data_1B5B
# 
_entry.id   1B5B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.390 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1B5B         pdb_00001b5b 10.2210/pdb1b5b/pdb 
WWPDB D_1000171487 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-06-17 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
5 'Structure model' 1 4 2018-08-08 
6 'Structure model' 1 5 2024-04-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Derived calculations'      
4  4 'Structure model' Other                       
5  5 'Structure model' 'Data collection'           
6  5 'Structure model' 'Experimental preparation'  
7  5 'Structure model' 'Source and taxonomy'       
8  6 'Structure model' 'Data collection'           
9  6 'Structure model' 'Database references'       
10 6 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' pdbx_database_status             
2  4 'Structure model' pdbx_struct_assembly             
3  4 'Structure model' pdbx_struct_oper_list            
4  4 'Structure model' struct_conf                      
5  4 'Structure model' struct_conf_type                 
6  5 'Structure model' entity_src_gen                   
7  5 'Structure model' pdbx_nmr_details                 
8  5 'Structure model' pdbx_nmr_exptl_sample            
9  5 'Structure model' pdbx_nmr_exptl_sample_conditions 
10 5 'Structure model' pdbx_nmr_representative          
11 5 'Structure model' pdbx_nmr_sample_details          
12 5 'Structure model' pdbx_nmr_software                
13 5 'Structure model' pdbx_nmr_spectrometer            
14 6 'Structure model' chem_comp_atom                   
15 6 'Structure model' chem_comp_bond                   
16 6 'Structure model' database_2                       
17 6 'Structure model' struct_conn                      
18 6 'Structure model' struct_site                      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_pdbx_database_status.process_site'                     
2  5 'Structure model' '_entity_src_gen.gene_src_genus'                         
3  5 'Structure model' '_entity_src_gen.host_org_genus'                         
4  5 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'                
5  5 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id'         
6  5 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'          
7  5 'Structure model' '_entity_src_gen.pdbx_host_org_strain'                   
8  5 'Structure model' '_entity_src_gen.pdbx_host_org_vector_type'              
9  5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.ionic_strength'       
10 5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.ionic_strength_units' 
11 5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.label'                
12 5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pH_units'             
13 5 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pressure'             
14 5 'Structure model' '_pdbx_nmr_spectrometer.field_strength'                  
15 5 'Structure model' '_pdbx_nmr_spectrometer.manufacturer'                    
16 5 'Structure model' '_pdbx_nmr_spectrometer.model'                           
17 6 'Structure model' '_database_2.pdbx_DOI'                                   
18 6 'Structure model' '_database_2.pdbx_database_accession'                    
19 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id'                        
20 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id'                         
21 6 'Structure model' '_struct_conn.ptnr1_label_asym_id'                       
22 6 'Structure model' '_struct_conn.ptnr1_label_atom_id'                       
23 6 'Structure model' '_struct_conn.ptnr1_label_comp_id'                       
24 6 'Structure model' '_struct_conn.ptnr1_label_seq_id'                        
25 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id'                        
26 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id'                         
27 6 'Structure model' '_struct_conn.ptnr2_label_asym_id'                       
28 6 'Structure model' '_struct_conn.ptnr2_label_atom_id'                       
29 6 'Structure model' '_struct_conn.ptnr2_label_comp_id'                       
30 6 'Structure model' '_struct_conn.ptnr2_label_seq_id'                        
31 6 'Structure model' '_struct_site.pdbx_auth_asym_id'                         
32 6 'Structure model' '_struct_site.pdbx_auth_comp_id'                         
33 6 'Structure model' '_struct_site.pdbx_auth_seq_id'                          
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1B5B 
_pdbx_database_status.recvd_initial_deposition_date   1998-04-06 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dangi, B.'    1 
'Sarma, S.'    2 
'Yan, C.'      3 
'Banville, D.' 4 
'Guiles, R.D.' 5 
# 
_citation.id                        primary 
_citation.title                     
;The origin of differences in the physical properties of the equilibrium forms of cytochrome b5 revealed through high-resolution NMR structures and backbone dynamic analyses.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            37 
_citation.page_first                8289 
_citation.page_last                 8302 
_citation.year                      1998 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9622481 
_citation.pdbx_database_id_DOI      10.1021/bi9801964 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dangi, B.'      1 ? 
primary 'Sarma, S.'      2 ? 
primary 'Yan, C.'        3 ? 
primary 'Banville, D.L.' 4 ? 
primary 'Guiles, R.D.'   5 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'FERROCYTOCHROME B5'              10813.908 1 ? ? ? 
'HEME AS PROSTHETIC GROUP, WITH H63 AND H39 AS AXIAL LIGANDS' 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELH
PDDRSKIAKPSETL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELH
PDDRSKIAKPSETL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'PROTOPORPHYRIN IX CONTAINING FE' 
_pdbx_entity_nonpoly.comp_id     HEM 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ASP n 
1 2  LYS n 
1 3  ASP n 
1 4  VAL n 
1 5  LYS n 
1 6  TYR n 
1 7  TYR n 
1 8  THR n 
1 9  LEU n 
1 10 GLU n 
1 11 GLU n 
1 12 ILE n 
1 13 GLN n 
1 14 LYS n 
1 15 HIS n 
1 16 LYS n 
1 17 ASP n 
1 18 SER n 
1 19 LYS n 
1 20 SER n 
1 21 THR n 
1 22 TRP n 
1 23 VAL n 
1 24 ILE n 
1 25 LEU n 
1 26 HIS n 
1 27 HIS n 
1 28 LYS n 
1 29 VAL n 
1 30 TYR n 
1 31 ASP n 
1 32 LEU n 
1 33 THR n 
1 34 LYS n 
1 35 PHE n 
1 36 LEU n 
1 37 GLU n 
1 38 GLU n 
1 39 HIS n 
1 40 PRO n 
1 41 GLY n 
1 42 GLY n 
1 43 GLU n 
1 44 GLU n 
1 45 VAL n 
1 46 LEU n 
1 47 ARG n 
1 48 GLU n 
1 49 GLN n 
1 50 ALA n 
1 51 GLY n 
1 52 GLY n 
1 53 ASP n 
1 54 ALA n 
1 55 THR n 
1 56 GLU n 
1 57 ASN n 
1 58 PHE n 
1 59 GLU n 
1 60 ASP n 
1 61 VAL n 
1 62 GLY n 
1 63 HIS n 
1 64 SER n 
1 65 THR n 
1 66 ASP n 
1 67 ALA n 
1 68 ARG n 
1 69 GLU n 
1 70 LEU n 
1 71 SER n 
1 72 LYS n 
1 73 THR n 
1 74 TYR n 
1 75 ILE n 
1 76 ILE n 
1 77 GLY n 
1 78 GLU n 
1 79 LEU n 
1 80 HIS n 
1 81 PRO n 
1 82 ASP n 
1 83 ASP n 
1 84 ARG n 
1 85 SER n 
1 86 LYS n 
1 87 ILE n 
1 88 ALA n 
1 89 LYS n 
1 90 PRO n 
1 91 SER n 
1 92 GLU n 
1 93 THR n 
1 94 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) PLYSS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET3C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ASP 1  1  1  ASP ASP A . n 
A 1 2  LYS 2  2  2  LYS LYS A . n 
A 1 3  ASP 3  3  3  ASP ASP A . n 
A 1 4  VAL 4  4  4  VAL VAL A . n 
A 1 5  LYS 5  5  5  LYS LYS A . n 
A 1 6  TYR 6  6  6  TYR TYR A . n 
A 1 7  TYR 7  7  7  TYR TYR A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  LEU 9  9  9  LEU LEU A . n 
A 1 10 GLU 10 10 10 GLU GLU A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 ILE 12 12 12 ILE ILE A . n 
A 1 13 GLN 13 13 13 GLN GLN A . n 
A 1 14 LYS 14 14 14 LYS LYS A . n 
A 1 15 HIS 15 15 15 HIS HIS A . n 
A 1 16 LYS 16 16 16 LYS LYS A . n 
A 1 17 ASP 17 17 17 ASP ASP A . n 
A 1 18 SER 18 18 18 SER SER A . n 
A 1 19 LYS 19 19 19 LYS LYS A . n 
A 1 20 SER 20 20 20 SER SER A . n 
A 1 21 THR 21 21 21 THR THR A . n 
A 1 22 TRP 22 22 22 TRP TRP A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 ILE 24 24 24 ILE ILE A . n 
A 1 25 LEU 25 25 25 LEU LEU A . n 
A 1 26 HIS 26 26 26 HIS HIS A . n 
A 1 27 HIS 27 27 27 HIS HIS A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 VAL 29 29 29 VAL VAL A . n 
A 1 30 TYR 30 30 30 TYR TYR A . n 
A 1 31 ASP 31 31 31 ASP ASP A . n 
A 1 32 LEU 32 32 32 LEU LEU A . n 
A 1 33 THR 33 33 33 THR THR A . n 
A 1 34 LYS 34 34 34 LYS LYS A . n 
A 1 35 PHE 35 35 35 PHE PHE A . n 
A 1 36 LEU 36 36 36 LEU LEU A . n 
A 1 37 GLU 37 37 37 GLU GLU A . n 
A 1 38 GLU 38 38 38 GLU GLU A . n 
A 1 39 HIS 39 39 39 HIS HIS A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 GLY 41 41 41 GLY GLY A . n 
A 1 42 GLY 42 42 42 GLY GLY A . n 
A 1 43 GLU 43 43 43 GLU GLU A . n 
A 1 44 GLU 44 44 44 GLU GLU A . n 
A 1 45 VAL 45 45 45 VAL VAL A . n 
A 1 46 LEU 46 46 46 LEU LEU A . n 
A 1 47 ARG 47 47 47 ARG ARG A . n 
A 1 48 GLU 48 48 48 GLU GLU A . n 
A 1 49 GLN 49 49 49 GLN GLN A . n 
A 1 50 ALA 50 50 50 ALA ALA A . n 
A 1 51 GLY 51 51 51 GLY GLY A . n 
A 1 52 GLY 52 52 52 GLY GLY A . n 
A 1 53 ASP 53 53 53 ASP ASP A . n 
A 1 54 ALA 54 54 54 ALA ALA A . n 
A 1 55 THR 55 55 55 THR THR A . n 
A 1 56 GLU 56 56 56 GLU GLU A . n 
A 1 57 ASN 57 57 57 ASN ASN A . n 
A 1 58 PHE 58 58 58 PHE PHE A . n 
A 1 59 GLU 59 59 59 GLU GLU A . n 
A 1 60 ASP 60 60 60 ASP ASP A . n 
A 1 61 VAL 61 61 61 VAL VAL A . n 
A 1 62 GLY 62 62 62 GLY GLY A . n 
A 1 63 HIS 63 63 63 HIS HIS A . n 
A 1 64 SER 64 64 64 SER SER A . n 
A 1 65 THR 65 65 65 THR THR A . n 
A 1 66 ASP 66 66 66 ASP ASP A . n 
A 1 67 ALA 67 67 67 ALA ALA A . n 
A 1 68 ARG 68 68 68 ARG ARG A . n 
A 1 69 GLU 69 69 69 GLU GLU A . n 
A 1 70 LEU 70 70 70 LEU LEU A . n 
A 1 71 SER 71 71 71 SER SER A . n 
A 1 72 LYS 72 72 72 LYS LYS A . n 
A 1 73 THR 73 73 73 THR THR A . n 
A 1 74 TYR 74 74 74 TYR TYR A . n 
A 1 75 ILE 75 75 75 ILE ILE A . n 
A 1 76 ILE 76 76 76 ILE ILE A . n 
A 1 77 GLY 77 77 77 GLY GLY A . n 
A 1 78 GLU 78 78 78 GLU GLU A . n 
A 1 79 LEU 79 79 79 LEU LEU A . n 
A 1 80 HIS 80 80 80 HIS HIS A . n 
A 1 81 PRO 81 81 81 PRO PRO A . n 
A 1 82 ASP 82 82 82 ASP ASP A . n 
A 1 83 ASP 83 83 83 ASP ASP A . n 
A 1 84 ARG 84 84 84 ARG ARG A . n 
A 1 85 SER 85 85 85 SER SER A . n 
A 1 86 LYS 86 86 86 LYS LYS A . n 
A 1 87 ILE 87 87 87 ILE ILE A . n 
A 1 88 ALA 88 88 88 ALA ALA A . n 
A 1 89 LYS 89 89 89 LYS LYS A . n 
A 1 90 PRO 90 90 90 PRO PRO A . n 
A 1 91 SER 91 91 91 SER SER A . n 
A 1 92 GLU 92 92 92 GLU GLU A . n 
A 1 93 THR 93 93 93 THR THR A . n 
A 1 94 LEU 94 94 94 LEU LEU A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          HEM 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     95 
_pdbx_nonpoly_scheme.auth_seq_num    95 
_pdbx_nonpoly_scheme.pdb_mon_id      HEM 
_pdbx_nonpoly_scheme.auth_mon_id     HEM 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
_cell.entry_id           1B5B 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1B5B 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1B5B 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1B5B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1B5B 
_struct.title                     'RAT FERROCYTOCHROME B5 B CONFORMATION, NMR, 1 STRUCTURE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1B5B 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'ELECTRON TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CYB5_RAT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00173 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYII
GELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISALVVALMYRLYMAED
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1B5B 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 94 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00173 
_struct_ref_seq.db_align_beg                  5 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  98 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       94 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 I   LEU A 9  ? ILE A 12 ? LEU A 9  ILE A 12 1 ? 4 
HELX_P HELX_P2 II  THR A 33 ? GLU A 38 ? THR A 33 GLU A 38 1 ? 6 
HELX_P HELX_P3 III GLU A 44 ? ARG A 47 ? GLU A 44 ARG A 47 1 ? 4 
HELX_P HELX_P4 IV  ASP A 53 ? ASP A 60 ? ASP A 53 ASP A 60 1 ? 8 
HELX_P HELX_P5 V   THR A 65 ? SER A 71 ? THR A 65 SER A 71 1 ? 7 
HELX_P HELX_P6 VI  PRO A 81 ? LYS A 86 ? PRO A 81 LYS A 86 5 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A HIS 39 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 39 A HEM 95 1_555 ? ? ? ? ? ? ? 1.921 ? ? 
metalc2 metalc ? ? A HIS 63 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 63 A HEM 95 1_555 ? ? ? ? ? ? ? 2.005 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NA  ? B HEM .  ? A HEM 95 ? 1_555 86.6  ? 
2  NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NB  ? B HEM .  ? A HEM 95 ? 1_555 92.1  ? 
3  NA  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NB  ? B HEM .  ? A HEM 95 ? 1_555 90.8  ? 
4  NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC  ? B HEM .  ? A HEM 95 ? 1_555 94.0  ? 
5  NA  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC  ? B HEM .  ? A HEM 95 ? 1_555 179.1 ? 
6  NB  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC  ? B HEM .  ? A HEM 95 ? 1_555 89.8  ? 
7  NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND  ? B HEM .  ? A HEM 95 ? 1_555 88.5  ? 
8  NA  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND  ? B HEM .  ? A HEM 95 ? 1_555 89.7  ? 
9  NB  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND  ? B HEM .  ? A HEM 95 ? 1_555 179.3 ? 
10 NC  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND  ? B HEM .  ? A HEM 95 ? 1_555 89.7  ? 
11 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 170.9 ? 
12 NA  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 99.4  ? 
13 NB  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 81.2  ? 
14 NC  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 80.0  ? 
15 ND  ? B HEM .  ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 98.2  ? 
# 
_struct_sheet.id               I 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
I 1 LYS A 5  ? TYR A 7  ? LYS A 5  TYR A 7  
I 2 TYR A 74 ? HIS A 80 ? TYR A 74 HIS A 80 
I 3 HIS A 27 ? LEU A 32 ? HIS A 27 LEU A 32 
I 4 THR A 21 ? LEU A 25 ? THR A 21 LEU A 25 
I 5 GLY A 51 ? ALA A 54 ? GLY A 51 ALA A 54 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
I 1 2 O LYS A 5  ? O LYS A 5  N GLU A 78 ? N GLU A 78 
I 2 3 N LEU A 79 ? N LEU A 79 O HIS A 27 ? O HIS A 27 
I 3 4 N LEU A 32 ? N LEU A 32 O THR A 21 ? O THR A 21 
I 4 5 O TRP A 22 ? O TRP A 22 N GLY A 51 ? N GLY A 51 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    HEM 
_struct_site.pdbx_auth_seq_id     95 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    13 
_struct_site.details              'BINDING SITE FOR RESIDUE HEM A 95' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 VAL A 23 ? VAL A 23 . ? 1_555 ? 
2  AC1 13 PHE A 35 ? PHE A 35 . ? 1_555 ? 
3  AC1 13 HIS A 39 ? HIS A 39 . ? 1_555 ? 
4  AC1 13 PRO A 40 ? PRO A 40 . ? 1_555 ? 
5  AC1 13 GLY A 41 ? GLY A 41 . ? 1_555 ? 
6  AC1 13 VAL A 45 ? VAL A 45 . ? 1_555 ? 
7  AC1 13 LEU A 46 ? LEU A 46 . ? 1_555 ? 
8  AC1 13 ALA A 54 ? ALA A 54 . ? 1_555 ? 
9  AC1 13 ASN A 57 ? ASN A 57 . ? 1_555 ? 
10 AC1 13 VAL A 61 ? VAL A 61 . ? 1_555 ? 
11 AC1 13 HIS A 63 ? HIS A 63 . ? 1_555 ? 
12 AC1 13 SER A 64 ? SER A 64 . ? 1_555 ? 
13 AC1 13 SER A 71 ? SER A 71 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A GLU 44 ? ? H A GLU 48 ? ? 1.49 
2 1 O A TRP 22 ? ? H A GLY 51 ? ? 1.52 
3 1 O A TYR 7  ? ? H A HIS 80 ? ? 1.58 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 3  ? ? 76.32   -57.58 
2  1 VAL A 4  ? ? -43.86  159.54 
3  1 HIS A 27 ? ? 35.67   46.27  
4  1 PRO A 40 ? ? -75.03  23.97  
5  1 HIS A 63 ? ? -39.58  133.55 
6  1 TYR A 74 ? ? -92.27  48.19  
7  1 HIS A 80 ? ? -38.95  145.92 
8  1 ALA A 88 ? ? 67.23   -76.28 
9  1 LYS A 89 ? ? 171.99  123.27 
10 1 SER A 91 ? ? 55.37   105.24 
11 1 GLU A 92 ? ? 68.04   169.10 
12 1 THR A 93 ? ? -160.38 -49.14 
# 
_pdbx_nmr_ensemble.entry_id                             1B5B 
_pdbx_nmr_ensemble.conformers_calculated_total_number   200 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         'CLOSEST TO THE AVERAGE STRUCTURE, LOW TARGET FUNCTION' 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             1B5B 
_pdbx_nmr_representative.selection_criteria   'closest to the average structure, low target function' 
# 
_pdbx_nmr_sample_details.contents         
'[U-13C; U-15N] Cytochrome b5, 100 mM phosphate buffer, 0.5 mM TSP, pH 7.0, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.details          'The sample was reduced by purging with nitrogen prior to addition of sodium dithionite.' 
_pdbx_nmr_sample_details.label            sample_1 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
_pdbx_nmr_sample_details.type             solution 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
'Cytochrome b5'    ?   ? ?  '[U-13C; U-15N]'    1 
'phosphate buffer' 100 ? mM 'natural abundance' 2 
TSP                0.5 ? mM 'natural abundance' 3 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            313 
_pdbx_nmr_exptl_sample_conditions.pressure               ambient 
_pdbx_nmr_exptl_sample_conditions.pH                     7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         100 
_pdbx_nmr_exptl_sample_conditions.pressure_units         . 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
_pdbx_nmr_exptl_sample_conditions.label                  sample_conditions 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 NOESY               1 
2  1 DQF-COSY            1 
3  1 TOCSY               1 
4  1 'N15 3D NOESY-HMQC' 1 
5  1 'N15 3D TOCSY-HMQC' 1 
6  1 '3D HCCH-TOCSY'     1 
7  1 HNCO                1 
8  1 'CBCA(CO)NH'        1 
9  1 HSQC                1 
10 1 'HCACO< HNHA'       1 
# 
_pdbx_nmr_details.entry_id   1B5B 
_pdbx_nmr_details.text       
;THIS STRUCTURE REPRESENTS THE A CONFORMATION OF THE RAT
FERROCYTOCHROME B5.  IT IS THE STRUCTURE CLOSEST TO THE
AVERAGE AS ANALYZED BY X-PLOR.  200 STRUCTURES WERE
CALCULATED USING DIANA 2.1 AND ONE STRUCTURE WAS CHOSEN TO
REPRESENT THE FINAL RESULTS. THE STRUCTURE WAS DETERMINED USING 2D AND 3D EXPERIMENTS
INCLUDING DISTANCE AND ANGULAR RESTRAINTS FROM HNHA.
;
# 
_pdbx_nmr_refine.entry_id           1B5B 
_pdbx_nmr_refine.method             'distance geometry' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement              DIANA  2.1 WUTHRICH 1 
'structure calculation' DIANA  2.1 WUTHRICH 2 
refinement              X-PLOR ?   ?        3 
'data analysis'         X-PLOR ?   ?        4 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
GLN N    N  N N 74  
GLN CA   C  N S 75  
GLN C    C  N N 76  
GLN O    O  N N 77  
GLN CB   C  N N 78  
GLN CG   C  N N 79  
GLN CD   C  N N 80  
GLN OE1  O  N N 81  
GLN NE2  N  N N 82  
GLN OXT  O  N N 83  
GLN H    H  N N 84  
GLN H2   H  N N 85  
GLN HA   H  N N 86  
GLN HB2  H  N N 87  
GLN HB3  H  N N 88  
GLN HG2  H  N N 89  
GLN HG3  H  N N 90  
GLN HE21 H  N N 91  
GLN HE22 H  N N 92  
GLN HXT  H  N N 93  
GLU N    N  N N 94  
GLU CA   C  N S 95  
GLU C    C  N N 96  
GLU O    O  N N 97  
GLU CB   C  N N 98  
GLU CG   C  N N 99  
GLU CD   C  N N 100 
GLU OE1  O  N N 101 
GLU OE2  O  N N 102 
GLU OXT  O  N N 103 
GLU H    H  N N 104 
GLU H2   H  N N 105 
GLU HA   H  N N 106 
GLU HB2  H  N N 107 
GLU HB3  H  N N 108 
GLU HG2  H  N N 109 
GLU HG3  H  N N 110 
GLU HE2  H  N N 111 
GLU HXT  H  N N 112 
GLY N    N  N N 113 
GLY CA   C  N N 114 
GLY C    C  N N 115 
GLY O    O  N N 116 
GLY OXT  O  N N 117 
GLY H    H  N N 118 
GLY H2   H  N N 119 
GLY HA2  H  N N 120 
GLY HA3  H  N N 121 
GLY HXT  H  N N 122 
HEM CHA  C  N N 123 
HEM CHB  C  N N 124 
HEM CHC  C  N N 125 
HEM CHD  C  N N 126 
HEM C1A  C  Y N 127 
HEM C2A  C  Y N 128 
HEM C3A  C  Y N 129 
HEM C4A  C  Y N 130 
HEM CMA  C  N N 131 
HEM CAA  C  N N 132 
HEM CBA  C  N N 133 
HEM CGA  C  N N 134 
HEM O1A  O  N N 135 
HEM O2A  O  N N 136 
HEM C1B  C  N N 137 
HEM C2B  C  N N 138 
HEM C3B  C  N N 139 
HEM C4B  C  N N 140 
HEM CMB  C  N N 141 
HEM CAB  C  N N 142 
HEM CBB  C  N N 143 
HEM C1C  C  Y N 144 
HEM C2C  C  Y N 145 
HEM C3C  C  Y N 146 
HEM C4C  C  Y N 147 
HEM CMC  C  N N 148 
HEM CAC  C  N N 149 
HEM CBC  C  N N 150 
HEM C1D  C  N N 151 
HEM C2D  C  N N 152 
HEM C3D  C  N N 153 
HEM C4D  C  N N 154 
HEM CMD  C  N N 155 
HEM CAD  C  N N 156 
HEM CBD  C  N N 157 
HEM CGD  C  N N 158 
HEM O1D  O  N N 159 
HEM O2D  O  N N 160 
HEM NA   N  Y N 161 
HEM NB   N  N N 162 
HEM NC   N  Y N 163 
HEM ND   N  N N 164 
HEM FE   FE N N 165 
HEM HHB  H  N N 166 
HEM HHC  H  N N 167 
HEM HHD  H  N N 168 
HEM HMA  H  N N 169 
HEM HMAA H  N N 170 
HEM HMAB H  N N 171 
HEM HAA  H  N N 172 
HEM HAAA H  N N 173 
HEM HBA  H  N N 174 
HEM HBAA H  N N 175 
HEM HMB  H  N N 176 
HEM HMBA H  N N 177 
HEM HMBB H  N N 178 
HEM HAB  H  N N 179 
HEM HBB  H  N N 180 
HEM HBBA H  N N 181 
HEM HMC  H  N N 182 
HEM HMCA H  N N 183 
HEM HMCB H  N N 184 
HEM HAC  H  N N 185 
HEM HBC  H  N N 186 
HEM HBCA H  N N 187 
HEM HMD  H  N N 188 
HEM HMDA H  N N 189 
HEM HMDB H  N N 190 
HEM HAD  H  N N 191 
HEM HADA H  N N 192 
HEM HBD  H  N N 193 
HEM HBDA H  N N 194 
HEM H2A  H  N N 195 
HEM H2D  H  N N 196 
HEM HHA  H  N N 197 
HIS N    N  N N 198 
HIS CA   C  N S 199 
HIS C    C  N N 200 
HIS O    O  N N 201 
HIS CB   C  N N 202 
HIS CG   C  Y N 203 
HIS ND1  N  Y N 204 
HIS CD2  C  Y N 205 
HIS CE1  C  Y N 206 
HIS NE2  N  Y N 207 
HIS OXT  O  N N 208 
HIS H    H  N N 209 
HIS H2   H  N N 210 
HIS HA   H  N N 211 
HIS HB2  H  N N 212 
HIS HB3  H  N N 213 
HIS HD1  H  N N 214 
HIS HD2  H  N N 215 
HIS HE1  H  N N 216 
HIS HE2  H  N N 217 
HIS HXT  H  N N 218 
ILE N    N  N N 219 
ILE CA   C  N S 220 
ILE C    C  N N 221 
ILE O    O  N N 222 
ILE CB   C  N S 223 
ILE CG1  C  N N 224 
ILE CG2  C  N N 225 
ILE CD1  C  N N 226 
ILE OXT  O  N N 227 
ILE H    H  N N 228 
ILE H2   H  N N 229 
ILE HA   H  N N 230 
ILE HB   H  N N 231 
ILE HG12 H  N N 232 
ILE HG13 H  N N 233 
ILE HG21 H  N N 234 
ILE HG22 H  N N 235 
ILE HG23 H  N N 236 
ILE HD11 H  N N 237 
ILE HD12 H  N N 238 
ILE HD13 H  N N 239 
ILE HXT  H  N N 240 
LEU N    N  N N 241 
LEU CA   C  N S 242 
LEU C    C  N N 243 
LEU O    O  N N 244 
LEU CB   C  N N 245 
LEU CG   C  N N 246 
LEU CD1  C  N N 247 
LEU CD2  C  N N 248 
LEU OXT  O  N N 249 
LEU H    H  N N 250 
LEU H2   H  N N 251 
LEU HA   H  N N 252 
LEU HB2  H  N N 253 
LEU HB3  H  N N 254 
LEU HG   H  N N 255 
LEU HD11 H  N N 256 
LEU HD12 H  N N 257 
LEU HD13 H  N N 258 
LEU HD21 H  N N 259 
LEU HD22 H  N N 260 
LEU HD23 H  N N 261 
LEU HXT  H  N N 262 
LYS N    N  N N 263 
LYS CA   C  N S 264 
LYS C    C  N N 265 
LYS O    O  N N 266 
LYS CB   C  N N 267 
LYS CG   C  N N 268 
LYS CD   C  N N 269 
LYS CE   C  N N 270 
LYS NZ   N  N N 271 
LYS OXT  O  N N 272 
LYS H    H  N N 273 
LYS H2   H  N N 274 
LYS HA   H  N N 275 
LYS HB2  H  N N 276 
LYS HB3  H  N N 277 
LYS HG2  H  N N 278 
LYS HG3  H  N N 279 
LYS HD2  H  N N 280 
LYS HD3  H  N N 281 
LYS HE2  H  N N 282 
LYS HE3  H  N N 283 
LYS HZ1  H  N N 284 
LYS HZ2  H  N N 285 
LYS HZ3  H  N N 286 
LYS HXT  H  N N 287 
PHE N    N  N N 288 
PHE CA   C  N S 289 
PHE C    C  N N 290 
PHE O    O  N N 291 
PHE CB   C  N N 292 
PHE CG   C  Y N 293 
PHE CD1  C  Y N 294 
PHE CD2  C  Y N 295 
PHE CE1  C  Y N 296 
PHE CE2  C  Y N 297 
PHE CZ   C  Y N 298 
PHE OXT  O  N N 299 
PHE H    H  N N 300 
PHE H2   H  N N 301 
PHE HA   H  N N 302 
PHE HB2  H  N N 303 
PHE HB3  H  N N 304 
PHE HD1  H  N N 305 
PHE HD2  H  N N 306 
PHE HE1  H  N N 307 
PHE HE2  H  N N 308 
PHE HZ   H  N N 309 
PHE HXT  H  N N 310 
PRO N    N  N N 311 
PRO CA   C  N S 312 
PRO C    C  N N 313 
PRO O    O  N N 314 
PRO CB   C  N N 315 
PRO CG   C  N N 316 
PRO CD   C  N N 317 
PRO OXT  O  N N 318 
PRO H    H  N N 319 
PRO HA   H  N N 320 
PRO HB2  H  N N 321 
PRO HB3  H  N N 322 
PRO HG2  H  N N 323 
PRO HG3  H  N N 324 
PRO HD2  H  N N 325 
PRO HD3  H  N N 326 
PRO HXT  H  N N 327 
SER N    N  N N 328 
SER CA   C  N S 329 
SER C    C  N N 330 
SER O    O  N N 331 
SER CB   C  N N 332 
SER OG   O  N N 333 
SER OXT  O  N N 334 
SER H    H  N N 335 
SER H2   H  N N 336 
SER HA   H  N N 337 
SER HB2  H  N N 338 
SER HB3  H  N N 339 
SER HG   H  N N 340 
SER HXT  H  N N 341 
THR N    N  N N 342 
THR CA   C  N S 343 
THR C    C  N N 344 
THR O    O  N N 345 
THR CB   C  N R 346 
THR OG1  O  N N 347 
THR CG2  C  N N 348 
THR OXT  O  N N 349 
THR H    H  N N 350 
THR H2   H  N N 351 
THR HA   H  N N 352 
THR HB   H  N N 353 
THR HG1  H  N N 354 
THR HG21 H  N N 355 
THR HG22 H  N N 356 
THR HG23 H  N N 357 
THR HXT  H  N N 358 
TRP N    N  N N 359 
TRP CA   C  N S 360 
TRP C    C  N N 361 
TRP O    O  N N 362 
TRP CB   C  N N 363 
TRP CG   C  Y N 364 
TRP CD1  C  Y N 365 
TRP CD2  C  Y N 366 
TRP NE1  N  Y N 367 
TRP CE2  C  Y N 368 
TRP CE3  C  Y N 369 
TRP CZ2  C  Y N 370 
TRP CZ3  C  Y N 371 
TRP CH2  C  Y N 372 
TRP OXT  O  N N 373 
TRP H    H  N N 374 
TRP H2   H  N N 375 
TRP HA   H  N N 376 
TRP HB2  H  N N 377 
TRP HB3  H  N N 378 
TRP HD1  H  N N 379 
TRP HE1  H  N N 380 
TRP HE3  H  N N 381 
TRP HZ2  H  N N 382 
TRP HZ3  H  N N 383 
TRP HH2  H  N N 384 
TRP HXT  H  N N 385 
TYR N    N  N N 386 
TYR CA   C  N S 387 
TYR C    C  N N 388 
TYR O    O  N N 389 
TYR CB   C  N N 390 
TYR CG   C  Y N 391 
TYR CD1  C  Y N 392 
TYR CD2  C  Y N 393 
TYR CE1  C  Y N 394 
TYR CE2  C  Y N 395 
TYR CZ   C  Y N 396 
TYR OH   O  N N 397 
TYR OXT  O  N N 398 
TYR H    H  N N 399 
TYR H2   H  N N 400 
TYR HA   H  N N 401 
TYR HB2  H  N N 402 
TYR HB3  H  N N 403 
TYR HD1  H  N N 404 
TYR HD2  H  N N 405 
TYR HE1  H  N N 406 
TYR HE2  H  N N 407 
TYR HH   H  N N 408 
TYR HXT  H  N N 409 
VAL N    N  N N 410 
VAL CA   C  N S 411 
VAL C    C  N N 412 
VAL O    O  N N 413 
VAL CB   C  N N 414 
VAL CG1  C  N N 415 
VAL CG2  C  N N 416 
VAL OXT  O  N N 417 
VAL H    H  N N 418 
VAL H2   H  N N 419 
VAL HA   H  N N 420 
VAL HB   H  N N 421 
VAL HG11 H  N N 422 
VAL HG12 H  N N 423 
VAL HG13 H  N N 424 
VAL HG21 H  N N 425 
VAL HG22 H  N N 426 
VAL HG23 H  N N 427 
VAL HXT  H  N N 428 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HEM CHA C1A  sing N N 116 
HEM CHA C4D  doub N N 117 
HEM CHA HHA  sing N N 118 
HEM CHB C4A  sing N N 119 
HEM CHB C1B  doub N N 120 
HEM CHB HHB  sing N N 121 
HEM CHC C4B  sing N N 122 
HEM CHC C1C  doub N N 123 
HEM CHC HHC  sing N N 124 
HEM CHD C4C  doub N N 125 
HEM CHD C1D  sing N N 126 
HEM CHD HHD  sing N N 127 
HEM C1A C2A  doub Y N 128 
HEM C1A NA   sing Y N 129 
HEM C2A C3A  sing Y N 130 
HEM C2A CAA  sing N N 131 
HEM C3A C4A  doub Y N 132 
HEM C3A CMA  sing N N 133 
HEM C4A NA   sing Y N 134 
HEM CMA HMA  sing N N 135 
HEM CMA HMAA sing N N 136 
HEM CMA HMAB sing N N 137 
HEM CAA CBA  sing N N 138 
HEM CAA HAA  sing N N 139 
HEM CAA HAAA sing N N 140 
HEM CBA CGA  sing N N 141 
HEM CBA HBA  sing N N 142 
HEM CBA HBAA sing N N 143 
HEM CGA O1A  doub N N 144 
HEM CGA O2A  sing N N 145 
HEM C1B C2B  sing N N 146 
HEM C1B NB   sing N N 147 
HEM C2B C3B  doub N N 148 
HEM C2B CMB  sing N N 149 
HEM C3B C4B  sing N N 150 
HEM C3B CAB  sing N N 151 
HEM C4B NB   doub N N 152 
HEM CMB HMB  sing N N 153 
HEM CMB HMBA sing N N 154 
HEM CMB HMBB sing N N 155 
HEM CAB CBB  doub N N 156 
HEM CAB HAB  sing N N 157 
HEM CBB HBB  sing N N 158 
HEM CBB HBBA sing N N 159 
HEM C1C C2C  sing Y N 160 
HEM C1C NC   sing Y N 161 
HEM C2C C3C  doub Y N 162 
HEM C2C CMC  sing N N 163 
HEM C3C C4C  sing Y N 164 
HEM C3C CAC  sing N N 165 
HEM C4C NC   sing Y N 166 
HEM CMC HMC  sing N N 167 
HEM CMC HMCA sing N N 168 
HEM CMC HMCB sing N N 169 
HEM CAC CBC  doub N N 170 
HEM CAC HAC  sing N N 171 
HEM CBC HBC  sing N N 172 
HEM CBC HBCA sing N N 173 
HEM C1D C2D  sing N N 174 
HEM C1D ND   doub N N 175 
HEM C2D C3D  doub N N 176 
HEM C2D CMD  sing N N 177 
HEM C3D C4D  sing N N 178 
HEM C3D CAD  sing N N 179 
HEM C4D ND   sing N N 180 
HEM CMD HMD  sing N N 181 
HEM CMD HMDA sing N N 182 
HEM CMD HMDB sing N N 183 
HEM CAD CBD  sing N N 184 
HEM CAD HAD  sing N N 185 
HEM CAD HADA sing N N 186 
HEM CBD CGD  sing N N 187 
HEM CBD HBD  sing N N 188 
HEM CBD HBDA sing N N 189 
HEM CGD O1D  doub N N 190 
HEM CGD O2D  sing N N 191 
HEM O2A H2A  sing N N 192 
HEM O2D H2D  sing N N 193 
HEM FE  NA   sing N N 194 
HEM FE  NB   sing N N 195 
HEM FE  NC   sing N N 196 
HEM FE  ND   sing N N 197 
HIS N   CA   sing N N 198 
HIS N   H    sing N N 199 
HIS N   H2   sing N N 200 
HIS CA  C    sing N N 201 
HIS CA  CB   sing N N 202 
HIS CA  HA   sing N N 203 
HIS C   O    doub N N 204 
HIS C   OXT  sing N N 205 
HIS CB  CG   sing N N 206 
HIS CB  HB2  sing N N 207 
HIS CB  HB3  sing N N 208 
HIS CG  ND1  sing Y N 209 
HIS CG  CD2  doub Y N 210 
HIS ND1 CE1  doub Y N 211 
HIS ND1 HD1  sing N N 212 
HIS CD2 NE2  sing Y N 213 
HIS CD2 HD2  sing N N 214 
HIS CE1 NE2  sing Y N 215 
HIS CE1 HE1  sing N N 216 
HIS NE2 HE2  sing N N 217 
HIS OXT HXT  sing N N 218 
ILE N   CA   sing N N 219 
ILE N   H    sing N N 220 
ILE N   H2   sing N N 221 
ILE CA  C    sing N N 222 
ILE CA  CB   sing N N 223 
ILE CA  HA   sing N N 224 
ILE C   O    doub N N 225 
ILE C   OXT  sing N N 226 
ILE CB  CG1  sing N N 227 
ILE CB  CG2  sing N N 228 
ILE CB  HB   sing N N 229 
ILE CG1 CD1  sing N N 230 
ILE CG1 HG12 sing N N 231 
ILE CG1 HG13 sing N N 232 
ILE CG2 HG21 sing N N 233 
ILE CG2 HG22 sing N N 234 
ILE CG2 HG23 sing N N 235 
ILE CD1 HD11 sing N N 236 
ILE CD1 HD12 sing N N 237 
ILE CD1 HD13 sing N N 238 
ILE OXT HXT  sing N N 239 
LEU N   CA   sing N N 240 
LEU N   H    sing N N 241 
LEU N   H2   sing N N 242 
LEU CA  C    sing N N 243 
LEU CA  CB   sing N N 244 
LEU CA  HA   sing N N 245 
LEU C   O    doub N N 246 
LEU C   OXT  sing N N 247 
LEU CB  CG   sing N N 248 
LEU CB  HB2  sing N N 249 
LEU CB  HB3  sing N N 250 
LEU CG  CD1  sing N N 251 
LEU CG  CD2  sing N N 252 
LEU CG  HG   sing N N 253 
LEU CD1 HD11 sing N N 254 
LEU CD1 HD12 sing N N 255 
LEU CD1 HD13 sing N N 256 
LEU CD2 HD21 sing N N 257 
LEU CD2 HD22 sing N N 258 
LEU CD2 HD23 sing N N 259 
LEU OXT HXT  sing N N 260 
LYS N   CA   sing N N 261 
LYS N   H    sing N N 262 
LYS N   H2   sing N N 263 
LYS CA  C    sing N N 264 
LYS CA  CB   sing N N 265 
LYS CA  HA   sing N N 266 
LYS C   O    doub N N 267 
LYS C   OXT  sing N N 268 
LYS CB  CG   sing N N 269 
LYS CB  HB2  sing N N 270 
LYS CB  HB3  sing N N 271 
LYS CG  CD   sing N N 272 
LYS CG  HG2  sing N N 273 
LYS CG  HG3  sing N N 274 
LYS CD  CE   sing N N 275 
LYS CD  HD2  sing N N 276 
LYS CD  HD3  sing N N 277 
LYS CE  NZ   sing N N 278 
LYS CE  HE2  sing N N 279 
LYS CE  HE3  sing N N 280 
LYS NZ  HZ1  sing N N 281 
LYS NZ  HZ2  sing N N 282 
LYS NZ  HZ3  sing N N 283 
LYS OXT HXT  sing N N 284 
PHE N   CA   sing N N 285 
PHE N   H    sing N N 286 
PHE N   H2   sing N N 287 
PHE CA  C    sing N N 288 
PHE CA  CB   sing N N 289 
PHE CA  HA   sing N N 290 
PHE C   O    doub N N 291 
PHE C   OXT  sing N N 292 
PHE CB  CG   sing N N 293 
PHE CB  HB2  sing N N 294 
PHE CB  HB3  sing N N 295 
PHE CG  CD1  doub Y N 296 
PHE CG  CD2  sing Y N 297 
PHE CD1 CE1  sing Y N 298 
PHE CD1 HD1  sing N N 299 
PHE CD2 CE2  doub Y N 300 
PHE CD2 HD2  sing N N 301 
PHE CE1 CZ   doub Y N 302 
PHE CE1 HE1  sing N N 303 
PHE CE2 CZ   sing Y N 304 
PHE CE2 HE2  sing N N 305 
PHE CZ  HZ   sing N N 306 
PHE OXT HXT  sing N N 307 
PRO N   CA   sing N N 308 
PRO N   CD   sing N N 309 
PRO N   H    sing N N 310 
PRO CA  C    sing N N 311 
PRO CA  CB   sing N N 312 
PRO CA  HA   sing N N 313 
PRO C   O    doub N N 314 
PRO C   OXT  sing N N 315 
PRO CB  CG   sing N N 316 
PRO CB  HB2  sing N N 317 
PRO CB  HB3  sing N N 318 
PRO CG  CD   sing N N 319 
PRO CG  HG2  sing N N 320 
PRO CG  HG3  sing N N 321 
PRO CD  HD2  sing N N 322 
PRO CD  HD3  sing N N 323 
PRO OXT HXT  sing N N 324 
SER N   CA   sing N N 325 
SER N   H    sing N N 326 
SER N   H2   sing N N 327 
SER CA  C    sing N N 328 
SER CA  CB   sing N N 329 
SER CA  HA   sing N N 330 
SER C   O    doub N N 331 
SER C   OXT  sing N N 332 
SER CB  OG   sing N N 333 
SER CB  HB2  sing N N 334 
SER CB  HB3  sing N N 335 
SER OG  HG   sing N N 336 
SER OXT HXT  sing N N 337 
THR N   CA   sing N N 338 
THR N   H    sing N N 339 
THR N   H2   sing N N 340 
THR CA  C    sing N N 341 
THR CA  CB   sing N N 342 
THR CA  HA   sing N N 343 
THR C   O    doub N N 344 
THR C   OXT  sing N N 345 
THR CB  OG1  sing N N 346 
THR CB  CG2  sing N N 347 
THR CB  HB   sing N N 348 
THR OG1 HG1  sing N N 349 
THR CG2 HG21 sing N N 350 
THR CG2 HG22 sing N N 351 
THR CG2 HG23 sing N N 352 
THR OXT HXT  sing N N 353 
TRP N   CA   sing N N 354 
TRP N   H    sing N N 355 
TRP N   H2   sing N N 356 
TRP CA  C    sing N N 357 
TRP CA  CB   sing N N 358 
TRP CA  HA   sing N N 359 
TRP C   O    doub N N 360 
TRP C   OXT  sing N N 361 
TRP CB  CG   sing N N 362 
TRP CB  HB2  sing N N 363 
TRP CB  HB3  sing N N 364 
TRP CG  CD1  doub Y N 365 
TRP CG  CD2  sing Y N 366 
TRP CD1 NE1  sing Y N 367 
TRP CD1 HD1  sing N N 368 
TRP CD2 CE2  doub Y N 369 
TRP CD2 CE3  sing Y N 370 
TRP NE1 CE2  sing Y N 371 
TRP NE1 HE1  sing N N 372 
TRP CE2 CZ2  sing Y N 373 
TRP CE3 CZ3  doub Y N 374 
TRP CE3 HE3  sing N N 375 
TRP CZ2 CH2  doub Y N 376 
TRP CZ2 HZ2  sing N N 377 
TRP CZ3 CH2  sing Y N 378 
TRP CZ3 HZ3  sing N N 379 
TRP CH2 HH2  sing N N 380 
TRP OXT HXT  sing N N 381 
TYR N   CA   sing N N 382 
TYR N   H    sing N N 383 
TYR N   H2   sing N N 384 
TYR CA  C    sing N N 385 
TYR CA  CB   sing N N 386 
TYR CA  HA   sing N N 387 
TYR C   O    doub N N 388 
TYR C   OXT  sing N N 389 
TYR CB  CG   sing N N 390 
TYR CB  HB2  sing N N 391 
TYR CB  HB3  sing N N 392 
TYR CG  CD1  doub Y N 393 
TYR CG  CD2  sing Y N 394 
TYR CD1 CE1  sing Y N 395 
TYR CD1 HD1  sing N N 396 
TYR CD2 CE2  doub Y N 397 
TYR CD2 HD2  sing N N 398 
TYR CE1 CZ   doub Y N 399 
TYR CE1 HE1  sing N N 400 
TYR CE2 CZ   sing Y N 401 
TYR CE2 HE2  sing N N 402 
TYR CZ  OH   sing N N 403 
TYR OH  HH   sing N N 404 
TYR OXT HXT  sing N N 405 
VAL N   CA   sing N N 406 
VAL N   H    sing N N 407 
VAL N   H2   sing N N 408 
VAL CA  C    sing N N 409 
VAL CA  CB   sing N N 410 
VAL CA  HA   sing N N 411 
VAL C   O    doub N N 412 
VAL C   OXT  sing N N 413 
VAL CB  CG1  sing N N 414 
VAL CB  CG2  sing N N 415 
VAL CB  HB   sing N N 416 
VAL CG1 HG11 sing N N 417 
VAL CG1 HG12 sing N N 418 
VAL CG1 HG13 sing N N 419 
VAL CG2 HG21 sing N N 420 
VAL CG2 HG22 sing N N 421 
VAL CG2 HG23 sing N N 422 
VAL OXT HXT  sing N N 423 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 AMX       Bruker 600 ? 
2 UNITYPLUS Varian 500 ? 
# 
_atom_sites.entry_id                    1B5B 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
H  
N  
O  
# 
loop_