data_1BBG # _entry.id 1BBG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BBG pdb_00001bbg 10.2210/pdb1bbg/pdb WWPDB D_1000171559 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2BBG _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BBG _pdbx_database_status.recvd_initial_deposition_date 1998-04-24 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Warren, G.L.' 1 'Tuner, C.J.' 2 'Petsko, G.A.' 3 'Brunger, A.T.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'A Highly Precise Solution 1H NMR Structure of Ragweed Allergen Amb. T. V' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Determination of the Three-Dimensional Solution Structure of Ragweed Allergen Amb T V by Nuclear Magnetic Resonance Spectroscopy' Biochemistry 31 5117 ? 1992 BICHAW US 0006-2960 0033 ? ? ? 2 'Ra5G, a Homologue of Ra5 in Giant Ragweed Pollen: Isolation, Hla-Dr-Associated Activity and Amino Acid Sequence' Mol.Immunol. 22 899 ? 1985 MOIMD5 UK 0161-5890 0921 ? ? ? 3 '500-Mhz 1H NMR Studies of Ragweed Allergen Ra5' Biochemistry 24 2747 ? 1985 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Warren, G.L.' 1 ? primary 'Turner, C.J.' 2 ? primary 'Petsko, G.A.' 3 ? primary 'Brunger, A.T.' 4 ? 1 'Metzler, W.J.' 5 ? 1 'Valentine, K.' 6 ? 1 'Roebber, M.' 7 ? 1 'Friedrichs, M.S.' 8 ? 1 'Marsh, D.G.' 9 ? 1 'Mueller, L.' 10 ? 2 'Goodfriend, L.' 11 ? 2 'Choudhury, A.M.' 12 ? 2 'Klapper, D.G.' 13 ? 2 'Coulter, K.M.' 14 ? 2 'Dorval, G.' 15 ? 2 'Del Carpio, J.' 16 ? 2 'Osterland, C.K.' 17 ? 3 'Vidusek, D.A.' 18 ? 3 'Roberts, M.F.' 19 ? 3 'Goodfriend, L.' 20 ? # _cell.entry_id 1BBG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BBG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'POLLEN ALLERGEN 5' _entity.formula_weight 4325.987 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DDGLCYEGTNCGKVGKYCCSPIGKYCVCYDSKAICNKNCT _entity_poly.pdbx_seq_one_letter_code_can DDGLCYEGTNCGKVGKYCCSPIGKYCVCYDSKAICNKNCT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ASP n 1 3 GLY n 1 4 LEU n 1 5 CYS n 1 6 TYR n 1 7 GLU n 1 8 GLY n 1 9 THR n 1 10 ASN n 1 11 CYS n 1 12 GLY n 1 13 LYS n 1 14 VAL n 1 15 GLY n 1 16 LYS n 1 17 TYR n 1 18 CYS n 1 19 CYS n 1 20 SER n 1 21 PRO n 1 22 ILE n 1 23 GLY n 1 24 LYS n 1 25 TYR n 1 26 CYS n 1 27 VAL n 1 28 CYS n 1 29 TYR n 1 30 ASP n 1 31 SER n 1 32 LYS n 1 33 ALA n 1 34 ILE n 1 35 CYS n 1 36 ASN n 1 37 LYS n 1 38 ASN n 1 39 CYS n 1 40 THR n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'giant ragweed' _entity_src_nat.pdbx_organism_scientific 'Ambrosia trifida' _entity_src_nat.pdbx_ncbi_taxonomy_id 4214 _entity_src_nat.genus Ambrosia _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details POLLEN # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MPAT5_AMBTR _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P10414 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MKNIFMLTLFILIITSTIKAIGSTNEVDEIKQEDDGLCYEGTNCGKVGKYCCSPIGKYCVCYDSKAICNKNCT _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BBG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10414 _struct_ref_seq.db_align_beg 34 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 73 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 DQFCOSY 1 3 1 PCOSY 1 4 1 PECOSY 1 5 1 TOCSY 1 6 1 3DNOESY-TOCSY 1 7 1 3DTOCSY-NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 'HOME BUILT' Home-built 501.9 2 'HOME BUILT' Home-built 591.1 # _pdbx_nmr_refine.entry_id 1BBG _pdbx_nmr_refine.method 'ITERATIVE SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE MANUSCRIPT SUBMITTED TO JMB ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1BBG _pdbx_nmr_details.text 'THIS IS A MINIMIZED AVERAGE STRUCTURE. THE STRUCTURE WAS DETERMINING USING HOMONUCLEAR 2- AND 3-D NMR SPECTROSCOPY' # _pdbx_nmr_ensemble.entry_id 1BBG _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'BONDS RMS < 0.01, ANGLE RMS < 1.0, IMPROPER RMS < 1.0, 0 NOE VIOL > 0.5, 0 DIHEDRAL VIOL > 5.0' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 0.3 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE-KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ,RICE,SIMONSON,WARREN' 1 'structure solution' 'MSI FELIX' FELIX ? 2 'structure solution' NMRCompass ? ? 3 # _exptl.entry_id 1BBG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BBG _struct.title 'RAGWEED POLLEN ALLERGEN FROM AMBROSIA TRIFIDA V, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BBG _struct_keywords.pdbx_keywords ALLERGEN _struct_keywords.text 'PROTEIN ALLERGEN, SMALL HIGHLY DISULFIDE BONDED, ALLERGEN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 32 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 36 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 32 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 36 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 5 A CYS 35 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 11 A CYS 26 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf3 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 18 A CYS 28 1_555 ? ? ? ? ? ? ? 2.015 ? ? disulf4 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 19 A CYS 39 1_555 ? ? ? ? ? ? ? 2.015 ? ? hydrog1 hydrog ? ? A TYR 6 O ? ? ? 1_555 A CYS 18 N ? ? A TYR 6 A CYS 18 1_555 ? ? ? ? ? ? ? ? ? ? hydrog2 hydrog ? ? A TYR 17 O ? ? ? 1_555 A TYR 29 N ? ? A TYR 17 A TYR 29 1_555 ? ? ? ? ? ? ? ? ? ? hydrog3 hydrog ? ? A CYS 18 O ? ? ? 1_555 A TYR 6 N ? ? A CYS 18 A TYR 6 1_555 ? ? ? ? ? ? ? ? ? ? hydrog4 hydrog ? ? A CYS 19 O ? ? ? 1_555 A VAL 27 N ? ? A CYS 19 A VAL 27 1_555 ? ? ? ? ? ? ? ? ? ? hydrog5 hydrog ? ? A VAL 27 O ? ? ? 1_555 A CYS 19 N ? ? A VAL 27 A CYS 19 1_555 ? ? ? ? ? ? ? ? ? ? hydrog6 hydrog ? ? A TYR 29 O ? ? ? 1_555 A TYR 17 N ? ? A TYR 29 A TYR 17 1_555 ? ? ? ? ? ? ? ? ? ? hydrog7 hydrog ? ? A LYS 13 O ? ? ? 1_555 A LYS 16 N ? ? A LYS 13 A LYS 16 1_555 ? ? ? ? ? ? ? ? ? ? hydrog8 hydrog ? ? A SER 31 O ? ? ? 1_555 A CYS 35 N ? ? A SER 31 A CYS 35 1_555 ? ? ? ? ? ? ? ? ? ? hydrog9 hydrog ? ? A LYS 32 O ? ? ? 1_555 A ASN 36 N ? ? A LYS 32 A ASN 36 1_555 ? ? ? ? ? ? ? ? ? ? hydrog10 hydrog ? ? A ALA 33 O ? ? ? 1_555 A LYS 37 N ? ? A ALA 33 A LYS 37 1_555 ? ? ? ? ? ? ? ? ? ? hydrog11 hydrog ? ? A ILE 34 O ? ? ? 1_555 A ASN 38 N ? ? A ILE 34 A ASN 38 1_555 ? ? ? ? ? ? ? ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? hydrog ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 17 ? CYS A 19 ? TYR A 17 CYS A 19 A 2 VAL A 27 ? TYR A 29 ? VAL A 27 TYR A 29 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 17 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 17 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 29 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 29 # _database_PDB_matrix.entry_id 1BBG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BBG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 THR 40 40 40 THR THR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-06-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 0.3 ? 1 CNS phasing 0.3 ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD3 A LYS 13 ? ? SG A CYS 18 ? ? 1.04 2 1 O A CYS 35 ? ? HB2 A CYS 39 ? ? 1.04 3 1 HE3 A LYS 13 ? ? H A CYS 18 ? ? 1.16 4 1 HB2 A SER 31 ? ? HG13 A ILE 34 ? ? 1.21 5 1 HG23 A ILE 22 ? ? HD2 A LYS 24 ? ? 1.21 6 1 HZ1 A LYS 13 ? ? HB2 A CYS 18 ? ? 1.25 7 1 HG22 A THR 9 ? ? HG21 A VAL 14 ? ? 1.29 8 1 HG13 A VAL 27 ? ? HE1 A TYR 29 ? ? 1.31 9 1 HG21 A ILE 22 ? ? H A LYS 24 ? ? 1.31 10 1 HD2 A LYS 13 ? ? C A TYR 17 ? ? 1.48 11 1 O A SER 31 ? ? H A ILE 34 ? ? 1.49 12 1 CB A TYR 29 ? ? HG23 A ILE 34 ? ? 1.52 13 1 HE3 A LYS 13 ? ? N A CYS 18 ? ? 1.53 14 1 HD2 A LYS 13 ? ? O A TYR 17 ? ? 1.53 15 1 HB3 A LYS 16 ? ? O A TYR 29 ? ? 1.54 16 1 CG A TYR 29 ? ? HG23 A ILE 34 ? ? 1.58 17 1 O A CYS 35 ? ? CB A CYS 39 ? ? 1.71 18 1 CD A LYS 13 ? ? SG A CYS 18 ? ? 1.73 19 1 O A LYS 37 ? ? OG1 A THR 40 ? ? 1.96 20 1 O A SER 31 ? ? N A ILE 34 ? ? 2.09 21 1 O A CYS 35 ? ? SG A CYS 39 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 9 ? ? -155.48 23.74 2 1 LYS A 16 ? ? -109.62 -132.41 3 1 SER A 20 ? ? -165.72 119.13 4 1 ILE A 22 ? ? -165.43 10.51 5 1 CYS A 26 ? ? 32.42 62.20 6 1 LYS A 32 ? ? -37.66 -38.20 7 1 CYS A 35 ? ? -62.52 -72.98 8 1 LYS A 37 ? ? -59.05 -80.74 #