data_1B53 # _entry.id 1B53 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1B53 pdb_00001b53 10.2210/pdb1b53/pdb WWPDB D_1000171482 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1B53 _pdbx_database_status.recvd_initial_deposition_date 1999-01-11 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Waltho, J.P.' 1 'Higgins, L.D.' 2 'Craven, C.J.' 3 'Tan, P.' 4 'Dudgeon, T.' 5 # _citation.id primary _citation.title ;Identification of amino acid residues critical for aggregation of human CC chemokines macrophage inflammatory protein (MIP)-1alpha, MIP-1beta, and RANTES. Characterization of active disaggregated chemokine variants. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 274 _citation.page_first 16077 _citation.page_last 16084 _citation.year 1999 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10347159 _citation.pdbx_database_id_DOI 10.1074/jbc.274.23.16077 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Czaplewski, L.G.' 1 ? primary 'McKeating, J.' 2 ? primary 'Craven, C.J.' 3 ? primary 'Higgins, L.D.' 4 ? primary 'Appay, V.' 5 ? primary 'Brown, A.' 6 ? primary 'Dudgeon, T.' 7 ? primary 'Howard, L.A.' 8 ? primary 'Meyers, T.' 9 ? primary 'Owen, J.' 10 ? primary 'Palan, S.R.' 11 ? primary 'Tan, P.' 12 ? primary 'Wilson, G.' 13 ? primary 'Woods, N.R.' 14 ? primary 'Heyworth, C.M.' 15 ? primary 'Lord, B.I.' 16 ? primary 'Brotherton, D.' 17 ? primary 'Christison, R.' 18 ? primary 'Craig, S.' 19 ? primary 'Cribbes, S.' 20 ? primary 'Edwards, R.M.' 21 ? primary 'Evans, S.J.' 22 ? primary 'Gilbert, R.' 23 ? primary 'Morgan, P.' 24 ? primary 'Randle, E.' 25 ? primary 'Schofield, N.' 26 ? primary 'Varley, P.G.' 27 ? primary 'Fisher, J.' 28 ? primary 'Waltho, J.P.' 29 ? primary 'Hunter, M.G.' 30 ? # _cell.entry_id 1B53 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1B53 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description MIP-1A _entity.formula_weight 7678.577 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation D26A _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA _entity_poly.pdbx_seq_one_letter_code_can SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 ALA n 1 4 ALA n 1 5 ASP n 1 6 THR n 1 7 PRO n 1 8 THR n 1 9 ALA n 1 10 CYS n 1 11 CYS n 1 12 PHE n 1 13 SER n 1 14 TYR n 1 15 THR n 1 16 SER n 1 17 ARG n 1 18 GLN n 1 19 ILE n 1 20 PRO n 1 21 GLN n 1 22 ASN n 1 23 PHE n 1 24 ILE n 1 25 ALA n 1 26 ALA n 1 27 TYR n 1 28 PHE n 1 29 GLU n 1 30 THR n 1 31 SER n 1 32 SER n 1 33 GLN n 1 34 CYS n 1 35 SER n 1 36 LYS n 1 37 PRO n 1 38 GLY n 1 39 VAL n 1 40 ILE n 1 41 PHE n 1 42 LEU n 1 43 THR n 1 44 LYS n 1 45 ARG n 1 46 SER n 1 47 ARG n 1 48 GLN n 1 49 VAL n 1 50 CYS n 1 51 ALA n 1 52 ASP n 1 53 PRO n 1 54 SER n 1 55 GLU n 1 56 GLU n 1 57 TRP n 1 58 VAL n 1 59 GLN n 1 60 LYS n 1 61 TYR n 1 62 VAL n 1 63 SER n 1 64 ASP n 1 65 LEU n 1 66 GLU n 1 67 LEU n 1 68 SER n 1 69 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus Pichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCL3_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P10147 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEW VQKYVSDLELSA ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1B53 A 1 ? 69 ? P10147 24 ? 92 ? 1 69 2 1 1B53 B 1 ? 69 ? P10147 24 ? 92 ? 1 69 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1B53 ALA A 26 ? UNP P10147 ASP 49 'engineered mutation' 26 1 2 1B53 ALA B 26 ? UNP P10147 ASP 49 'engineered mutation' 26 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 ST 1 2 1 'ARD HETERONUCLEAR TECHNIQUES' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'NO ADDED SALT' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '10% H2O/90% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1B53 _pdbx_nmr_refine.method 'SIMULATED ANNEALING STARTING FROM RANDOM ATOM POSITIONS' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1B53 _pdbx_nmr_details.text ;MEAN STRUCTURE. THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELLED MIP-1A. ADDITIONAL INTERMONOMER CONSTRAINTS WERE ACQUIRED USING A MIXED 13C/15N-12C/14N SAMPLE. ; # _pdbx_nmr_ensemble.entry_id 1B53 _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 1B53 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1B53 _struct.title 'NMR STRUCTURE OF HUMAN MIP-1A D26A, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1B53 _struct_keywords.pdbx_keywords CHEMOKINE _struct_keywords.text 'CHEMOKINE, CYTOKINE, CHEMOTAXIS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 21 ? PHE A 23 ? GLN A 21 PHE A 23 5 ? 3 HELX_P HELX_P2 2 VAL A 58 ? SER A 63 ? VAL A 58 SER A 63 1 ? 6 HELX_P HELX_P3 3 GLN B 21 ? PHE B 23 ? GLN B 21 PHE B 23 5 ? 3 HELX_P HELX_P4 4 VAL B 58 ? SER B 63 ? VAL B 58 SER B 63 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 10 A CYS 34 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 B CYS 10 SG ? ? A CYS 10 B CYS 10 1_555 ? ? ? ? ? ? ? 2.717 ? ? disulf3 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 11 A CYS 50 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf4 disulf ? ? A CYS 34 SG ? ? ? 1_555 B CYS 10 SG ? ? A CYS 34 B CYS 10 1_555 ? ? ? ? ? ? ? 2.953 ? ? disulf5 disulf ? ? A CYS 34 SG ? ? ? 1_555 B CYS 34 SG ? ? A CYS 34 B CYS 34 1_555 ? ? ? ? ? ? ? 2.973 ? ? disulf6 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 34 SG ? ? B CYS 10 B CYS 34 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf7 disulf ? ? B CYS 11 SG ? ? ? 1_555 B CYS 50 SG ? ? B CYS 11 B CYS 50 1_555 ? ? ? ? ? ? ? 2.022 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1B53 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1B53 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ALA 69 69 69 ALA ALA A . n B 1 1 SER 1 1 1 SER SER B . n B 1 2 LEU 2 2 2 LEU LEU B . n B 1 3 ALA 3 3 3 ALA ALA B . n B 1 4 ALA 4 4 4 ALA ALA B . n B 1 5 ASP 5 5 5 ASP ASP B . n B 1 6 THR 6 6 6 THR THR B . n B 1 7 PRO 7 7 7 PRO PRO B . n B 1 8 THR 8 8 8 THR THR B . n B 1 9 ALA 9 9 9 ALA ALA B . n B 1 10 CYS 10 10 10 CYS CYS B . n B 1 11 CYS 11 11 11 CYS CYS B . n B 1 12 PHE 12 12 12 PHE PHE B . n B 1 13 SER 13 13 13 SER SER B . n B 1 14 TYR 14 14 14 TYR TYR B . n B 1 15 THR 15 15 15 THR THR B . n B 1 16 SER 16 16 16 SER SER B . n B 1 17 ARG 17 17 17 ARG ARG B . n B 1 18 GLN 18 18 18 GLN GLN B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 PRO 20 20 20 PRO PRO B . n B 1 21 GLN 21 21 21 GLN GLN B . n B 1 22 ASN 22 22 22 ASN ASN B . n B 1 23 PHE 23 23 23 PHE PHE B . n B 1 24 ILE 24 24 24 ILE ILE B . n B 1 25 ALA 25 25 25 ALA ALA B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 TYR 27 27 27 TYR TYR B . n B 1 28 PHE 28 28 28 PHE PHE B . n B 1 29 GLU 29 29 29 GLU GLU B . n B 1 30 THR 30 30 30 THR THR B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 GLN 33 33 33 GLN GLN B . n B 1 34 CYS 34 34 34 CYS CYS B . n B 1 35 SER 35 35 35 SER SER B . n B 1 36 LYS 36 36 36 LYS LYS B . n B 1 37 PRO 37 37 37 PRO PRO B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 ILE 40 40 40 ILE ILE B . n B 1 41 PHE 41 41 41 PHE PHE B . n B 1 42 LEU 42 42 42 LEU LEU B . n B 1 43 THR 43 43 43 THR THR B . n B 1 44 LYS 44 44 44 LYS LYS B . n B 1 45 ARG 45 45 45 ARG ARG B . n B 1 46 SER 46 46 46 SER SER B . n B 1 47 ARG 47 47 47 ARG ARG B . n B 1 48 GLN 48 48 48 GLN GLN B . n B 1 49 VAL 49 49 49 VAL VAL B . n B 1 50 CYS 50 50 50 CYS CYS B . n B 1 51 ALA 51 51 51 ALA ALA B . n B 1 52 ASP 52 52 52 ASP ASP B . n B 1 53 PRO 53 53 53 PRO PRO B . n B 1 54 SER 54 54 54 SER SER B . n B 1 55 GLU 55 55 55 GLU GLU B . n B 1 56 GLU 56 56 56 GLU GLU B . n B 1 57 TRP 57 57 57 TRP TRP B . n B 1 58 VAL 58 58 58 VAL VAL B . n B 1 59 GLN 59 59 59 GLN GLN B . n B 1 60 LYS 60 60 60 LYS LYS B . n B 1 61 TYR 61 61 61 TYR TYR B . n B 1 62 VAL 62 62 62 VAL VAL B . n B 1 63 SER 63 63 63 SER SER B . n B 1 64 ASP 64 64 64 ASP ASP B . n B 1 65 LEU 65 65 65 LEU LEU B . n B 1 66 GLU 66 66 66 GLU GLU B . n B 1 67 LEU 67 67 67 LEU LEU B . n B 1 68 SER 68 68 68 SER SER B . n B 1 69 ALA 69 69 69 ALA ALA B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-07-22 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-02-22 5 'Structure model' 1 4 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Database references' 5 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.process_site' 4 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB3 A SER 13 ? ? HB2 B ALA 4 ? ? 1.12 2 1 HB2 A SER 13 ? ? O B ALA 4 ? ? 1.27 3 1 HD2 A PHE 12 ? ? OG1 B THR 8 ? ? 1.57 4 1 CB A SER 13 ? ? O B ALA 4 ? ? 2.17 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 14 ? ? CG A TYR 14 ? ? CD2 A TYR 14 ? ? 110.43 121.00 -10.57 0.60 N 2 1 CD1 A TYR 14 ? ? CG A TYR 14 ? ? CD2 A TYR 14 ? ? 50.42 117.90 -67.48 1.10 N 3 1 CB A TYR 14 ? ? CG A TYR 14 ? ? CD1 A TYR 14 ? ? 136.00 121.00 15.00 0.60 N 4 1 CG A TYR 14 ? ? CD1 A TYR 14 ? ? CE1 A TYR 14 ? ? 77.32 121.30 -43.98 0.80 N 5 1 CG A TYR 14 ? ? CD2 A TYR 14 ? ? CE2 A TYR 14 ? ? 75.64 121.30 -45.66 0.80 N 6 1 CD1 A TYR 14 ? ? CE1 A TYR 14 ? ? CZ A TYR 14 ? ? 75.64 119.80 -44.16 0.90 N 7 1 CE1 A TYR 14 ? ? CZ A TYR 14 ? ? CE2 A TYR 14 ? ? 51.00 119.80 -68.80 1.60 N 8 1 CZ A TYR 14 ? ? CE2 A TYR 14 ? ? CD2 A TYR 14 ? ? 77.39 119.80 -42.41 0.90 N 9 1 CB B TYR 14 ? ? CG B TYR 14 ? ? CD2 B TYR 14 ? ? 110.44 121.00 -10.56 0.60 N 10 1 CD1 B TYR 14 ? ? CG B TYR 14 ? ? CD2 B TYR 14 ? ? 50.41 117.90 -67.49 1.10 N 11 1 CB B TYR 14 ? ? CG B TYR 14 ? ? CD1 B TYR 14 ? ? 135.98 121.00 14.98 0.60 N 12 1 CG B TYR 14 ? ? CD1 B TYR 14 ? ? CE1 B TYR 14 ? ? 77.32 121.30 -43.98 0.80 N 13 1 CG B TYR 14 ? ? CD2 B TYR 14 ? ? CE2 B TYR 14 ? ? 75.66 121.30 -45.64 0.80 N 14 1 CD1 B TYR 14 ? ? CE1 B TYR 14 ? ? CZ B TYR 14 ? ? 75.64 119.80 -44.16 0.90 N 15 1 CE1 B TYR 14 ? ? CZ B TYR 14 ? ? CE2 B TYR 14 ? ? 51.02 119.80 -68.78 1.60 N 16 1 CZ B TYR 14 ? ? CE2 B TYR 14 ? ? CD2 B TYR 14 ? ? 77.40 119.80 -42.40 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 2 ? ? -161.13 -155.36 2 1 ALA A 3 ? ? -62.46 -142.75 3 1 THR A 6 ? ? 160.24 126.00 4 1 THR A 8 ? ? -53.22 90.84 5 1 ALA A 9 ? ? -48.22 108.43 6 1 CYS A 11 ? ? -101.23 77.60 7 1 ALA A 25 ? ? -149.50 -38.65 8 1 ALA A 26 ? ? -109.34 -145.80 9 1 TYR A 27 ? ? 178.78 -43.50 10 1 PHE A 28 ? ? 46.99 -173.53 11 1 GLU A 29 ? ? -164.17 39.01 12 1 THR A 30 ? ? 42.37 -143.67 13 1 SER A 31 ? ? -177.77 -166.09 14 1 GLN A 33 ? ? 78.31 -29.84 15 1 LYS A 36 ? ? -116.01 77.93 16 1 PRO A 37 ? ? -82.15 31.03 17 1 THR A 43 ? ? -41.61 159.53 18 1 SER A 46 ? ? 45.87 25.53 19 1 SER A 54 ? ? -166.73 35.87 20 1 LEU A 67 ? ? 171.42 64.08 21 1 LEU B 2 ? ? -161.18 -155.44 22 1 ALA B 3 ? ? -62.40 -142.74 23 1 THR B 6 ? ? 160.30 125.99 24 1 THR B 8 ? ? -53.23 90.85 25 1 ALA B 9 ? ? -48.14 108.40 26 1 CYS B 11 ? ? -101.23 77.62 27 1 ALA B 25 ? ? -149.52 -38.64 28 1 ALA B 26 ? ? -109.34 -145.77 29 1 TYR B 27 ? ? 178.76 -43.46 30 1 PHE B 28 ? ? 47.22 -173.56 31 1 GLU B 29 ? ? -164.21 38.99 32 1 THR B 30 ? ? 42.39 -143.68 33 1 SER B 31 ? ? -177.79 -166.09 34 1 GLN B 33 ? ? 78.28 -29.84 35 1 LYS B 36 ? ? -115.94 77.89 36 1 PRO B 37 ? ? -82.11 31.03 37 1 THR B 43 ? ? -41.59 159.46 38 1 SER B 46 ? ? 45.88 25.51 39 1 SER B 54 ? ? -166.79 35.91 40 1 LEU B 67 ? ? 171.38 64.08 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 14 ? ? 0.445 'SIDE CHAIN' 2 1 ARG A 45 ? ? 0.283 'SIDE CHAIN' 3 1 ARG A 47 ? ? 0.295 'SIDE CHAIN' 4 1 TYR B 14 ? ? 0.445 'SIDE CHAIN' 5 1 ARG B 45 ? ? 0.283 'SIDE CHAIN' 6 1 ARG B 47 ? ? 0.295 'SIDE CHAIN' #