data_1B5B # _entry.id 1B5B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.390 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1B5B pdb_00001b5b 10.2210/pdb1b5b/pdb WWPDB D_1000171487 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-06-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2018-08-08 6 'Structure model' 1 5 2024-04-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Experimental preparation' 7 5 'Structure model' 'Source and taxonomy' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type 6 5 'Structure model' entity_src_gen 7 5 'Structure model' pdbx_nmr_details 8 5 'Structure model' pdbx_nmr_exptl_sample 9 5 'Structure model' pdbx_nmr_exptl_sample_conditions 10 5 'Structure model' pdbx_nmr_representative 11 5 'Structure model' pdbx_nmr_sample_details 12 5 'Structure model' pdbx_nmr_software 13 5 'Structure model' pdbx_nmr_spectrometer 14 6 'Structure model' chem_comp_atom 15 6 'Structure model' chem_comp_bond 16 6 'Structure model' database_2 17 6 'Structure model' struct_conn 18 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_entity_src_gen.gene_src_genus' 3 5 'Structure model' '_entity_src_gen.host_org_genus' 4 5 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' 5 5 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 6 5 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 7 5 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 8 5 'Structure model' '_entity_src_gen.pdbx_host_org_vector_type' 9 5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.ionic_strength' 10 5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.ionic_strength_units' 11 5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.label' 12 5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pH_units' 13 5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pressure' 14 5 'Structure model' '_pdbx_nmr_spectrometer.field_strength' 15 5 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 16 5 'Structure model' '_pdbx_nmr_spectrometer.model' 17 6 'Structure model' '_database_2.pdbx_DOI' 18 6 'Structure model' '_database_2.pdbx_database_accession' 19 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 6 'Structure model' '_struct_conn.ptnr2_label_seq_id' 31 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1B5B _pdbx_database_status.recvd_initial_deposition_date 1998-04-06 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dangi, B.' 1 'Sarma, S.' 2 'Yan, C.' 3 'Banville, D.' 4 'Guiles, R.D.' 5 # _citation.id primary _citation.title ;The origin of differences in the physical properties of the equilibrium forms of cytochrome b5 revealed through high-resolution NMR structures and backbone dynamic analyses. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 37 _citation.page_first 8289 _citation.page_last 8302 _citation.year 1998 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9622481 _citation.pdbx_database_id_DOI 10.1021/bi9801964 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dangi, B.' 1 ? primary 'Sarma, S.' 2 ? primary 'Yan, C.' 3 ? primary 'Banville, D.L.' 4 ? primary 'Guiles, R.D.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'FERROCYTOCHROME B5' 10813.908 1 ? ? ? 'HEME AS PROSTHETIC GROUP, WITH H63 AND H39 AS AXIAL LIGANDS' 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELH PDDRSKIAKPSETL ; _entity_poly.pdbx_seq_one_letter_code_can ;DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELH PDDRSKIAKPSETL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'PROTOPORPHYRIN IX CONTAINING FE' _pdbx_entity_nonpoly.comp_id HEM # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 LYS n 1 3 ASP n 1 4 VAL n 1 5 LYS n 1 6 TYR n 1 7 TYR n 1 8 THR n 1 9 LEU n 1 10 GLU n 1 11 GLU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 HIS n 1 16 LYS n 1 17 ASP n 1 18 SER n 1 19 LYS n 1 20 SER n 1 21 THR n 1 22 TRP n 1 23 VAL n 1 24 ILE n 1 25 LEU n 1 26 HIS n 1 27 HIS n 1 28 LYS n 1 29 VAL n 1 30 TYR n 1 31 ASP n 1 32 LEU n 1 33 THR n 1 34 LYS n 1 35 PHE n 1 36 LEU n 1 37 GLU n 1 38 GLU n 1 39 HIS n 1 40 PRO n 1 41 GLY n 1 42 GLY n 1 43 GLU n 1 44 GLU n 1 45 VAL n 1 46 LEU n 1 47 ARG n 1 48 GLU n 1 49 GLN n 1 50 ALA n 1 51 GLY n 1 52 GLY n 1 53 ASP n 1 54 ALA n 1 55 THR n 1 56 GLU n 1 57 ASN n 1 58 PHE n 1 59 GLU n 1 60 ASP n 1 61 VAL n 1 62 GLY n 1 63 HIS n 1 64 SER n 1 65 THR n 1 66 ASP n 1 67 ALA n 1 68 ARG n 1 69 GLU n 1 70 LEU n 1 71 SER n 1 72 LYS n 1 73 THR n 1 74 TYR n 1 75 ILE n 1 76 ILE n 1 77 GLY n 1 78 GLU n 1 79 LEU n 1 80 HIS n 1 81 PRO n 1 82 ASP n 1 83 ASP n 1 84 ARG n 1 85 SER n 1 86 LYS n 1 87 ILE n 1 88 ALA n 1 89 LYS n 1 90 PRO n 1 91 SER n 1 92 GLU n 1 93 THR n 1 94 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET3C _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 LEU 94 94 94 LEU LEU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEM _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 95 _pdbx_nonpoly_scheme.auth_seq_num 95 _pdbx_nonpoly_scheme.pdb_mon_id HEM _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1B5B _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1B5B _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1B5B _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1B5B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1B5B _struct.title 'RAT FERROCYTOCHROME B5 B CONFORMATION, NMR, 1 STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1B5B _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYB5_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00173 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYII GELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISALVVALMYRLYMAED ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1B5B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00173 _struct_ref_seq.db_align_beg 5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 94 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 I LEU A 9 ? ILE A 12 ? LEU A 9 ILE A 12 1 ? 4 HELX_P HELX_P2 II THR A 33 ? GLU A 38 ? THR A 33 GLU A 38 1 ? 6 HELX_P HELX_P3 III GLU A 44 ? ARG A 47 ? GLU A 44 ARG A 47 1 ? 4 HELX_P HELX_P4 IV ASP A 53 ? ASP A 60 ? ASP A 53 ASP A 60 1 ? 8 HELX_P HELX_P5 V THR A 65 ? SER A 71 ? THR A 65 SER A 71 1 ? 7 HELX_P HELX_P6 VI PRO A 81 ? LYS A 86 ? PRO A 81 LYS A 86 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 39 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 39 A HEM 95 1_555 ? ? ? ? ? ? ? 1.921 ? ? metalc2 metalc ? ? A HIS 63 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 63 A HEM 95 1_555 ? ? ? ? ? ? ? 2.005 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NA ? B HEM . ? A HEM 95 ? 1_555 86.6 ? 2 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NB ? B HEM . ? A HEM 95 ? 1_555 92.1 ? 3 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NB ? B HEM . ? A HEM 95 ? 1_555 90.8 ? 4 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC ? B HEM . ? A HEM 95 ? 1_555 94.0 ? 5 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC ? B HEM . ? A HEM 95 ? 1_555 179.1 ? 6 NB ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC ? B HEM . ? A HEM 95 ? 1_555 89.8 ? 7 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 88.5 ? 8 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 89.7 ? 9 NB ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 179.3 ? 10 NC ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 89.7 ? 11 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 170.9 ? 12 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 99.4 ? 13 NB ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 81.2 ? 14 NC ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 80.0 ? 15 ND ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 98.2 ? # _struct_sheet.id I _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense I 1 2 ? parallel I 2 3 ? anti-parallel I 3 4 ? anti-parallel I 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id I 1 LYS A 5 ? TYR A 7 ? LYS A 5 TYR A 7 I 2 TYR A 74 ? HIS A 80 ? TYR A 74 HIS A 80 I 3 HIS A 27 ? LEU A 32 ? HIS A 27 LEU A 32 I 4 THR A 21 ? LEU A 25 ? THR A 21 LEU A 25 I 5 GLY A 51 ? ALA A 54 ? GLY A 51 ALA A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id I 1 2 O LYS A 5 ? O LYS A 5 N GLU A 78 ? N GLU A 78 I 2 3 N LEU A 79 ? N LEU A 79 O HIS A 27 ? O HIS A 27 I 3 4 N LEU A 32 ? N LEU A 32 O THR A 21 ? O THR A 21 I 4 5 O TRP A 22 ? O TRP A 22 N GLY A 51 ? N GLY A 51 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEM _struct_site.pdbx_auth_seq_id 95 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'BINDING SITE FOR RESIDUE HEM A 95' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 VAL A 23 ? VAL A 23 . ? 1_555 ? 2 AC1 13 PHE A 35 ? PHE A 35 . ? 1_555 ? 3 AC1 13 HIS A 39 ? HIS A 39 . ? 1_555 ? 4 AC1 13 PRO A 40 ? PRO A 40 . ? 1_555 ? 5 AC1 13 GLY A 41 ? GLY A 41 . ? 1_555 ? 6 AC1 13 VAL A 45 ? VAL A 45 . ? 1_555 ? 7 AC1 13 LEU A 46 ? LEU A 46 . ? 1_555 ? 8 AC1 13 ALA A 54 ? ALA A 54 . ? 1_555 ? 9 AC1 13 ASN A 57 ? ASN A 57 . ? 1_555 ? 10 AC1 13 VAL A 61 ? VAL A 61 . ? 1_555 ? 11 AC1 13 HIS A 63 ? HIS A 63 . ? 1_555 ? 12 AC1 13 SER A 64 ? SER A 64 . ? 1_555 ? 13 AC1 13 SER A 71 ? SER A 71 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 44 ? ? H A GLU 48 ? ? 1.49 2 1 O A TRP 22 ? ? H A GLY 51 ? ? 1.52 3 1 O A TYR 7 ? ? H A HIS 80 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? 76.32 -57.58 2 1 VAL A 4 ? ? -43.86 159.54 3 1 HIS A 27 ? ? 35.67 46.27 4 1 PRO A 40 ? ? -75.03 23.97 5 1 HIS A 63 ? ? -39.58 133.55 6 1 TYR A 74 ? ? -92.27 48.19 7 1 HIS A 80 ? ? -38.95 145.92 8 1 ALA A 88 ? ? 67.23 -76.28 9 1 LYS A 89 ? ? 171.99 123.27 10 1 SER A 91 ? ? 55.37 105.24 11 1 GLU A 92 ? ? 68.04 169.10 12 1 THR A 93 ? ? -160.38 -49.14 # _pdbx_nmr_ensemble.entry_id 1B5B _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'CLOSEST TO THE AVERAGE STRUCTURE, LOW TARGET FUNCTION' # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 1B5B _pdbx_nmr_representative.selection_criteria 'closest to the average structure, low target function' # _pdbx_nmr_sample_details.contents '[U-13C; U-15N] Cytochrome b5, 100 mM phosphate buffer, 0.5 mM TSP, pH 7.0, 90% H2O/10% D2O' _pdbx_nmr_sample_details.details 'The sample was reduced by purging with nitrogen prior to addition of sodium dithionite.' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.type solution # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Cytochrome b5' ? ? ? '[U-13C; U-15N]' 1 'phosphate buffer' 100 ? mM 'natural abundance' 2 TSP 0.5 ? mM 'natural abundance' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label sample_conditions _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 DQF-COSY 1 3 1 TOCSY 1 4 1 'N15 3D NOESY-HMQC' 1 5 1 'N15 3D TOCSY-HMQC' 1 6 1 '3D HCCH-TOCSY' 1 7 1 HNCO 1 8 1 'CBCA(CO)NH' 1 9 1 HSQC 1 10 1 'HCACO< HNHA' 1 # _pdbx_nmr_details.entry_id 1B5B _pdbx_nmr_details.text ;THIS STRUCTURE REPRESENTS THE A CONFORMATION OF THE RAT FERROCYTOCHROME B5. IT IS THE STRUCTURE CLOSEST TO THE AVERAGE AS ANALYZED BY X-PLOR. 200 STRUCTURES WERE CALCULATED USING DIANA 2.1 AND ONE STRUCTURE WAS CHOSEN TO REPRESENT THE FINAL RESULTS. THE STRUCTURE WAS DETERMINED USING 2D AND 3D EXPERIMENTS INCLUDING DISTANCE AND ANGULAR RESTRAINTS FROM HNHA. ; # _pdbx_nmr_refine.entry_id 1B5B _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DIANA 2.1 WUTHRICH 1 'structure calculation' DIANA 2.1 WUTHRICH 2 refinement X-PLOR ? ? 3 'data analysis' X-PLOR ? ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HEM CHA C N N 123 HEM CHB C N N 124 HEM CHC C N N 125 HEM CHD C N N 126 HEM C1A C Y N 127 HEM C2A C Y N 128 HEM C3A C Y N 129 HEM C4A C Y N 130 HEM CMA C N N 131 HEM CAA C N N 132 HEM CBA C N N 133 HEM CGA C N N 134 HEM O1A O N N 135 HEM O2A O N N 136 HEM C1B C N N 137 HEM C2B C N N 138 HEM C3B C N N 139 HEM C4B C N N 140 HEM CMB C N N 141 HEM CAB C N N 142 HEM CBB C N N 143 HEM C1C C Y N 144 HEM C2C C Y N 145 HEM C3C C Y N 146 HEM C4C C Y N 147 HEM CMC C N N 148 HEM CAC C N N 149 HEM CBC C N N 150 HEM C1D C N N 151 HEM C2D C N N 152 HEM C3D C N N 153 HEM C4D C N N 154 HEM CMD C N N 155 HEM CAD C N N 156 HEM CBD C N N 157 HEM CGD C N N 158 HEM O1D O N N 159 HEM O2D O N N 160 HEM NA N Y N 161 HEM NB N N N 162 HEM NC N Y N 163 HEM ND N N N 164 HEM FE FE N N 165 HEM HHB H N N 166 HEM HHC H N N 167 HEM HHD H N N 168 HEM HMA H N N 169 HEM HMAA H N N 170 HEM HMAB H N N 171 HEM HAA H N N 172 HEM HAAA H N N 173 HEM HBA H N N 174 HEM HBAA H N N 175 HEM HMB H N N 176 HEM HMBA H N N 177 HEM HMBB H N N 178 HEM HAB H N N 179 HEM HBB H N N 180 HEM HBBA H N N 181 HEM HMC H N N 182 HEM HMCA H N N 183 HEM HMCB H N N 184 HEM HAC H N N 185 HEM HBC H N N 186 HEM HBCA H N N 187 HEM HMD H N N 188 HEM HMDA H N N 189 HEM HMDB H N N 190 HEM HAD H N N 191 HEM HADA H N N 192 HEM HBD H N N 193 HEM HBDA H N N 194 HEM H2A H N N 195 HEM H2D H N N 196 HEM HHA H N N 197 HIS N N N N 198 HIS CA C N S 199 HIS C C N N 200 HIS O O N N 201 HIS CB C N N 202 HIS CG C Y N 203 HIS ND1 N Y N 204 HIS CD2 C Y N 205 HIS CE1 C Y N 206 HIS NE2 N Y N 207 HIS OXT O N N 208 HIS H H N N 209 HIS H2 H N N 210 HIS HA H N N 211 HIS HB2 H N N 212 HIS HB3 H N N 213 HIS HD1 H N N 214 HIS HD2 H N N 215 HIS HE1 H N N 216 HIS HE2 H N N 217 HIS HXT H N N 218 ILE N N N N 219 ILE CA C N S 220 ILE C C N N 221 ILE O O N N 222 ILE CB C N S 223 ILE CG1 C N N 224 ILE CG2 C N N 225 ILE CD1 C N N 226 ILE OXT O N N 227 ILE H H N N 228 ILE H2 H N N 229 ILE HA H N N 230 ILE HB H N N 231 ILE HG12 H N N 232 ILE HG13 H N N 233 ILE HG21 H N N 234 ILE HG22 H N N 235 ILE HG23 H N N 236 ILE HD11 H N N 237 ILE HD12 H N N 238 ILE HD13 H N N 239 ILE HXT H N N 240 LEU N N N N 241 LEU CA C N S 242 LEU C C N N 243 LEU O O N N 244 LEU CB C N N 245 LEU CG C N N 246 LEU CD1 C N N 247 LEU CD2 C N N 248 LEU OXT O N N 249 LEU H H N N 250 LEU H2 H N N 251 LEU HA H N N 252 LEU HB2 H N N 253 LEU HB3 H N N 254 LEU HG H N N 255 LEU HD11 H N N 256 LEU HD12 H N N 257 LEU HD13 H N N 258 LEU HD21 H N N 259 LEU HD22 H N N 260 LEU HD23 H N N 261 LEU HXT H N N 262 LYS N N N N 263 LYS CA C N S 264 LYS C C N N 265 LYS O O N N 266 LYS CB C N N 267 LYS CG C N N 268 LYS CD C N N 269 LYS CE C N N 270 LYS NZ N N N 271 LYS OXT O N N 272 LYS H H N N 273 LYS H2 H N N 274 LYS HA H N N 275 LYS HB2 H N N 276 LYS HB3 H N N 277 LYS HG2 H N N 278 LYS HG3 H N N 279 LYS HD2 H N N 280 LYS HD3 H N N 281 LYS HE2 H N N 282 LYS HE3 H N N 283 LYS HZ1 H N N 284 LYS HZ2 H N N 285 LYS HZ3 H N N 286 LYS HXT H N N 287 PHE N N N N 288 PHE CA C N S 289 PHE C C N N 290 PHE O O N N 291 PHE CB C N N 292 PHE CG C Y N 293 PHE CD1 C Y N 294 PHE CD2 C Y N 295 PHE CE1 C Y N 296 PHE CE2 C Y N 297 PHE CZ C Y N 298 PHE OXT O N N 299 PHE H H N N 300 PHE H2 H N N 301 PHE HA H N N 302 PHE HB2 H N N 303 PHE HB3 H N N 304 PHE HD1 H N N 305 PHE HD2 H N N 306 PHE HE1 H N N 307 PHE HE2 H N N 308 PHE HZ H N N 309 PHE HXT H N N 310 PRO N N N N 311 PRO CA C N S 312 PRO C C N N 313 PRO O O N N 314 PRO CB C N N 315 PRO CG C N N 316 PRO CD C N N 317 PRO OXT O N N 318 PRO H H N N 319 PRO HA H N N 320 PRO HB2 H N N 321 PRO HB3 H N N 322 PRO HG2 H N N 323 PRO HG3 H N N 324 PRO HD2 H N N 325 PRO HD3 H N N 326 PRO HXT H N N 327 SER N N N N 328 SER CA C N S 329 SER C C N N 330 SER O O N N 331 SER CB C N N 332 SER OG O N N 333 SER OXT O N N 334 SER H H N N 335 SER H2 H N N 336 SER HA H N N 337 SER HB2 H N N 338 SER HB3 H N N 339 SER HG H N N 340 SER HXT H N N 341 THR N N N N 342 THR CA C N S 343 THR C C N N 344 THR O O N N 345 THR CB C N R 346 THR OG1 O N N 347 THR CG2 C N N 348 THR OXT O N N 349 THR H H N N 350 THR H2 H N N 351 THR HA H N N 352 THR HB H N N 353 THR HG1 H N N 354 THR HG21 H N N 355 THR HG22 H N N 356 THR HG23 H N N 357 THR HXT H N N 358 TRP N N N N 359 TRP CA C N S 360 TRP C C N N 361 TRP O O N N 362 TRP CB C N N 363 TRP CG C Y N 364 TRP CD1 C Y N 365 TRP CD2 C Y N 366 TRP NE1 N Y N 367 TRP CE2 C Y N 368 TRP CE3 C Y N 369 TRP CZ2 C Y N 370 TRP CZ3 C Y N 371 TRP CH2 C Y N 372 TRP OXT O N N 373 TRP H H N N 374 TRP H2 H N N 375 TRP HA H N N 376 TRP HB2 H N N 377 TRP HB3 H N N 378 TRP HD1 H N N 379 TRP HE1 H N N 380 TRP HE3 H N N 381 TRP HZ2 H N N 382 TRP HZ3 H N N 383 TRP HH2 H N N 384 TRP HXT H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HEM CHA C1A sing N N 116 HEM CHA C4D doub N N 117 HEM CHA HHA sing N N 118 HEM CHB C4A sing N N 119 HEM CHB C1B doub N N 120 HEM CHB HHB sing N N 121 HEM CHC C4B sing N N 122 HEM CHC C1C doub N N 123 HEM CHC HHC sing N N 124 HEM CHD C4C doub N N 125 HEM CHD C1D sing N N 126 HEM CHD HHD sing N N 127 HEM C1A C2A doub Y N 128 HEM C1A NA sing Y N 129 HEM C2A C3A sing Y N 130 HEM C2A CAA sing N N 131 HEM C3A C4A doub Y N 132 HEM C3A CMA sing N N 133 HEM C4A NA sing Y N 134 HEM CMA HMA sing N N 135 HEM CMA HMAA sing N N 136 HEM CMA HMAB sing N N 137 HEM CAA CBA sing N N 138 HEM CAA HAA sing N N 139 HEM CAA HAAA sing N N 140 HEM CBA CGA sing N N 141 HEM CBA HBA sing N N 142 HEM CBA HBAA sing N N 143 HEM CGA O1A doub N N 144 HEM CGA O2A sing N N 145 HEM C1B C2B sing N N 146 HEM C1B NB sing N N 147 HEM C2B C3B doub N N 148 HEM C2B CMB sing N N 149 HEM C3B C4B sing N N 150 HEM C3B CAB sing N N 151 HEM C4B NB doub N N 152 HEM CMB HMB sing N N 153 HEM CMB HMBA sing N N 154 HEM CMB HMBB sing N N 155 HEM CAB CBB doub N N 156 HEM CAB HAB sing N N 157 HEM CBB HBB sing N N 158 HEM CBB HBBA sing N N 159 HEM C1C C2C sing Y N 160 HEM C1C NC sing Y N 161 HEM C2C C3C doub Y N 162 HEM C2C CMC sing N N 163 HEM C3C C4C sing Y N 164 HEM C3C CAC sing N N 165 HEM C4C NC sing Y N 166 HEM CMC HMC sing N N 167 HEM CMC HMCA sing N N 168 HEM CMC HMCB sing N N 169 HEM CAC CBC doub N N 170 HEM CAC HAC sing N N 171 HEM CBC HBC sing N N 172 HEM CBC HBCA sing N N 173 HEM C1D C2D sing N N 174 HEM C1D ND doub N N 175 HEM C2D C3D doub N N 176 HEM C2D CMD sing N N 177 HEM C3D C4D sing N N 178 HEM C3D CAD sing N N 179 HEM C4D ND sing N N 180 HEM CMD HMD sing N N 181 HEM CMD HMDA sing N N 182 HEM CMD HMDB sing N N 183 HEM CAD CBD sing N N 184 HEM CAD HAD sing N N 185 HEM CAD HADA sing N N 186 HEM CBD CGD sing N N 187 HEM CBD HBD sing N N 188 HEM CBD HBDA sing N N 189 HEM CGD O1D doub N N 190 HEM CGD O2D sing N N 191 HEM O2A H2A sing N N 192 HEM O2D H2D sing N N 193 HEM FE NA sing N N 194 HEM FE NB sing N N 195 HEM FE NC sing N N 196 HEM FE ND sing N N 197 HIS N CA sing N N 198 HIS N H sing N N 199 HIS N H2 sing N N 200 HIS CA C sing N N 201 HIS CA CB sing N N 202 HIS CA HA sing N N 203 HIS C O doub N N 204 HIS C OXT sing N N 205 HIS CB CG sing N N 206 HIS CB HB2 sing N N 207 HIS CB HB3 sing N N 208 HIS CG ND1 sing Y N 209 HIS CG CD2 doub Y N 210 HIS ND1 CE1 doub Y N 211 HIS ND1 HD1 sing N N 212 HIS CD2 NE2 sing Y N 213 HIS CD2 HD2 sing N N 214 HIS CE1 NE2 sing Y N 215 HIS CE1 HE1 sing N N 216 HIS NE2 HE2 sing N N 217 HIS OXT HXT sing N N 218 ILE N CA sing N N 219 ILE N H sing N N 220 ILE N H2 sing N N 221 ILE CA C sing N N 222 ILE CA CB sing N N 223 ILE CA HA sing N N 224 ILE C O doub N N 225 ILE C OXT sing N N 226 ILE CB CG1 sing N N 227 ILE CB CG2 sing N N 228 ILE CB HB sing N N 229 ILE CG1 CD1 sing N N 230 ILE CG1 HG12 sing N N 231 ILE CG1 HG13 sing N N 232 ILE CG2 HG21 sing N N 233 ILE CG2 HG22 sing N N 234 ILE CG2 HG23 sing N N 235 ILE CD1 HD11 sing N N 236 ILE CD1 HD12 sing N N 237 ILE CD1 HD13 sing N N 238 ILE OXT HXT sing N N 239 LEU N CA sing N N 240 LEU N H sing N N 241 LEU N H2 sing N N 242 LEU CA C sing N N 243 LEU CA CB sing N N 244 LEU CA HA sing N N 245 LEU C O doub N N 246 LEU C OXT sing N N 247 LEU CB CG sing N N 248 LEU CB HB2 sing N N 249 LEU CB HB3 sing N N 250 LEU CG CD1 sing N N 251 LEU CG CD2 sing N N 252 LEU CG HG sing N N 253 LEU CD1 HD11 sing N N 254 LEU CD1 HD12 sing N N 255 LEU CD1 HD13 sing N N 256 LEU CD2 HD21 sing N N 257 LEU CD2 HD22 sing N N 258 LEU CD2 HD23 sing N N 259 LEU OXT HXT sing N N 260 LYS N CA sing N N 261 LYS N H sing N N 262 LYS N H2 sing N N 263 LYS CA C sing N N 264 LYS CA CB sing N N 265 LYS CA HA sing N N 266 LYS C O doub N N 267 LYS C OXT sing N N 268 LYS CB CG sing N N 269 LYS CB HB2 sing N N 270 LYS CB HB3 sing N N 271 LYS CG CD sing N N 272 LYS CG HG2 sing N N 273 LYS CG HG3 sing N N 274 LYS CD CE sing N N 275 LYS CD HD2 sing N N 276 LYS CD HD3 sing N N 277 LYS CE NZ sing N N 278 LYS CE HE2 sing N N 279 LYS CE HE3 sing N N 280 LYS NZ HZ1 sing N N 281 LYS NZ HZ2 sing N N 282 LYS NZ HZ3 sing N N 283 LYS OXT HXT sing N N 284 PHE N CA sing N N 285 PHE N H sing N N 286 PHE N H2 sing N N 287 PHE CA C sing N N 288 PHE CA CB sing N N 289 PHE CA HA sing N N 290 PHE C O doub N N 291 PHE C OXT sing N N 292 PHE CB CG sing N N 293 PHE CB HB2 sing N N 294 PHE CB HB3 sing N N 295 PHE CG CD1 doub Y N 296 PHE CG CD2 sing Y N 297 PHE CD1 CE1 sing Y N 298 PHE CD1 HD1 sing N N 299 PHE CD2 CE2 doub Y N 300 PHE CD2 HD2 sing N N 301 PHE CE1 CZ doub Y N 302 PHE CE1 HE1 sing N N 303 PHE CE2 CZ sing Y N 304 PHE CE2 HE2 sing N N 305 PHE CZ HZ sing N N 306 PHE OXT HXT sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AMX Bruker 600 ? 2 UNITYPLUS Varian 500 ? # _atom_sites.entry_id 1B5B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O # loop_