYR A 32 ? ? 0.120 'SIDE CHAIN' 7 8 TYR A 5 ? ? 0.082 'SIDE CHAIN' 8 8 TYR A 13 ? ? 0.183 'SIDE CHAIN' 9 8 TYR A 32 ? ? 0.086 'SIDE CHAIN' 10 9 TYR A 13 ? ? 0.142 'SIDE CHAIN' 11 9 TYR A 32 ? ? 0.139 'SIDE CHAIN' 12 10 TYR A 13 ? ? 0.126 'SIDE CHAIN' 13 11 TYR A 13 ? ? 0.072 'SIDE CHAIN' 14 11 TYR A 32 ? ? 0.119 'SIDE CHAIN' 15 14 TYR A 13 ? ? 0.116 'SIDE CHAIN' 16 14 TYR A 32 ? ? 0.091 'SIDE CHAIN' 17 15 TYR A 13 ? ? 0.097 'SIDE CHAIN' 18 16 TYR A 13 ? ? 0.142 'SIDE CHAIN' 19 16 TYR A 32 ? ? 0.080 'SIDE CHAIN' 20 17 TYR A 32 ? ? 0.086 'SIDE CHAIN' 21 18 TYR A 13 ? ? 0.131 'SIDE CHAIN' 22 18 TYR A 32 ? ? 0.143 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1AZJ _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 18 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 3.9 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 TOCSY 1 2 1 COSY 1 3 1 NOESY 1 4 1 RELAY-COSY 1 # _pdbx_nmr_refine.entry_id 1AZJ _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement SA/MD ? CLORE,NILGES 1 'structure solution' 'BIOSYM TECHNOLOGIES' TECHNOLOGIES ? 2 'structure solution' Felix ? ? 3 'structure solution' 'Insight II' ? ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 CYS N N N N 31 CYS CA C N R 32 CYS C C N N 33 CYS O O N N 34 CYS CB C N N 35 CYS SG S N N 36 CYS OXT O N N 37 CYS H H N N 38 CYS H2 H N N 39 CYS HA H N N 40 CYS HB2 H N N 41 CYS HB3 H N N 42 CYS HG H N N 43 CYS HXT H N N 44 GLN N N N N 45 GLN CA C N S 46 GLN C C N N 47 GLN O O N N 48 GLN CB C N N 49 GLN CG C N N 50 GLN CD C N N 51 GLN OE1 O N N 52 GLN NE2 N N N 53 GLN OXT O N N 54 GLN H H N N 55 GLN H2 H N N 56 GLN HA H N N 57 GLN HB2 H N N 58 GLN HB3 H N N 59 GLN HG2 H N N 60 GLN HG3 H N N 61 GLN HE21 H N N 62 GLN HE22 H N N 63 GLN HXT H N N 64 GLY N N N N 65 GLY CA C N N 66 GLY C C N N 67 GLY O O N N 68 GLY OXT O N N 69 GLY H H N N 70 GLY H2 H N N 71 GLY HA2 H N N 72 GLY HA3 H N N 73 GLY HXT H N N 74 HIS N N N N 75 HIS CA C N S 76 HIS C C N N 77 HIS O O N N 78 HIS CB C N N 79 HIS CG C Y N 80 HIS ND1 N Y N 81 HIS CD2 C Y N 82 HIS CE1 C Y N 83 HIS NE2 N Y N 84 HIS OXT O N N 85 HIS H H N N 86 HIS H2 H N N 87 HIS HA H N N 88 HIS HB2 H N N 89 HIS HB3 H N N 90 HIS HD1 H N N 91 HIS HD2 H N N 92 HIS HE1 H N N 93 HIS HE2 H N N 94 HIS HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 PRO N N N N 140 PRO CA C N S 141 PRO C C N N 142 PRO O O N N 143 PRO CB C N N 144 PRO CG C N N 145 PRO CD C N N 146 PRO OXT O N N 147 PRO H H N N 148 PRO HA H N N 149 PRO HB2 H N N 150 PRO HB3 H N N 151 PRO HG2 H N N 152 PRO HG3 H N N 153 PRO HD2 H N N 154 PRO HD3 H N N 155 PRO HXT H N N 156 SER N N N N 157 SER CA C N S 158 SER C C N N 159 SER O O N N 160 SER CB C N N 161 SER OG O N N 162 SER OXT O N N 163 SER H H N N 164 SER H2 H N N 165 SER HA H N N 166 SER HB2 H N N 167 SER HB3 H N N 168 SER HG H N N 169 SER HXT H N N 170 THR N N N N 171 THR CA C N S 172 THR C C N N 173 THR O O N N 174 THR CB C N R 175 THR OG1 O N N 176 THR CG2 C N N 177 THR OXT O N N 178 THR H H N N 179 THR H2 H N N 180 THR HA H N N 181 THR HB H N N 182 THR HG1 H N N 183 THR HG21 H N N 184 THR HG22 H N N 185 THR HG23 H N N 186 THR HXT H N N 187 TYR N N N N 188 TYR CA C N S 189 TYR C C N N 190 TYR O O N N 191 TYR CB C N N 192 TYR CG C Y N 193 TYR CD1 C Y N 194 TYR CD2 C Y N 195 TYR CE1 C Y N 196 TYR CE2 C Y N 197 TYR CZ C Y N 198 TYR OH O N N 199 TYR OXT O N N 200 TYR H H N N 201 TYR H2 H N N 202 TYR HA H N N 203 TYR HB2 H N N 204 TYR HB3 H N N 205 TYR HD1 H N N 206 TYR HD2 H N N 207 TYR HE1 H N N 208 TYR HE2 H N N 209 TYR HH H N N 210 TYR HXT H N N 211 VAL N N N N 212 VAL CA C N S 213 VAL C C N N 214 VAL O O N N 215 VAL CB C N N 216 VAL CG1 C N N 217 VAL CG2 C N N 218 VAL OXT O N N 219 VAL H H N N 220 VAL H2 H N N 221 VAL HA H N N 222 VAL HB H N N 223 VAL HG11 H N N 224 VAL HG12 H N N 225 VAL HG13 H N N 226 VAL HG21 H N N 227 VAL HG22 H N N 228 VAL HG23 H N N 229 VAL HXT H N N 230 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 CYS N CA sing N N 29 CYS N H sing N N 30 CYS N H2 sing N N 31 CYS CA C sing N N 32 CYS CA CB sing N N 33 CYS CA HA sing N N 34 CYS C O doub N N 35 CYS C OXT sing N N 36 CYS CB SG sing N N 37 CYS CB HB2 sing N N 38 CYS CB HB3 sing N N 39 CYS SG HG sing N N 40 CYS OXT HXT sing N N 41 GLN N CA sing N N 42 GLN N H sing N N 43 GLN N H2 sing N N 44 GLN CA C sing N N 45 GLN CA CB sing N N 46 GLN CA HA sing N N 47 GLN C O doub N N 48 GLN C OXT sing N N 49 GLN CB CG sing N N 50 GLN CB HB2 sing N N 51 GLN CB HB3 sing N N 52 GLN CG CD sing N N 53 GLN CG HG2 sing N N 54 GLN CG HG3 sing N N 55 GLN CD OE1 doub N N 56 GLN CD NE2 sing N N 57 GLN NE2 HE21 sing N N 58 GLN NE2 HE22 sing N N 59 GLN OXT HXT sing N N 60 GLY N CA sing N N 61 GLY N H sing N N 62 GLY N H2 sing N N 63 GLY CA C sing N N 64 GLY CA HA2 sing N N 65 GLY CA HA3 sing N N 66 GLY C O doub N N 67 GLY C OXT sing N N 68 GLY OXT HXT sing N N 69 HIS N CA sing N N 70 HIS N H sing N N 71 HIS N H2 sing N N 72 HIS CA C sing N N 73 HIS CA CB sing N N 74 HIS CA HA sing N N 75 HIS C O doub N N 76 HIS C OXT sing N N 77 HIS CB CG sing N N 78 HIS CB HB2 sing N N 79 HIS CB HB3 sing N N 80 HIS CG ND1 sing Y N 81 HIS CG CD2 doub Y N 82 HIS ND1 CE1 doub Y N 83 HIS ND1 HD1 sing N N 84 HIS CD2 NE2 sing Y N 85 HIS CD2 HD2 sing N N 86 HIS CE1 NE2 sing Y N 87 HIS CE1 HE1 sing N N 88 HIS NE2 HE2 sing N N 89 HIS OXT HXT sing N N 90 ILE N CA sing N N 91 ILE N H sing N N 92 ILE N H2 sing N N 93 ILE CA C sing N N 94 ILE CA CB sing N N 95 ILE CA HA sing N N 96 ILE C O doub N N 97 ILE C OXT sing N N 98 ILE CB CG1 sing N N 99 ILE CB CG2 sing N N 100 ILE CB HB sing N N 101 ILE CG1 CD1 sing N N 102 ILE CG1 HG12 sing N N 103 ILE CG1 HG13 sing N N 104 ILE CG2 HG21 sing N N 105 ILE CG2 HG22 sing N N 106 ILE CG2 HG23 sing N N 107 ILE CD1 HD11 sing N N 108 ILE CD1 HD12 sing N N 109 ILE CD1 HD13 sing N N 110 ILE OXT HXT sing N N 111 LEU N CA sing N N 112 LEU N H sing N N 113 LEU N H2 sing N N 114 LEU CA C sing N N 115 LEU CA CB sing N N 116 LEU CA HA sing N N 117 LEU C O doub N N 118 LEU C OXT sing N N 119 LEU CB CG sing N N 120 LEU CB HB2 sing N N 121 LEU CB HB3 sing N N 122 LEU CG CD1 sing N N 123 LEU CG CD2 sing N N 124 LEU CG HG sing N N 125 LEU CD1 HD11 sing N N 126 LEU CD1 HD12 sing N N 127 LEU CD1 HD13 sing N N 128 LEU CD2 HD21 sing N N 129 LEU CD2 HD22 sing N N 130 LEU CD2 HD23 sing N N 131 LEU OXT HXT sing N N 132 PRO N CA sing N N 133 PRO N CD sing N N 134 PRO N H sing N N 135 PRO CA C sing N N 136 PRO CA CB sing N N 137 PRO CA HA sing N N 138 PRO C O doub N N 139 PRO C OXT sing N N 140 PRO CB CG sing N N 141 PRO CB HB2 sing N N 142 PRO CB HB3 sing N N 143 PRO CG CD sing N N 144 PRO CG HG2 sing N N 145 PRO CG HG3 sing N N 146 PRO CD HD2 sing N N 147 PRO CD HD3 sing N N 148 PRO OXT HXT sing N N 149 SER N CA sing N N 150 SER N H sing N N 151 SER N H2 sing N N 152 SER CA C sing N N 153 SER CA CB sing N N 154 SER CA HA sing N N 155 SER C O doub N N 156 SER C OXT sing N N 157 SER CB OG sing N N 158 SER CB HB2 sing N N 159 SER CB HB3 sing N N 160 SER OG HG sing N N 161 SER OXT HXT sing N N 162 THR N CA sing N N 163 THR N H sing N N 164 THR N H2 sing N N 165 THR CA C sing N N 166 THR CA CB sing N N 167 THR CA HA sing N N 168 THR C O doub N N 169 THR C OXT sing N N 170 THR CB OG1 sing N N 171 THR CB CG2 sing N N 172 THR CB HB sing N N 173 THR OG1 HG1 sing N N 174 THR CG2 HG21 sing N N 175 THR CG2 HG22 sing N N 176 THR CG2 HG23 sing N N 177 THR OXT HXT sing N N 178 TYR N CA sing N N 179 TYR N H sing N N 180 TYR N H2 sing N N 181 TYR CA C sing N N 182 TYR CA CB sing N N 183 TYR CA HA sing N N 184 TYR C O doub N N 185 TYR C OXT sing N N 186 TYR CB CG sing N N 187 TYR CB HB2 sing N N 188 TYR CB HB3 sing N N 189 TYR CG CD1 doub Y N 190 TYR CG CD2 sing Y N 191 TYR CD1 CE1 sing Y N 192 TYR CD1 HD1 sing N N 193 TYR CD2 CE2 doub Y N 194 TYR CD2 HD2 sing N N 195 TYR CE1 CZ doub Y N 196 TYR CE1 HE1 sing N N 197 TYR CE2 CZ sing Y N 198 TYR CE2 HE2 sing N N 199 TYR CZ OH sing N N 200 TYR OH HH sing N N 201 TYR OXT HXT sing N N 202 VAL N CA sing N N 203 VAL N H sing N N 204 VAL N H2 sing N N 205 VAL CA C sing N N 206 VAL CA CB sing N N 207 VAL CA HA sing N N 208 VAL C O doub N N 209 VAL C OXT sing N N 210 VAL CB CG1 sing N N 211 VAL CB CG2 sing N N 212 VAL CB HB sing N N 213 VAL CG1 HG11 sing N N 214 VAL CG1 HG12 sing N N 215 VAL CG1 HG13 sing N N 216 VAL CG2 HG21 sing N N 217 VAL CG2 HG22 sing N N 218 VAL CG2 HG23 sing N N 219 VAL OXT HXT sing N N 220 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'VARIAN UNITY 600' _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1AZJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #