data_1BBI # _entry.id 1BBI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1BBI WWPDB D_1000171561 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2BBI _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BBI _pdbx_database_status.recvd_initial_deposition_date 1991-09-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Werner, M.H.' 1 'Wemmer, D.E.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Three-dimensional structure of soybean trypsin/chymotrypsin Bowman-Birk inhibitor in solution.' Biochemistry 31 999 1010 1992 BICHAW US 0006-2960 0033 ? 1734975 10.1021/bi00119a008 1 '1H Assignments and Secondary Structure Determination of the Soybean Trypsin(Slash)Chymotrypsin Bowman-Birk Inhibitor' Biochemistry 30 3356 ? 1991 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Werner, M.H.' 1 primary 'Wemmer, D.E.' 2 1 'Werner, M.H.' 3 1 'Wemmer, D.E.' 4 # _cell.entry_id 1BBI _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BBI _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TRYPSIN/CHYMOTRYPSIN BOWMAN-BIRK INHIBITOR' _entity.formula_weight 7880.859 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDKEN _entity_poly.pdbx_seq_one_letter_code_can DDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDKEN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ASP n 1 3 GLU n 1 4 SER n 1 5 SER n 1 6 LYS n 1 7 PRO n 1 8 CYS n 1 9 CYS n 1 10 ASP n 1 11 GLN n 1 12 CYS n 1 13 ALA n 1 14 CYS n 1 15 THR n 1 16 LYS n 1 17 SER n 1 18 ASN n 1 19 PRO n 1 20 PRO n 1 21 GLN n 1 22 CYS n 1 23 ARG n 1 24 CYS n 1 25 SER n 1 26 ASP n 1 27 MET n 1 28 ARG n 1 29 LEU n 1 30 ASN n 1 31 SER n 1 32 CYS n 1 33 HIS n 1 34 SER n 1 35 ALA n 1 36 CYS n 1 37 LYS n 1 38 SER n 1 39 CYS n 1 40 ILE n 1 41 CYS n 1 42 ALA n 1 43 LEU n 1 44 SER n 1 45 TYR n 1 46 PRO n 1 47 ALA n 1 48 GLN n 1 49 CYS n 1 50 PHE n 1 51 CYS n 1 52 VAL n 1 53 ASP n 1 54 ILE n 1 55 THR n 1 56 ASP n 1 57 PHE n 1 58 CYS n 1 59 TYR n 1 60 GLU n 1 61 PRO n 1 62 CYS n 1 63 LYS n 1 64 PRO n 1 65 SER n 1 66 GLU n 1 67 ASP n 1 68 ASP n 1 69 LYS n 1 70 GLU n 1 71 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name soybean _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Glycine max' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3847 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IBB1_SOYBN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01055 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MVVLKVCLVLLFLVGGTTSANLRLSKLGLLMKSDHQHSNDDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCIC ALSYPAQCFCVDITDFCYEPCKPSEDDKEN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BBI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01055 _struct_ref_seq.db_align_beg 40 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1BBI _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1BBI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BBI _struct.title 'THREE-DIMENSIONAL STRUCTURE OF SOYBEAN TRYPSIN(SLASH)CHYMOTRYPSIN BOWMAN-BIRK INHIBITOR IN SOLUTION' _struct.pdbx_descriptor 'TRYPSIN/CHYMOTRYPSIN BOWMAN-BIRK INHIBITOR (NMR, MINIMIZED AVERAGE STRUCTURE)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BBI _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' _struct_keywords.text 'SERINE PROTEASE INHIBITOR, HYDROLASE INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 62 SG ? ? A CYS 8 A CYS 62 1_555 ? ? ? ? ? ? ? 2.020 ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 9 A CYS 24 1_555 ? ? ? ? ? ? ? 2.006 ? disulf3 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 58 SG ? ? A CYS 12 A CYS 58 1_555 ? ? ? ? ? ? ? 2.012 ? disulf4 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 14 A CYS 22 1_555 ? ? ? ? ? ? ? 2.026 ? disulf5 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 32 A CYS 39 1_555 ? ? ? ? ? ? ? 2.012 ? disulf6 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 36 A CYS 51 1_555 ? ? ? ? ? ? ? 2.013 ? disulf7 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 36 A CYS 39 1_555 ? ? ? ? ? ? ? 2.994 ? disulf8 disulf ? ? A CYS 41 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 41 A CYS 49 1_555 ? ? ? ? ? ? ? 2.018 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 18 A . ? ASN 18 A PRO 19 A ? PRO 19 A 1 -0.47 2 TYR 45 A . ? TYR 45 A PRO 46 A ? PRO 46 A 1 -0.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 12 ? THR A 15 ? CYS A 12 THR A 15 A 2 GLN A 21 ? CYS A 24 ? GLN A 21 CYS A 24 B 1 MET A 27 ? ARG A 28 ? MET A 27 ARG A 28 B 2 GLN A 48 ? CYS A 51 ? GLN A 48 CYS A 51 B 3 CYS A 39 ? ALA A 42 ? CYS A 39 ALA A 42 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 15 ? N THR A 15 O GLN A 21 ? O GLN A 21 B 1 2 N ARG A 28 ? N ARG A 28 O CYS A 49 ? O CYS A 49 B 2 3 O GLN A 48 ? O GLN A 48 N ALA A 42 ? N ALA A 42 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details T1 Unknown ? ? ? ? 2 ? C1 Unknown ? ? ? ? 2 ? # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 T1 2 LYS A 16 ? LYS A 16 . ? 1_555 ? 2 T1 2 SER A 17 ? SER A 17 . ? 1_555 ? 3 C1 2 LEU A 43 ? LEU A 43 . ? 1_555 ? 4 C1 2 SER A 44 ? SER A 44 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BBI _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BBI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'CIS PROLINE - PRO 19' 2 'CIS PROLINE - PRO 46' # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASN 71 71 71 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1993-10-31 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-05-09 5 'Structure model' 1 4 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 5 'Structure model' 'Derived calculations' 5 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' pdbx_database_status 2 5 'Structure model' struct_conf # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 5 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 HIS _pdbx_validate_rmsd_bond.auth_seq_id_1 33 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 ND1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 HIS _pdbx_validate_rmsd_bond.auth_seq_id_2 33 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.251 _pdbx_validate_rmsd_bond.bond_target_value 1.369 _pdbx_validate_rmsd_bond.bond_deviation -0.118 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.015 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 8 ? ? -135.03 -151.13 2 1 ASP A 10 ? ? -143.86 -76.64 3 1 ASP A 26 ? ? -37.60 -73.15 4 1 LEU A 29 ? ? -86.83 36.60 5 1 ASN A 30 ? ? -162.72 -88.34 6 1 CYS A 32 ? ? -98.31 -159.50 7 1 HIS A 33 ? ? -137.37 -142.03 8 1 SER A 38 ? ? -112.26 64.72 9 1 LEU A 43 ? ? -67.30 87.21 10 1 PHE A 57 ? ? -153.33 -6.50 11 1 CYS A 58 ? ? 55.37 103.03 12 1 TYR A 59 ? ? -47.94 178.73 13 1 PRO A 61 ? ? -43.32 157.50 14 1 CYS A 62 ? ? -94.63 -153.39 15 1 LYS A 63 ? ? 63.02 65.87 16 1 PRO A 64 ? ? -56.05 -155.72 17 1 SER A 65 ? ? 68.12 -146.35 18 1 GLU A 66 ? ? -60.99 -158.90 19 1 ASP A 67 ? ? -78.63 -121.30 20 1 ASP A 68 ? ? -53.58 -171.84 21 1 LYS A 69 ? ? -154.11 -55.54 22 1 GLU A 70 ? ? -82.69 -76.89 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 23 ? ? 0.312 'SIDE CHAIN' 2 1 ARG A 28 ? ? 0.248 'SIDE CHAIN' #