data_1BBO # _entry.id 1BBO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.381 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BBO pdb_00001bbo 10.2210/pdb1bbo/pdb WWPDB D_1000171565 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BBO _pdbx_database_status.recvd_initial_deposition_date 1992-05-01 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Clore, G.M.' 1 'Omichinski, J.G.' 2 'Gronenborn, A.M.' 3 # _citation.id primary _citation.title 'High-resolution solution structure of the double Cys2His2 zinc finger from the human enhancer binding protein MBP-1.' _citation.journal_abbrev Biochemistry _citation.journal_volume 31 _citation.page_first 3907 _citation.page_last 3917 _citation.year 1992 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 1567844 _citation.pdbx_database_id_DOI 10.1021/bi00131a004 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Omichinski, J.G.' 1 ? primary 'Clore, G.M.' 2 ? primary 'Robien, M.' 3 ? primary 'Sakaguchi, K.' 4 ? primary 'Appella, E.' 5 ? primary 'Gronenborn, A.M.' 6 ? # _cell.entry_id 1BBO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BBO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HUMAN ENHANCER-BINDING PROTEIN MBP-1' 6774.106 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'KYICEECGIR(ABA)KKPSMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKK' _entity_poly.pdbx_seq_one_letter_code_can KYICEECGIRAKKPSMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 TYR n 1 3 ILE n 1 4 CYS n 1 5 GLU n 1 6 GLU n 1 7 CYS n 1 8 GLY n 1 9 ILE n 1 10 ARG n 1 11 ABA n 1 12 LYS n 1 13 LYS n 1 14 PRO n 1 15 SER n 1 16 MET n 1 17 LEU n 1 18 LYS n 1 19 LYS n 1 20 HIS n 1 21 ILE n 1 22 ARG n 1 23 THR n 1 24 HIS n 1 25 THR n 1 26 ASP n 1 27 VAL n 1 28 ARG n 1 29 PRO n 1 30 TYR n 1 31 HIS n 1 32 CYS n 1 33 THR n 1 34 TYR n 1 35 CYS n 1 36 ASN n 1 37 PHE n 1 38 SER n 1 39 PHE n 1 40 LYS n 1 41 THR n 1 42 LYS n 1 43 GLY n 1 44 ASN n 1 45 LEU n 1 46 THR n 1 47 LYS n 1 48 HIS n 1 49 MET n 1 50 LYS n 1 51 SER n 1 52 LYS n 1 53 ALA n 1 54 HIS n 1 55 SER n 1 56 LYS n 1 57 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZEP1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P15822 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MPRTKQIHPRNLRDKIEEAQKELNGAEVSKKEILQAGVKGTSESLKGVKRKKIVAENHLKKIPKSPLRNPLQAKHKQNTE ESSFAVLHSASESHKKQNYIPVKNGKQFTKQNGETPGIIAEASKSEESVSPKKPLFLQQPSELRRWRSEGADPAKFSDLD EQCDSSSLSSKTRTDNSECISSHCGTTSPSYTNTAFDVLLKAMEPELSTLSQKGSPCAIKTEKLRPNKTARSPPKLKNSS MDAPNQTSQELVAESQSSCTSYTVHMSAAQKNEQGAMQSASHLYHQHEHFVPKSNQHNQQLPGCSGFTGSLTNLQNQENA KLEQVYNIAVTSSVGLTSPSSRSQVTPQNQQMDSASPLSISPANSTQSPPMPIYNSTHVASVVNQSVEQMCNLLLKDQKP KKQGKYICEYCNRACAKPSVLLKHIRSHTGERPYPCVTCGFSFKTKSNLYKHKKSHAHTIKLGLVLQPDAGGLFLSHESP KALSIHSDVEDSGESEEEGATDERQHDLGAMELQNVHIIKRMSNAETLLKSSFTPSSPENVIGDFLLQDRSAESQAVTEL PKVVVHHVTVSPLRTDSPKAMDPKPELSSAQKQKDLQVTNVQPLSANMSQGGVSRLETNENSHQKGDMNPLEGKQDSHVG TVHAQLQRQQATDYSQEQQGKLLSPRSLGSTDSGYFSRSESADQTVSPPTPFARRFPAQNKTLEGVTDPLQLLSPRQHPL LCHREKALLLPGQMRPPLATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSIDSPKSYIFKDSFQFDLKPVGR RTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSNSMPTTGYSAVPANIIPPPHPLRGSQSFDDKIGAFYDDVFVS GPNAPVPQSGHPRTLVRQAAIEDSSANESHVLGTGQSLDESHQGCHAAGEAMSVRSKALAQGPHIEKKKSHQGRGTMFEC ETCRNRYRKLENFENHKKFYCSELHGPKTKVAMREPEHSPVPGGLQPQILHYRVAGSSGIWEQTPQIRKRRKMKSVGDDE ELQQNESGTSPKSSEGLQFQNALGCNPSLPKHSVTIRSDQQHKNIQLQNSHIHLVARGPEQTMDPKLSTIMEQQISSAAQ DKIELQRHGTGISVIQHTNSLSRPNSFDKPEPFERASPVSFQELNRTGNSGSLKVIGISQEESHPSRDGSHPHQLALSDA LRGELQESSRKSPSERHVLGQPSRLIRQHNIQVPEILVTEEPDRDLEAQCHDQEKSEKFSWPQRSETLSKLPTEKLPPKK KRLRLAEIEHSSTESSFDSTLSRSLSRESSLSHTSSFSASLDIEDVSKTEASPKIDFLNKAEFLMIPAGLNTLNVPGCHR EMRRTASEQINCTQTSMEVSDLRSKSFDCGSITPPQTTPLTELQPPSSPSRVGVTGHVPLLERRRGPLVRQISLGIAPDS HLSPVHPTSFQNTALPSVNAVPYQGPQLTSTSLAEFSANTLHSQTQVKDLQAETSNSSSTNVFPVQQLCDINLLNQIHAP PSHQSTQLSLQVSTQGSKPDKNSVLSGSSKSEDCFAPKYQLHCQVFTSGPSCSSNPVHSLPNQVISDPVGTDHCVTSATL PTKLIDSMSNSHPLLPPELRPLGSQVQKVPSSFMLPIRLQSSVPAYCFATLTSLPQILVTQDLPNQPICQTNHSVVPISE EQNSVPTLQKGHQNALPNPEKEFLCENVFSEMSQNSSLSESLPITQKISVGRLSPQQESSASSKRMLSPANSLDIAMEKH QKRAKDENGAVCATDVRPLEALSSRVNEASKQKKPILVRQVCTTEPLDGVMLEKDVFSQPEISNEAVNLTNVLPADNSST GCSKFVVIEPISELQEFENIKSSTSLTLTVRSSPAPSENTHLSPLKCTDNNQERKSPGVKNQGDKVNIQEQSQRPVTSLS LFNIKDTQQLAFPSLKTTTNFTWCYLLRQKSLHLPQKDQKTSAYTDWTVSASNPNPLGLPTKVALALLNSKQNTGKSLYC QAITTHSKSDLLVYSSKWKSSLSKRALGNQKSTVVEFSNKDASEINSEQDKENSLIKSEPRRIKIFDGGYKSNEEYVYIR GRGRGKYICEECGIRCKKPSMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKKCVDLGISVGLIDEQDTEE SDEKQRFSYERSGYDLEESDGPDEDDNENEDDDEDSQAESVLSATPSVTASPQHLPSRSSLQDPVSTDEDVRITDCFSGV HTDPMDVLPRALLTRMTVLSTAQSDYNRKTLSPGKARQRAARDENDTIPSVDTSRSPCHQMSVDYPESEEILRSSMAGKA VAITQSPSSVRLPPAAAEHSPQTAAGMPSVASPHPDPQEQKQQITLQPTPGLPSPHTHLFSHLPLHSQQQSRTPYNMVPV GGIHVVPAGLTYSTFVPLQAGPVQLTIPAVSVVHRTLGTHRNTVTEVSGTTNPAGVAELSSVVPCIPIGQIRVPGLQNLS TPGLQSLPSLSMETVNIVGLANTNMAPQVHPPGLALNAVGLQVLTANPSSQSSPAPQAHIPGLQILNIALPTLIPSVSQV AVDAQGAPEMPASQSKACETQPKQTSVASANQVSRTESPQGLPTVQRENAKKVLNPPAPAGDHARLDGLSKMDTEKAASA NHVKPKPELTSIQGQPASTSQPLLKAHSEVFTKPSGQQTLSPDRQVPRPTGLPRRQPTVHFSDVSSDDDEDRLVIAT ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BBO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15822 _struct_ref_seq.db_align_beg 2086 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 57 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1BBO _struct_ref_seq_dif.mon_id ABA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 11 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P15822 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 2096 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 11 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _pdbx_nmr_refine.entry_id 1BBO _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;DETAILS OF THE STRUCTURE DETERMINATION AND ALL STRUCTURAL STATISTICS ARE GIVEN IN THE JRNL REFERENCE ABOVE. THE STRUCTURES ARE BASED ON 1135 INTERPROTON DISTANCE RESTRAINTS DERIVED FROM NOE MEASUREMENTS; AND 55 PHI, 44 PSI AND 45 CHI1 TORSION ANGLE RESTRAINTS DERIVED FROM COUPLING CONSTANTS AND NOE DATA, USING THE CONFORMATIONAL GRID SEARCH PROGRAM STEREOSEARCH (M. NILGES, G. M. CLORE, AND A. M. GRONENBORN, (1990) BIOPOLYMERS 29, 813. THE METHOD USED TO DETERMINE THE STRUCTURES IS THE HYBRID METRIC MATRIX DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING METHOD (M. NILGES, G. M. CLORE, AND A. M. GRONENBORN, FEBS LETT. 229, 317-324 (1988)). A TOTAL OF 30 STRUCTURES WERE CALCULATED. AS THERE IS SOME UNCERTAINTY IN THE EXACT ORIENTATION OF THE N- AND C- TERMINAL FINGERS RELATIVE TO EACH OTHER, THE COORDINATES ARE PRESENTED TWICE. IN MODELS 1 THROUGH 30, THE COORDINATES ARE BEST FITTED TO THE N-TERMINAL DOMAIN (RESIDUES 2 - 28). IN MODELS 31 THROUGH 60, THE COORDINATES ARE BEST FITTED TO THE C-TERMINAL DOMAIN (RESIDUES 27 - 55). THE ANGLE BETWEEN THE LONG AXES OF THE HELICES (RESIDUES 13 - 25 AND 41 - 55 FROM THE N- AND C- TERMINAL FINGERS, RESPECTIVELY) ADOPT A RANGE OF VALUES CENTERED AROUND A MEAN OF 47 DEGREES WITH A STANDARD DEVIATION OF +/- 5 DEGREES. CONSEQUENTLY, NO AVERAGE STRUCTURE IS GIVEN. THE NUMBERS IN LAST COLUMN IN THE COORDINATE FILES HAVE NO MEANING. ALL THE INTERPROTON DISTANCE AND TORSION ANGLE RESTRAINTS ARE INCLUDED HERE AS A SEPARATE FILE: MBP_EXPT_DATA.DAT ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1BBO _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 60 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1BBO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BBO _struct.title 'HIGH-RESOLUTION SOLUTION STRUCTURE OF THE DOUBLE CYS2*HIS2 ZINC FINGER FROM THE HUMAN ENHANCER BINDING PROTEIN MBP-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BBO _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA-BINDING PROTEIN, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 13 ? HIS A 24 ? LYS A 13 HIS A 24 1 ? 12 HELX_P HELX_P2 2 THR A 41 ? SER A 51 ? THR A 41 SER A 51 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ARG 10 C ? ? ? 1_555 A ABA 11 N ? ? A ARG 10 A ABA 11 1_555 ? ? ? ? ? ? ? 1.310 ? ? covale2 covale both ? A ABA 11 C ? ? ? 1_555 A LYS 12 N ? ? A ABA 11 A LYS 12 1_555 ? ? ? ? ? ? ? 1.303 ? ? metalc1 metalc ? ? A CYS 4 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 4 A ZN 60 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc2 metalc ? ? A CYS 7 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 7 A ZN 60 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc3 metalc ? ? A HIS 20 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 20 A ZN 60 1_555 ? ? ? ? ? ? ? 1.997 ? ? metalc4 metalc ? ? A HIS 24 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 24 A ZN 60 1_555 ? ? ? ? ? ? ? 1.983 ? ? metalc5 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 32 A ZN 61 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc6 metalc ? ? A CYS 35 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 35 A ZN 61 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc7 metalc ? ? A HIS 48 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 48 A ZN 61 1_555 ? ? ? ? ? ? ? 1.998 ? ? metalc8 metalc ? ? A HIS 54 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 54 A ZN 61 1_555 ? ? ? ? ? ? ? 1.994 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 30 ? HIS A 31 ? TYR A 30 HIS A 31 A 2 SER A 38 ? PHE A 39 ? SER A 38 PHE A 39 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 30 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 30 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 39 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 39 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 60 ? 4 'BINDING SITE FOR RESIDUE ZN A 60' AC2 Software A ZN 61 ? 4 'BINDING SITE FOR RESIDUE ZN A 61' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 4 ? CYS A 4 . ? 1_555 ? 2 AC1 4 CYS A 7 ? CYS A 7 . ? 1_555 ? 3 AC1 4 HIS A 20 ? HIS A 20 . ? 1_555 ? 4 AC1 4 HIS A 24 ? HIS A 24 . ? 1_555 ? 5 AC2 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 6 AC2 4 CYS A 35 ? CYS A 35 . ? 1_555 ? 7 AC2 4 HIS A 48 ? HIS A 48 . ? 1_555 ? 8 AC2 4 HIS A 54 ? HIS A 54 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BBO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BBO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ABA 11 11 11 ABA ABA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LYS 57 57 57 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 60 60 ZN ZN A . C 2 ZN 1 61 61 ZN ZN A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ABA _pdbx_struct_mod_residue.label_seq_id 11 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ABA _pdbx_struct_mod_residue.auth_seq_id 11 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ALA _pdbx_struct_mod_residue.details 'ALPHA-AMINOBUTYRIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 4 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 60 ? 1_555 SG ? A CYS 7 ? A CYS 7 ? 1_555 111.2 ? 2 SG ? A CYS 4 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 60 ? 1_555 NE2 ? A HIS 20 ? A HIS 20 ? 1_555 111.7 ? 3 SG ? A CYS 7 ? A CYS 7 ? 1_555 ZN ? B ZN . ? A ZN 60 ? 1_555 NE2 ? A HIS 20 ? A HIS 20 ? 1_555 110.6 ? 4 SG ? A CYS 4 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 60 ? 1_555 NE2 ? A HIS 24 ? A HIS 24 ? 1_555 110.9 ? 5 SG ? A CYS 7 ? A CYS 7 ? 1_555 ZN ? B ZN . ? A ZN 60 ? 1_555 NE2 ? A HIS 24 ? A HIS 24 ? 1_555 101.2 ? 6 NE2 ? A HIS 20 ? A HIS 20 ? 1_555 ZN ? B ZN . ? A ZN 60 ? 1_555 NE2 ? A HIS 24 ? A HIS 24 ? 1_555 110.9 ? 7 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 61 ? 1_555 SG ? A CYS 35 ? A CYS 35 ? 1_555 112.6 ? 8 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 61 ? 1_555 NE2 ? A HIS 48 ? A HIS 48 ? 1_555 113.7 ? 9 SG ? A CYS 35 ? A CYS 35 ? 1_555 ZN ? C ZN . ? A ZN 61 ? 1_555 NE2 ? A HIS 48 ? A HIS 48 ? 1_555 110.5 ? 10 SG ? A CYS 32 ? A CYS 32 ? 1_555 ZN ? C ZN . ? A ZN 61 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 112.8 ? 11 SG ? A CYS 35 ? A CYS 35 ? 1_555 ZN ? C ZN . ? A ZN 61 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 92.7 ? 12 NE2 ? A HIS 48 ? A HIS 48 ? 1_555 ZN ? C ZN . ? A ZN 61 ? 1_555 NE2 ? A HIS 54 ? A HIS 54 ? 1_555 112.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1993-10-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 2 0 2023-11-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Structure summary' 7 5 'Structure model' 'Atomic model' 8 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_keywords 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site 10 5 'Structure model' atom_site 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_keywords.text' 30 4 'Structure model' '_struct_ref_seq_dif.details' 31 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 34 5 'Structure model' '_atom_site.auth_atom_id' 35 5 'Structure model' '_atom_site.label_atom_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 H3 A LYS 1 ? ? H A TYR 2 ? ? 1.31 2 6 HG A SER 38 ? ? H A PHE 39 ? ? 1.33 3 7 H2 A LYS 1 ? ? H A TYR 2 ? ? 1.34 4 27 HG A SER 38 ? ? H A PHE 39 ? ? 1.24 5 33 H3 A LYS 1 ? ? H A TYR 2 ? ? 1.31 6 36 HG A SER 38 ? ? H A PHE 39 ? ? 1.33 7 37 H2 A LYS 1 ? ? H A TYR 2 ? ? 1.34 8 57 HG A SER 38 ? ? H A PHE 39 ? ? 1.24 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 2 1 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 3 1 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 4 1 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 5 2 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 6 2 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 7 2 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 8 2 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 9 3 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 10 3 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 11 3 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 12 4 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 13 4 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.252 1.369 -0.117 0.015 N 14 4 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.276 1.369 -0.093 0.015 N 15 4 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 16 5 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 17 5 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 18 5 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 19 5 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.275 1.369 -0.094 0.015 N 20 6 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 21 6 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 22 6 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 23 6 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 24 7 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 25 7 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.252 1.369 -0.117 0.015 N 26 7 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.276 1.369 -0.093 0.015 N 27 7 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 28 8 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.278 1.369 -0.091 0.015 N 29 8 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.252 1.369 -0.117 0.015 N 30 8 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 31 8 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 32 9 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.274 1.369 -0.095 0.015 N 33 9 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 34 9 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 35 9 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 36 10 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.274 1.369 -0.095 0.015 N 37 10 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 38 10 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 39 10 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 40 11 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 41 11 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 42 11 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 43 11 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 44 12 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 45 12 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.252 1.369 -0.117 0.015 N 46 12 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 47 12 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.279 1.369 -0.090 0.015 N 48 13 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.278 1.369 -0.091 0.015 N 49 13 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.251 1.369 -0.118 0.015 N 50 13 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 51 13 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 52 14 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 53 14 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 54 14 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 55 14 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 56 15 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 57 15 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 58 15 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 59 16 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 60 16 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.250 1.369 -0.119 0.015 N 61 16 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 62 16 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.276 1.369 -0.093 0.015 N 63 17 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 64 17 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.252 1.369 -0.117 0.015 N 65 17 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 66 18 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 67 18 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.255 1.369 -0.114 0.015 N 68 18 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 69 18 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 70 19 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 71 19 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 72 19 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 73 19 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.276 1.369 -0.093 0.015 N 74 20 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 75 20 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 76 20 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 77 20 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 78 21 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 79 21 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 80 21 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 81 21 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 82 22 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.274 1.369 -0.095 0.015 N 83 22 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 84 22 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 85 22 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 86 23 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 87 23 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 88 23 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 89 23 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 90 24 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 91 24 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.255 1.369 -0.114 0.015 N 92 24 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 93 24 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 94 25 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 95 25 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.252 1.369 -0.117 0.015 N 96 25 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 97 25 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 98 26 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 99 26 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.252 1.369 -0.117 0.015 N 100 26 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 101 26 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 102 27 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.274 1.369 -0.095 0.015 N 103 27 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 104 27 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 105 27 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.276 1.369 -0.093 0.015 N 106 28 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 107 28 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.251 1.369 -0.118 0.015 N 108 28 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 109 28 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.275 1.369 -0.094 0.015 N 110 29 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 111 29 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 112 29 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.276 1.369 -0.093 0.015 N 113 29 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.279 1.369 -0.090 0.015 N 114 30 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 115 30 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.252 1.369 -0.117 0.015 N 116 30 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 117 30 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 118 31 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 119 31 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 120 31 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 121 31 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 122 32 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 123 32 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 124 32 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 125 32 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 126 33 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 127 33 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 128 33 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 129 33 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.279 1.369 -0.090 0.015 N 130 34 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 131 34 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 132 34 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 133 34 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 134 35 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 135 35 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 136 35 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 137 35 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.276 1.369 -0.093 0.015 N 138 36 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 139 36 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 140 36 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 141 36 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 142 37 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 143 37 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 144 37 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 145 37 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 146 38 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.278 1.369 -0.091 0.015 N 147 38 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.252 1.369 -0.117 0.015 N 148 38 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 149 38 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 150 39 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 151 39 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 152 39 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 153 39 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 154 40 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 155 40 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 156 40 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 157 40 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 158 41 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 159 41 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 160 41 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 161 41 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 162 42 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 163 42 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.251 1.369 -0.118 0.015 N 164 42 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.276 1.369 -0.093 0.015 N 165 42 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 166 43 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.251 1.369 -0.118 0.015 N 167 43 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 168 43 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 169 44 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 170 44 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 171 44 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 172 44 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 173 45 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 174 45 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.255 1.369 -0.114 0.015 N 175 45 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 176 45 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.279 1.369 -0.090 0.015 N 177 46 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 178 46 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.250 1.369 -0.119 0.015 N 179 46 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 180 46 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.275 1.369 -0.094 0.015 N 181 47 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 182 47 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.251 1.369 -0.118 0.015 N 183 47 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 184 47 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 185 48 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 186 48 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.255 1.369 -0.114 0.015 N 187 48 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 188 48 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 189 49 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.274 1.369 -0.095 0.015 N 190 49 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 191 49 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 192 49 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 193 50 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 194 50 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 195 50 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 196 50 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.276 1.369 -0.093 0.015 N 197 51 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 198 51 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.255 1.369 -0.114 0.015 N 199 51 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 200 51 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 201 52 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.274 1.369 -0.095 0.015 N 202 52 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 203 52 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 204 52 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 205 53 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 206 53 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.255 1.369 -0.114 0.015 N 207 53 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 208 53 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 209 54 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 210 54 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 211 54 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 212 54 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N 213 55 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.276 1.369 -0.093 0.015 N 214 55 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 215 55 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 216 55 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.278 1.369 -0.091 0.015 N 217 56 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 218 56 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 219 56 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 220 56 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.279 1.369 -0.090 0.015 N 221 57 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 222 57 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.253 1.369 -0.116 0.015 N 223 57 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.276 1.369 -0.093 0.015 N 224 57 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.276 1.369 -0.093 0.015 N 225 58 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.275 1.369 -0.094 0.015 N 226 58 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.251 1.369 -0.118 0.015 N 227 58 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.277 1.369 -0.092 0.015 N 228 58 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.275 1.369 -0.094 0.015 N 229 59 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 230 59 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.254 1.369 -0.115 0.015 N 231 59 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.276 1.369 -0.093 0.015 N 232 59 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.279 1.369 -0.090 0.015 N 233 60 CG A HIS 20 ? ? ND1 A HIS 20 ? ? 1.277 1.369 -0.092 0.015 N 234 60 CG A HIS 31 ? ? ND1 A HIS 31 ? ? 1.251 1.369 -0.118 0.015 N 235 60 CG A HIS 48 ? ? ND1 A HIS 48 ? ? 1.278 1.369 -0.091 0.015 N 236 60 CG A HIS 54 ? ? ND1 A HIS 54 ? ? 1.277 1.369 -0.092 0.015 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 2 ? ? -152.81 66.29 2 1 GLU A 6 ? ? -90.90 -70.11 3 1 LYS A 18 ? ? -35.49 -38.31 4 1 THR A 25 ? ? -95.68 -110.76 5 1 ASP A 26 ? ? -149.38 31.24 6 1 VAL A 27 ? ? -96.53 47.48 7 1 TYR A 34 ? ? -142.75 -63.94 8 1 CYS A 35 ? ? -68.21 -174.68 9 1 ALA A 53 ? ? -52.97 -86.23 10 1 LYS A 56 ? ? -76.94 48.86 11 2 LYS A 12 ? ? -63.30 10.81 12 2 PRO A 14 ? ? -63.49 -70.96 13 2 THR A 25 ? ? -94.20 -93.17 14 2 ASP A 26 ? ? -156.90 23.56 15 2 VAL A 27 ? ? -97.19 50.11 16 2 TYR A 34 ? ? -118.55 -72.90 17 2 CYS A 35 ? ? -59.39 -169.20 18 2 LYS A 52 ? ? -68.52 8.48 19 2 ALA A 53 ? ? -44.67 -94.80 20 2 SER A 55 ? ? -155.19 -41.78 21 3 TYR A 2 ? ? -156.01 45.08 22 3 THR A 25 ? ? -91.84 -100.02 23 3 ASP A 26 ? ? -159.58 28.50 24 3 VAL A 27 ? ? -91.81 46.50 25 3 TYR A 34 ? ? -141.45 -44.32 26 3 ALA A 53 ? ? -47.33 -76.21 27 3 HIS A 54 ? ? -170.61 106.54 28 4 GLU A 6 ? ? -90.37 -69.65 29 4 THR A 25 ? ? -84.00 -100.10 30 4 ASP A 26 ? ? -151.28 27.12 31 4 VAL A 27 ? ? -100.99 45.27 32 4 TYR A 30 ? ? -66.11 94.96 33 4 TYR A 34 ? ? -144.40 -67.93 34 4 CYS A 35 ? ? -62.43 -165.25 35 4 SER A 51 ? ? -44.58 155.28 36 4 LYS A 52 ? ? -69.29 9.83 37 4 ALA A 53 ? ? -46.28 -93.61 38 4 SER A 55 ? ? -162.33 61.15 39 4 LYS A 56 ? ? -49.92 -88.19 40 5 TYR A 2 ? ? -143.69 47.35 41 5 GLU A 6 ? ? -91.23 -69.51 42 5 LYS A 12 ? ? -64.78 11.07 43 5 THR A 25 ? ? -96.99 -99.37 44 5 ASP A 26 ? ? -157.38 28.11 45 5 VAL A 27 ? ? -101.92 46.26 46 5 TYR A 34 ? ? -142.44 -65.87 47 5 CYS A 35 ? ? -64.86 -166.24 48 5 SER A 51 ? ? -44.70 156.63 49 5 ALA A 53 ? ? -46.51 -87.26 50 5 SER A 55 ? ? -151.67 -34.48 51 6 TYR A 2 ? ? -158.01 46.45 52 6 CYS A 4 ? ? -51.81 109.21 53 6 THR A 25 ? ? -103.44 -107.89 54 6 ASP A 26 ? ? -149.13 28.51 55 6 VAL A 27 ? ? -97.59 45.60 56 6 TYR A 34 ? ? -140.72 -67.35 57 6 CYS A 35 ? ? -65.27 -164.36 58 6 ALA A 53 ? ? -47.93 -73.18 59 7 TYR A 2 ? ? -93.28 46.72 60 7 LYS A 12 ? ? -63.74 10.73 61 7 PRO A 14 ? ? -65.67 -70.48 62 7 SER A 15 ? ? -31.96 -39.24 63 7 THR A 25 ? ? -95.48 -104.79 64 7 ASP A 26 ? ? -157.83 29.14 65 7 VAL A 27 ? ? -101.96 43.98 66 7 TYR A 34 ? ? -100.16 -74.78 67 7 CYS A 35 ? ? -58.28 -162.75 68 7 SER A 51 ? ? -55.82 177.43 69 7 ALA A 53 ? ? -43.20 -89.58 70 7 SER A 55 ? ? -175.38 100.77 71 7 LYS A 56 ? ? -49.19 -76.01 72 8 CYS A 4 ? ? -59.55 107.64 73 8 ABA A 11 ? ? -113.79 74.54 74 8 LYS A 12 ? ? -39.85 -28.21 75 8 THR A 25 ? ? -94.50 -104.35 76 8 ASP A 26 ? ? -146.40 26.01 77 8 VAL A 27 ? ? -98.13 43.24 78 8 PRO A 29 ? ? -65.15 25.73 79 8 TYR A 34 ? ? -101.38 -74.28 80 8 CYS A 35 ? ? -60.86 -169.78 81 8 ALA A 53 ? ? -48.03 -80.88 82 8 SER A 55 ? ? -141.22 -30.47 83 8 LYS A 56 ? ? -97.25 -111.60 84 9 TYR A 2 ? ? -153.79 47.29 85 9 GLU A 6 ? ? -91.34 -69.74 86 9 LYS A 12 ? ? -63.41 10.52 87 9 SER A 15 ? ? -31.91 -38.33 88 9 THR A 25 ? ? -89.82 -97.91 89 9 ASP A 26 ? ? -158.09 28.55 90 9 TYR A 34 ? ? -98.06 -74.82 91 9 CYS A 35 ? ? -58.10 -159.37 92 9 SER A 51 ? ? -47.91 161.12 93 9 ALA A 53 ? ? -47.05 -95.03 94 9 SER A 55 ? ? -152.72 79.84 95 9 LYS A 56 ? ? -51.99 -94.13 96 10 LYS A 12 ? ? -59.50 10.48 97 10 PRO A 14 ? ? -62.39 -71.23 98 10 SER A 15 ? ? -24.72 -45.61 99 10 HIS A 24 ? ? -76.55 20.16 100 10 THR A 25 ? ? -97.98 -104.95 101 10 ASP A 26 ? ? -148.73 28.41 102 10 VAL A 27 ? ? -98.39 43.58 103 10 TYR A 30 ? ? -65.56 91.45 104 10 TYR A 34 ? ? -112.47 -71.72 105 10 LYS A 50 ? ? -55.68 -8.42 106 10 ALA A 53 ? ? -68.76 -75.94 107 10 SER A 55 ? ? -146.35 -32.66 108 10 LYS A 56 ? ? -63.05 -76.53 109 11 TYR A 2 ? ? -91.78 54.79 110 11 GLU A 6 ? ? -91.95 -68.56 111 11 LYS A 12 ? ? -47.28 -19.01 112 11 SER A 15 ? ? -27.55 -48.32 113 11 THR A 25 ? ? -87.16 -97.40 114 11 ASP A 26 ? ? -157.69 29.45 115 11 VAL A 27 ? ? -94.56 47.00 116 11 TYR A 34 ? ? -100.51 -75.61 117 11 CYS A 35 ? ? -62.79 -171.29 118 11 SER A 51 ? ? -44.58 168.37 119 11 LYS A 52 ? ? -74.27 20.04 120 11 ALA A 53 ? ? -54.93 -105.32 121 11 SER A 55 ? ? -175.30 77.52 122 11 LYS A 56 ? ? -75.79 -106.22 123 12 TYR A 2 ? ? -92.14 41.64 124 12 GLU A 6 ? ? -90.61 -69.61 125 12 LYS A 12 ? ? -58.34 2.61 126 12 THR A 25 ? ? -90.40 -103.40 127 12 ASP A 26 ? ? -159.95 29.14 128 12 VAL A 27 ? ? -97.07 45.30 129 12 TYR A 34 ? ? -149.39 -71.51 130 12 CYS A 35 ? ? -57.12 -159.48 131 12 SER A 51 ? ? -50.81 -177.82 132 12 LYS A 52 ? ? -74.87 26.11 133 12 ALA A 53 ? ? -60.17 -119.48 134 12 SER A 55 ? ? -164.57 18.26 135 13 TYR A 2 ? ? -111.91 62.26 136 13 GLU A 6 ? ? -91.98 -69.38 137 13 LYS A 12 ? ? -48.41 -11.01 138 13 THR A 25 ? ? -93.45 -111.39 139 13 ASP A 26 ? ? -152.00 28.75 140 13 VAL A 27 ? ? -89.47 46.35 141 13 TYR A 34 ? ? -142.21 -67.73 142 13 LYS A 52 ? ? -75.77 40.01 143 13 ALA A 53 ? ? -60.59 -89.81 144 13 SER A 55 ? ? -152.76 53.73 145 14 GLU A 6 ? ? -99.88 -73.76 146 14 LYS A 12 ? ? -58.39 1.20 147 14 THR A 25 ? ? -89.99 -95.78 148 14 ASP A 26 ? ? -155.90 23.26 149 14 VAL A 27 ? ? -96.58 48.07 150 14 TYR A 34 ? ? -142.35 -65.20 151 14 CYS A 35 ? ? -67.59 -179.78 152 14 SER A 51 ? ? -45.07 159.68 153 14 ALA A 53 ? ? -42.95 -89.67 154 15 TYR A 2 ? ? -95.19 43.66 155 15 LYS A 12 ? ? -61.00 10.43 156 15 HIS A 24 ? ? -69.90 7.48 157 15 THR A 25 ? ? -96.55 -113.66 158 15 ASP A 26 ? ? -148.62 30.94 159 15 VAL A 27 ? ? -92.85 47.67 160 15 TYR A 30 ? ? -50.33 88.92 161 15 TYR A 34 ? ? -147.43 -62.25 162 15 LYS A 52 ? ? -75.82 26.73 163 15 ALA A 53 ? ? -57.55 -100.39 164 15 SER A 55 ? ? -156.95 32.14 165 15 LYS A 56 ? ? -63.25 -86.58 166 16 TYR A 2 ? ? -96.92 55.86 167 16 LYS A 12 ? ? -68.25 11.04 168 16 THR A 25 ? ? -101.62 -102.14 169 16 ASP A 26 ? ? -159.85 29.63 170 16 VAL A 27 ? ? -100.01 47.75 171 16 TYR A 34 ? ? -142.12 -65.79 172 16 CYS A 35 ? ? -67.88 -169.13 173 16 ALA A 53 ? ? -45.40 -74.97 174 17 TYR A 2 ? ? -150.43 45.58 175 17 LYS A 12 ? ? -47.21 -15.52 176 17 PRO A 14 ? ? -63.54 -72.06 177 17 SER A 15 ? ? -29.01 -42.21 178 17 THR A 25 ? ? -96.21 -105.77 179 17 ASP A 26 ? ? -155.19 30.06 180 17 VAL A 27 ? ? -96.30 47.54 181 17 TYR A 34 ? ? -139.02 -67.98 182 17 CYS A 35 ? ? -63.71 -163.25 183 17 LYS A 52 ? ? -82.63 39.26 184 17 SER A 55 ? ? -140.47 53.98 185 17 LYS A 56 ? ? -67.11 -96.90 186 18 TYR A 2 ? ? -96.04 52.05 187 18 GLU A 6 ? ? -96.02 -72.31 188 18 THR A 25 ? ? -96.61 -107.03 189 18 ASP A 26 ? ? -148.76 27.86 190 18 VAL A 27 ? ? -101.31 44.66 191 18 TYR A 30 ? ? -63.25 77.32 192 18 TYR A 34 ? ? -138.60 -68.80 193 18 CYS A 35 ? ? -66.07 -159.50 194 18 HIS A 54 ? ? -167.22 97.39 195 18 SER A 55 ? ? -147.47 -97.87 196 18 LYS A 56 ? ? -90.64 -109.17 197 19 TYR A 2 ? ? -145.56 44.51 198 19 GLU A 6 ? ? -92.90 -69.98 199 19 SER A 15 ? ? -28.95 -50.13 200 19 THR A 25 ? ? -87.26 -106.76 201 19 ASP A 26 ? ? -144.55 25.90 202 19 VAL A 27 ? ? -96.96 42.85 203 19 TYR A 34 ? ? -142.86 -67.57 204 19 ALA A 53 ? ? -44.34 -79.72 205 20 TYR A 2 ? ? -149.28 49.26 206 20 LYS A 12 ? ? -63.47 10.57 207 20 THR A 25 ? ? -98.58 -107.99 208 20 ASP A 26 ? ? -155.36 30.51 209 20 VAL A 27 ? ? -97.70 45.60 210 20 TYR A 30 ? ? -64.78 99.29 211 20 TYR A 34 ? ? -150.01 -68.12 212 20 CYS A 35 ? ? -61.42 -174.33 213 20 SER A 51 ? ? -49.71 153.42 214 20 LYS A 52 ? ? -76.40 22.98 215 20 ALA A 53 ? ? -43.92 -80.74 216 20 SER A 55 ? ? -151.04 74.04 217 20 LYS A 56 ? ? -76.34 46.08 218 21 TYR A 2 ? ? -94.01 45.93 219 21 LYS A 12 ? ? -62.00 10.84 220 21 SER A 15 ? ? -38.89 -36.90 221 21 THR A 25 ? ? -98.96 -104.51 222 21 ASP A 26 ? ? -159.03 30.28 223 21 VAL A 27 ? ? -102.76 43.21 224 21 TYR A 34 ? ? -141.25 -66.26 225 21 CYS A 35 ? ? -67.30 -158.00 226 21 LYS A 52 ? ? -61.65 0.11 227 21 ALA A 53 ? ? -48.94 -81.21 228 21 SER A 55 ? ? -153.78 47.09 229 21 LYS A 56 ? ? -74.56 35.97 230 22 TYR A 2 ? ? -151.13 49.70 231 22 LYS A 12 ? ? -61.65 10.35 232 22 THR A 25 ? ? -88.58 -108.87 233 22 ASP A 26 ? ? -149.76 30.14 234 22 VAL A 27 ? ? -96.09 44.75 235 22 TYR A 34 ? ? -142.96 -71.57 236 22 CYS A 35 ? ? -56.05 -165.10 237 22 LYS A 52 ? ? -72.85 33.54 238 22 ALA A 53 ? ? -56.81 -86.71 239 22 SER A 55 ? ? -112.47 -80.24 240 22 LYS A 56 ? ? -141.19 -113.68 241 23 GLU A 6 ? ? -99.43 -73.46 242 23 THR A 25 ? ? -95.62 -103.80 243 23 ASP A 26 ? ? -158.65 29.55 244 23 VAL A 27 ? ? -96.32 45.01 245 23 TYR A 34 ? ? -140.44 -61.26 246 23 ALA A 53 ? ? -46.33 -80.12 247 23 SER A 55 ? ? -159.51 67.32 248 23 LYS A 56 ? ? -90.48 -107.60 249 24 GLU A 6 ? ? -91.82 -70.83 250 24 THR A 25 ? ? -94.97 -102.35 251 24 ASP A 26 ? ? -156.90 29.87 252 24 VAL A 27 ? ? -96.34 46.41 253 24 TYR A 30 ? ? -65.84 74.80 254 24 TYR A 34 ? ? -99.00 -75.35 255 24 CYS A 35 ? ? -62.10 -160.93 256 24 SER A 51 ? ? -47.39 174.57 257 24 LYS A 52 ? ? -74.22 23.87 258 24 ALA A 53 ? ? -57.78 -110.33 259 24 SER A 55 ? ? -159.15 -34.49 260 25 TYR A 2 ? ? -97.64 59.89 261 25 GLU A 6 ? ? -90.10 -68.97 262 25 LYS A 12 ? ? -65.05 10.81 263 25 PRO A 14 ? ? -63.28 -70.85 264 25 THR A 25 ? ? -86.80 -97.88 265 25 ASP A 26 ? ? -155.42 29.07 266 25 VAL A 27 ? ? -94.75 46.56 267 25 TYR A 34 ? ? -144.15 -67.67 268 25 CYS A 35 ? ? -61.32 -165.31 269 25 SER A 51 ? ? -44.67 164.54 270 25 LYS A 52 ? ? -74.84 37.36 271 25 ALA A 53 ? ? -54.54 -105.11 272 25 HIS A 54 ? ? -150.39 88.89 273 25 LYS A 56 ? ? -144.82 -93.00 274 26 CYS A 4 ? ? -59.09 105.61 275 26 SER A 15 ? ? -32.42 -36.38 276 26 THR A 25 ? ? -98.07 -107.18 277 26 ASP A 26 ? ? -153.58 30.46 278 26 VAL A 27 ? ? -98.92 46.91 279 26 TYR A 34 ? ? -142.74 -60.96 280 26 SER A 51 ? ? -44.02 164.72 281 26 LYS A 52 ? ? -73.42 21.98 282 26 ALA A 53 ? ? -54.13 -103.45 283 26 SER A 55 ? ? -150.34 -45.07 284 26 LYS A 56 ? ? -101.22 -102.40 285 27 TYR A 2 ? ? -94.42 57.79 286 27 LYS A 12 ? ? -62.59 10.77 287 27 THR A 25 ? ? -94.52 -105.97 288 27 ASP A 26 ? ? -144.26 24.77 289 27 VAL A 27 ? ? -98.20 46.55 290 27 TYR A 34 ? ? -141.18 -63.68 291 27 LYS A 52 ? ? -77.11 25.77 292 27 ALA A 53 ? ? -46.29 -91.94 293 27 LYS A 56 ? ? -147.85 -46.46 294 28 TYR A 2 ? ? -150.34 65.72 295 28 LYS A 12 ? ? -53.82 -4.66 296 28 THR A 25 ? ? -92.44 -109.03 297 28 ASP A 26 ? ? -150.34 30.88 298 28 VAL A 27 ? ? -96.18 46.19 299 28 TYR A 34 ? ? -153.24 -71.05 300 28 CYS A 35 ? ? -59.46 -159.78 301 28 SER A 51 ? ? -50.58 -179.88 302 28 LYS A 52 ? ? -74.62 35.47 303 28 ALA A 53 ? ? -62.45 -114.69 304 28 LYS A 56 ? ? -99.42 50.55 305 29 LYS A 12 ? ? -62.59 10.69 306 29 THR A 25 ? ? -91.64 -112.31 307 29 ASP A 26 ? ? -148.74 29.59 308 29 VAL A 27 ? ? -90.79 47.14 309 29 TYR A 34 ? ? -139.20 -65.92 310 29 LYS A 52 ? ? -74.84 26.67 311 29 ALA A 53 ? ? -53.08 -92.18 312 29 LYS A 56 ? ? -78.25 -85.36 313 30 TYR A 2 ? ? -145.34 43.41 314 30 GLU A 6 ? ? -94.37 -71.70 315 30 THR A 25 ? ? -90.68 -108.60 316 30 ASP A 26 ? ? -152.82 29.20 317 30 VAL A 27 ? ? -92.53 45.67 318 30 TYR A 34 ? ? -138.53 -69.86 319 30 CYS A 35 ? ? -60.81 -165.45 320 30 LYS A 52 ? ? -75.27 22.73 321 30 HIS A 54 ? ? -164.99 97.42 322 30 SER A 55 ? ? -121.18 -75.92 323 31 TYR A 2 ? ? -152.81 66.29 324 31 GLU A 6 ? ? -90.90 -70.11 325 31 LYS A 18 ? ? -35.49 -38.31 326 31 THR A 25 ? ? -95.68 -110.76 327 31 ASP A 26 ? ? -149.38 31.24 328 31 VAL A 27 ? ? -96.53 47.48 329 31 TYR A 34 ? ? -142.75 -63.94 330 31 CYS A 35 ? ? -68.21 -174.68 331 31 ALA A 53 ? ? -52.97 -86.23 332 31 LYS A 56 ? ? -76.94 48.86 333 32 LYS A 12 ? ? -63.33 10.82 334 32 PRO A 14 ? ? -63.41 -70.94 335 32 THR A 25 ? ? -94.28 -93.10 336 32 ASP A 26 ? ? -156.93 23.56 337 32 VAL A 27 ? ? -97.19 50.13 338 32 TYR A 34 ? ? -118.64 -72.90 339 32 CYS A 35 ? ? -59.34 -169.13 340 32 LYS A 52 ? ? -68.55 8.43 341 32 ALA A 53 ? ? -44.66 -94.78 342 32 SER A 55 ? ? -155.20 -41.72 343 33 TYR A 2 ? ? -155.98 45.04 344 33 THR A 25 ? ? -91.92 -100.00 345 33 ASP A 26 ? ? -159.63 28.49 346 33 VAL A 27 ? ? -91.77 46.50 347 33 TYR A 34 ? ? -141.51 -44.32 348 33 ALA A 53 ? ? -47.26 -76.22 349 33 HIS A 54 ? ? -170.59 106.61 350 34 GLU A 6 ? ? -90.44 -69.57 351 34 THR A 25 ? ? -83.96 -100.14 352 34 ASP A 26 ? ? -151.23 27.07 353 34 VAL A 27 ? ? -100.95 45.29 354 34 TYR A 30 ? ? -66.16 94.91 355 34 TYR A 34 ? ? -144.44 -68.00 356 34 CYS A 35 ? ? -62.40 -165.30 357 34 SER A 51 ? ? -44.45 155.26 358 34 LYS A 52 ? ? -69.28 9.85 359 34 ALA A 53 ? ? -46.31 -93.53 360 34 SER A 55 ? ? -162.36 61.13 361 34 LYS A 56 ? ? -49.83 -88.25 362 35 TYR A 2 ? ? -143.66 47.22 363 35 GLU A 6 ? ? -91.18 -69.45 364 35 LYS A 12 ? ? -64.75 11.03 365 35 THR A 25 ? ? -97.00 -99.39 366 35 ASP A 26 ? ? -157.35 28.02 367 35 VAL A 27 ? ? -101.98 46.37 368 35 TYR A 34 ? ? -142.40 -65.82 369 35 CYS A 35 ? ? -64.90 -166.23 370 35 SER A 51 ? ? -44.73 156.66 371 35 ALA A 53 ? ? -46.55 -87.26 372 35 SER A 55 ? ? -151.63 -34.48 373 36 TYR A 2 ? ? -157.97 46.44 374 36 CYS A 4 ? ? -51.77 109.20 375 36 THR A 25 ? ? -103.49 -107.81 376 36 ASP A 26 ? ? -149.11 28.43 377 36 VAL A 27 ? ? -97.63 45.66 378 36 TYR A 34 ? ? -140.71 -67.36 379 36 CYS A 35 ? ? -65.26 -164.37 380 36 ALA A 53 ? ? -47.86 -73.25 381 37 TYR A 2 ? ? -93.24 46.64 382 37 LYS A 12 ? ? -63.72 10.67 383 37 PRO A 14 ? ? -65.66 -70.47 384 37 SER A 15 ? ? -32.07 -39.17 385 37 THR A 25 ? ? -95.58 -104.78 386 37 ASP A 26 ? ? -157.83 29.14 387 37 VAL A 27 ? ? -102.02 43.98 388 37 TYR A 34 ? ? -100.14 -74.78 389 37 CYS A 35 ? ? -58.31 -162.83 390 37 SER A 51 ? ? -55.78 177.49 391 37 ALA A 53 ? ? -43.24 -89.55 392 37 SER A 55 ? ? -175.42 100.86 393 37 LYS A 56 ? ? -49.25 -75.99 394 38 CYS A 4 ? ? -59.53 107.65 395 38 ABA A 11 ? ? -113.86 74.56 396 38 LYS A 12 ? ? -39.83 -28.22 397 38 THR A 25 ? ? -94.50 -104.37 398 38 ASP A 26 ? ? -146.45 26.03 399 38 VAL A 27 ? ? -98.13 43.23 400 38 PRO A 29 ? ? -65.23 25.76 401 38 TYR A 34 ? ? -101.36 -74.25 402 38 CYS A 35 ? ? -60.95 -169.77 403 38 ALA A 53 ? ? -47.98 -80.88 404 38 SER A 55 ? ? -141.20 -30.40 405 38 LYS A 56 ? ? -97.31 -111.56 406 39 TYR A 2 ? ? -153.80 47.27 407 39 GLU A 6 ? ? -91.45 -69.66 408 39 LYS A 12 ? ? -63.47 10.56 409 39 SER A 15 ? ? -31.82 -38.34 410 39 THR A 25 ? ? -89.87 -97.81 411 39 ASP A 26 ? ? -158.16 28.57 412 39 TYR A 34 ? ? -98.18 -74.77 413 39 CYS A 35 ? ? -58.11 -159.45 414 39 SER A 51 ? ? -47.89 161.18 415 39 ALA A 53 ? ? -47.07 -95.06 416 39 SER A 55 ? ? -152.74 79.88 417 39 LYS A 56 ? ? -51.98 -94.19 418 40 LYS A 12 ? ? -59.45 10.41 419 40 PRO A 14 ? ? -62.48 -71.15 420 40 SER A 15 ? ? -24.70 -45.67 421 40 HIS A 24 ? ? -76.52 20.16 422 40 THR A 25 ? ? -97.95 -104.93 423 40 ASP A 26 ? ? -148.77 28.41 424 40 VAL A 27 ? ? -98.37 43.59 425 40 TYR A 30 ? ? -65.52 91.39 426 40 TYR A 34 ? ? -112.36 -71.76 427 40 LYS A 50 ? ? -55.62 -8.47 428 40 ALA A 53 ? ? -68.78 -75.95 429 40 SER A 55 ? ? -146.33 -32.69 430 40 LYS A 56 ? ? -63.08 -76.55 431 41 TYR A 2 ? ? -91.78 54.87 432 41 GLU A 6 ? ? -92.03 -68.49 433 41 LYS A 12 ? ? -47.32 -18.95 434 41 SER A 15 ? ? -27.57 -48.29 435 41 THR A 25 ? ? -87.18 -97.41 436 41 ASP A 26 ? ? -157.72 29.47 437 41 VAL A 27 ? ? -94.56 46.94 438 41 TYR A 34 ? ? -100.51 -75.70 439 41 CYS A 35 ? ? -62.77 -171.30 440 41 SER A 51 ? ? -44.66 168.40 441 41 ALA A 53 ? ? -54.83 -105.35 442 41 SER A 55 ? ? -175.34 77.55 443 41 LYS A 56 ? ? -75.82 -106.17 444 42 TYR A 2 ? ? -92.15 41.59 445 42 GLU A 6 ? ? -90.49 -69.64 446 42 LYS A 12 ? ? -58.26 2.57 447 42 THR A 25 ? ? -90.37 -103.35 448 42 ASP A 26 ? ? -160.00 29.05 449 42 VAL A 27 ? ? -96.99 45.31 450 42 TYR A 34 ? ? -149.36 -71.52 451 42 CYS A 35 ? ? -57.07 -159.49 452 42 SER A 51 ? ? -50.73 -177.83 453 42 LYS A 52 ? ? -74.84 26.10 454 42 ALA A 53 ? ? -60.18 -119.49 455 42 SER A 55 ? ? -164.53 18.17 456 43 TYR A 2 ? ? -111.94 62.28 457 43 GLU A 6 ? ? -91.97 -69.33 458 43 LYS A 12 ? ? -48.35 -11.11 459 43 THR A 25 ? ? -93.51 -111.37 460 43 ASP A 26 ? ? -151.97 28.70 461 43 VAL A 27 ? ? -89.45 46.41 462 43 TYR A 34 ? ? -142.18 -67.78 463 43 LYS A 52 ? ? -75.87 40.13 464 43 ALA A 53 ? ? -60.64 -89.76 465 43 SER A 55 ? ? -152.74 53.72 466 44 GLU A 6 ? ? -99.83 -73.69 467 44 LYS A 12 ? ? -58.47 1.25 468 44 THR A 25 ? ? -90.03 -95.83 469 44 ASP A 26 ? ? -155.89 23.30 470 44 VAL A 27 ? ? -96.52 48.03 471 44 TYR A 34 ? ? -142.36 -65.26 472 44 CYS A 35 ? ? -67.55 -179.76 473 44 SER A 51 ? ? -45.04 159.63 474 44 ALA A 53 ? ? -43.03 -89.66 475 45 TYR A 2 ? ? -95.20 43.74 476 45 LYS A 12 ? ? -60.94 10.31 477 45 HIS A 24 ? ? -69.93 7.53 478 45 THR A 25 ? ? -96.49 -113.66 479 45 ASP A 26 ? ? -148.65 31.02 480 45 VAL A 27 ? ? -92.84 47.61 481 45 TYR A 30 ? ? -50.36 88.96 482 45 TYR A 34 ? ? -147.42 -62.32 483 45 LYS A 52 ? ? -75.81 26.73 484 45 ALA A 53 ? ? -57.55 -100.40 485 45 SER A 55 ? ? -156.89 32.02 486 45 LYS A 56 ? ? -63.20 -86.56 487 46 TYR A 2 ? ? -97.00 55.85 488 46 LYS A 12 ? ? -68.25 11.02 489 46 THR A 25 ? ? -101.65 -102.09 490 46 ASP A 26 ? ? -159.85 29.69 491 46 VAL A 27 ? ? -100.05 47.69 492 46 TYR A 34 ? ? -142.17 -65.82 493 46 CYS A 35 ? ? -67.89 -169.12 494 46 ALA A 53 ? ? -45.37 -74.99 495 47 TYR A 2 ? ? -150.41 45.52 496 47 LYS A 12 ? ? -47.17 -15.58 497 47 PRO A 14 ? ? -63.51 -72.02 498 47 SER A 15 ? ? -29.04 -42.21 499 47 THR A 25 ? ? -96.23 -105.73 500 47 ASP A 26 ? ? -155.18 30.04 501 47 VAL A 27 ? ? -96.33 47.56 502 47 TYR A 34 ? ? -139.07 -67.96 503 47 CYS A 35 ? ? -63.62 -163.27 504 47 LYS A 52 ? ? -82.58 39.15 505 47 SER A 55 ? ? -140.46 54.08 506 47 LYS A 56 ? ? -67.15 -96.82 507 48 TYR A 2 ? ? -96.00 52.13 508 48 GLU A 6 ? ? -96.08 -72.20 509 48 THR A 25 ? ? -96.64 -106.98 510 48 ASP A 26 ? ? -148.74 27.79 511 48 VAL A 27 ? ? -101.27 44.72 512 48 TYR A 30 ? ? -63.31 77.34 513 48 TYR A 34 ? ? -138.59 -68.87 514 48 CYS A 35 ? ? -66.03 -159.48 515 48 HIS A 54 ? ? -167.17 97.34 516 48 SER A 55 ? ? -147.43 -97.85 517 48 LYS A 56 ? ? -90.62 -109.23 518 49 TYR A 2 ? ? -145.61 44.59 519 49 GLU A 6 ? ? -92.86 -69.96 520 49 SER A 15 ? ? -28.94 -50.12 521 49 THR A 25 ? ? -87.22 -106.78 522 49 ASP A 26 ? ? -144.53 25.87 523 49 VAL A 27 ? ? -96.92 42.90 524 49 TYR A 34 ? ? -142.86 -67.62 525 49 ALA A 53 ? ? -44.38 -79.63 526 50 TYR A 2 ? ? -149.32 49.29 527 50 LYS A 12 ? ? -63.50 10.67 528 50 THR A 25 ? ? -98.61 -107.97 529 50 ASP A 26 ? ? -155.30 30.46 530 50 VAL A 27 ? ? -97.71 45.64 531 50 TYR A 30 ? ? -64.70 99.26 532 50 TYR A 34 ? ? -150.08 -68.10 533 50 CYS A 35 ? ? -61.37 -174.40 534 50 SER A 51 ? ? -49.76 153.42 535 50 LYS A 52 ? ? -76.34 22.93 536 50 ALA A 53 ? ? -43.95 -80.66 537 50 SER A 55 ? ? -151.04 74.09 538 50 LYS A 56 ? ? -76.40 46.07 539 51 TYR A 2 ? ? -94.00 45.90 540 51 LYS A 12 ? ? -62.00 10.86 541 51 SER A 15 ? ? -38.91 -36.87 542 51 THR A 25 ? ? -99.04 -104.52 543 51 ASP A 26 ? ? -159.00 30.22 544 51 VAL A 27 ? ? -102.71 43.14 545 51 TYR A 34 ? ? -141.30 -66.24 546 51 CYS A 35 ? ? -67.34 -157.99 547 51 LYS A 52 ? ? -61.64 0.11 548 51 ALA A 53 ? ? -48.91 -81.24 549 51 SER A 55 ? ? -153.72 47.11 550 51 LYS A 56 ? ? -74.60 36.03 551 52 TYR A 2 ? ? -151.14 49.75 552 52 LYS A 12 ? ? -61.53 10.28 553 52 THR A 25 ? ? -88.56 -108.85 554 52 ASP A 26 ? ? -149.80 30.08 555 52 VAL A 27 ? ? -95.99 44.62 556 52 TYR A 34 ? ? -142.96 -71.66 557 52 CYS A 35 ? ? -55.98 -165.05 558 52 LYS A 52 ? ? -72.86 33.58 559 52 ALA A 53 ? ? -56.82 -86.67 560 52 SER A 55 ? ? -112.53 -80.28 561 52 LYS A 56 ? ? -141.17 -113.71 562 53 GLU A 6 ? ? -99.43 -73.43 563 53 THR A 25 ? ? -95.66 -103.77 564 53 ASP A 26 ? ? -158.61 29.49 565 53 VAL A 27 ? ? -96.31 45.00 566 53 TYR A 34 ? ? -140.37 -61.27 567 53 ALA A 53 ? ? -46.31 -80.12 568 53 SER A 55 ? ? -159.56 67.38 569 53 LYS A 56 ? ? -90.49 -107.66 570 54 GLU A 6 ? ? -91.79 -70.80 571 54 THR A 25 ? ? -94.96 -102.33 572 54 ASP A 26 ? ? -156.93 29.88 573 54 VAL A 27 ? ? -96.32 46.37 574 54 TYR A 30 ? ? -65.89 74.83 575 54 TYR A 34 ? ? -99.04 -75.35 576 54 CYS A 35 ? ? -62.12 -160.89 577 54 SER A 51 ? ? -47.36 174.57 578 54 LYS A 52 ? ? -74.22 23.89 579 54 ALA A 53 ? ? -57.85 -110.30 580 54 SER A 55 ? ? -159.15 -34.50 581 55 TYR A 2 ? ? -97.65 59.89 582 55 GLU A 6 ? ? -90.07 -69.06 583 55 LYS A 12 ? ? -65.02 10.72 584 55 PRO A 14 ? ? -63.28 -70.80 585 55 THR A 25 ? ? -86.82 -97.91 586 55 ASP A 26 ? ? -155.41 29.05 587 55 VAL A 27 ? ? -94.77 46.57 588 55 TYR A 34 ? ? -144.22 -67.67 589 55 CYS A 35 ? ? -61.37 -165.31 590 55 SER A 51 ? ? -44.68 164.58 591 55 LYS A 52 ? ? -74.89 37.37 592 55 ALA A 53 ? ? -54.47 -105.07 593 55 HIS A 54 ? ? -150.44 88.89 594 55 LYS A 56 ? ? -144.91 -92.98 595 56 CYS A 4 ? ? -59.05 105.56 596 56 SER A 15 ? ? -32.53 -36.29 597 56 THR A 25 ? ? -98.06 -107.15 598 56 ASP A 26 ? ? -153.59 30.47 599 56 VAL A 27 ? ? -98.96 46.90 600 56 TYR A 34 ? ? -142.77 -60.93 601 56 SER A 51 ? ? -44.12 164.75 602 56 LYS A 52 ? ? -73.39 21.93 603 56 ALA A 53 ? ? -54.10 -103.51 604 56 SER A 55 ? ? -150.32 -45.11 605 56 LYS A 56 ? ? -101.17 -102.39 606 57 TYR A 2 ? ? -94.41 57.78 607 57 LYS A 12 ? ? -62.50 10.81 608 57 THR A 25 ? ? -94.57 -105.97 609 57 ASP A 26 ? ? -144.24 24.74 610 57 VAL A 27 ? ? -98.11 46.51 611 57 TYR A 34 ? ? -141.20 -63.68 612 57 LYS A 52 ? ? -77.09 25.81 613 57 ALA A 53 ? ? -46.27 -91.87 614 57 LYS A 56 ? ? -147.86 -46.58 615 58 TYR A 2 ? ? -150.37 65.71 616 58 LYS A 12 ? ? -53.86 -4.66 617 58 THR A 25 ? ? -92.38 -109.02 618 58 ASP A 26 ? ? -150.35 30.89 619 58 VAL A 27 ? ? -96.15 46.28 620 58 TYR A 34 ? ? -153.17 -71.05 621 58 CYS A 35 ? ? -59.54 -159.79 622 58 SER A 51 ? ? -50.58 -179.93 623 58 LYS A 52 ? ? -74.60 35.50 624 58 ALA A 53 ? ? -62.51 -114.64 625 58 LYS A 56 ? ? -99.38 50.54 626 59 LYS A 12 ? ? -62.62 10.66 627 59 THR A 25 ? ? -91.60 -112.33 628 59 ASP A 26 ? ? -148.72 29.54 629 59 VAL A 27 ? ? -90.75 47.18 630 59 TYR A 34 ? ? -139.21 -65.86 631 59 LYS A 52 ? ? -74.86 26.65 632 59 ALA A 53 ? ? -53.05 -92.16 633 59 LYS A 56 ? ? -78.32 -85.38 634 60 TYR A 2 ? ? -145.39 43.44 635 60 GLU A 6 ? ? -94.37 -71.69 636 60 THR A 25 ? ? -90.72 -108.61 637 60 ASP A 26 ? ? -152.83 29.23 638 60 VAL A 27 ? ? -92.50 45.61 639 60 TYR A 34 ? ? -138.45 -69.87 640 60 CYS A 35 ? ? -60.87 -165.41 641 60 LYS A 52 ? ? -75.32 22.74 642 60 HIS A 54 ? ? -165.02 97.35 643 60 SER A 55 ? ? -121.20 -75.94 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 10 ? ? 0.300 'SIDE CHAIN' 2 1 ARG A 22 ? ? 0.200 'SIDE CHAIN' 3 1 ARG A 28 ? ? 0.260 'SIDE CHAIN' 4 2 ARG A 10 ? ? 0.280 'SIDE CHAIN' 5 2 ARG A 22 ? ? 0.156 'SIDE CHAIN' 6 2 ARG A 28 ? ? 0.274 'SIDE CHAIN' 7 3 ARG A 10 ? ? 0.200 'SIDE CHAIN' 8 3 ARG A 22 ? ? 0.317 'SIDE CHAIN' 9 3 ARG A 28 ? ? 0.151 'SIDE CHAIN' 10 4 ARG A 10 ? ? 0.304 'SIDE CHAIN' 11 4 ARG A 22 ? ? 0.319 'SIDE CHAIN' 12 4 ARG A 28 ? ? 0.273 'SIDE CHAIN' 13 5 ARG A 10 ? ? 0.195 'SIDE CHAIN' 14 5 ARG A 22 ? ? 0.312 'SIDE CHAIN' 15 6 ARG A 10 ? ? 0.212 'SIDE CHAIN' 16 6 ARG A 22 ? ? 0.152 'SIDE CHAIN' 17 6 ARG A 28 ? ? 0.279 'SIDE CHAIN' 18 7 ARG A 10 ? ? 0.278 'SIDE CHAIN' 19 7 ARG A 22 ? ? 0.280 'SIDE CHAIN' 20 7 ARG A 28 ? ? 0.318 'SIDE CHAIN' 21 8 ARG A 10 ? ? 0.319 'SIDE CHAIN' 22 8 ARG A 22 ? ? 0.274 'SIDE CHAIN' 23 9 ARG A 10 ? ? 0.319 'SIDE CHAIN' 24 9 ARG A 28 ? ? 0.316 'SIDE CHAIN' 25 10 ARG A 10 ? ? 0.318 'SIDE CHAIN' 26 10 ARG A 22 ? ? 0.297 'SIDE CHAIN' 27 10 ARG A 28 ? ? 0.204 'SIDE CHAIN' 28 11 ARG A 10 ? ? 0.287 'SIDE CHAIN' 29 11 ARG A 22 ? ? 0.232 'SIDE CHAIN' 30 11 ARG A 28 ? ? 0.257 'SIDE CHAIN' 31 12 ARG A 10 ? ? 0.283 'SIDE CHAIN' 32 12 ARG A 22 ? ? 0.269 'SIDE CHAIN' 33 12 ARG A 28 ? ? 0.317 'SIDE CHAIN' 34 13 ARG A 10 ? ? 0.256 'SIDE CHAIN' 35 13 ARG A 22 ? ? 0.297 'SIDE CHAIN' 36 13 ARG A 28 ? ? 0.209 'SIDE CHAIN' 37 14 ARG A 10 ? ? 0.292 'SIDE CHAIN' 38 14 ARG A 22 ? ? 0.237 'SIDE CHAIN' 39 14 ARG A 28 ? ? 0.205 'SIDE CHAIN' 40 15 ARG A 10 ? ? 0.188 'SIDE CHAIN' 41 15 ARG A 28 ? ? 0.306 'SIDE CHAIN' 42 16 ARG A 10 ? ? 0.256 'SIDE CHAIN' 43 16 ARG A 22 ? ? 0.285 'SIDE CHAIN' 44 16 ARG A 28 ? ? 0.294 'SIDE CHAIN' 45 17 ARG A 10 ? ? 0.263 'SIDE CHAIN' 46 17 ARG A 22 ? ? 0.308 'SIDE CHAIN' 47 17 ARG A 28 ? ? 0.228 'SIDE CHAIN' 48 18 ARG A 10 ? ? 0.250 'SIDE CHAIN' 49 18 ARG A 22 ? ? 0.204 'SIDE CHAIN' 50 18 ARG A 28 ? ? 0.304 'SIDE CHAIN' 51 19 ARG A 10 ? ? 0.170 'SIDE CHAIN' 52 19 ARG A 22 ? ? 0.318 'SIDE CHAIN' 53 19 ARG A 28 ? ? 0.308 'SIDE CHAIN' 54 20 ARG A 10 ? ? 0.317 'SIDE CHAIN' 55 20 ARG A 22 ? ? 0.146 'SIDE CHAIN' 56 20 ARG A 28 ? ? 0.300 'SIDE CHAIN' 57 21 ARG A 10 ? ? 0.271 'SIDE CHAIN' 58 21 ARG A 22 ? ? 0.316 'SIDE CHAIN' 59 21 ARG A 28 ? ? 0.205 'SIDE CHAIN' 60 22 ARG A 10 ? ? 0.125 'SIDE CHAIN' 61 22 ARG A 22 ? ? 0.164 'SIDE CHAIN' 62 22 ARG A 28 ? ? 0.260 'SIDE CHAIN' 63 23 ARG A 22 ? ? 0.296 'SIDE CHAIN' 64 23 ARG A 28 ? ? 0.201 'SIDE CHAIN' 65 24 ARG A 10 ? ? 0.209 'SIDE CHAIN' 66 24 ARG A 22 ? ? 0.105 'SIDE CHAIN' 67 24 ARG A 28 ? ? 0.319 'SIDE CHAIN' 68 25 ARG A 22 ? ? 0.167 'SIDE CHAIN' 69 25 ARG A 28 ? ? 0.255 'SIDE CHAIN' 70 26 ARG A 10 ? ? 0.286 'SIDE CHAIN' 71 26 ARG A 22 ? ? 0.313 'SIDE CHAIN' 72 26 ARG A 28 ? ? 0.123 'SIDE CHAIN' 73 27 ARG A 10 ? ? 0.318 'SIDE CHAIN' 74 27 ARG A 22 ? ? 0.305 'SIDE CHAIN' 75 27 ARG A 28 ? ? 0.278 'SIDE CHAIN' 76 28 ARG A 10 ? ? 0.300 'SIDE CHAIN' 77 28 ARG A 22 ? ? 0.291 'SIDE CHAIN' 78 28 ARG A 28 ? ? 0.319 'SIDE CHAIN' 79 29 ARG A 10 ? ? 0.250 'SIDE CHAIN' 80 29 ARG A 22 ? ? 0.234 'SIDE CHAIN' 81 30 ARG A 10 ? ? 0.307 'SIDE CHAIN' 82 30 ARG A 22 ? ? 0.297 'SIDE CHAIN' 83 30 ARG A 28 ? ? 0.223 'SIDE CHAIN' 84 31 ARG A 10 ? ? 0.300 'SIDE CHAIN' 85 31 ARG A 22 ? ? 0.200 'SIDE CHAIN' 86 31 ARG A 28 ? ? 0.260 'SIDE CHAIN' 87 32 ARG A 10 ? ? 0.280 'SIDE CHAIN' 88 32 ARG A 22 ? ? 0.156 'SIDE CHAIN' 89 32 ARG A 28 ? ? 0.274 'SIDE CHAIN' 90 33 ARG A 10 ? ? 0.200 'SIDE CHAIN' 91 33 ARG A 22 ? ? 0.317 'SIDE CHAIN' 92 33 ARG A 28 ? ? 0.151 'SIDE CHAIN' 93 34 ARG A 10 ? ? 0.304 'SIDE CHAIN' 94 34 ARG A 22 ? ? 0.319 'SIDE CHAIN' 95 34 ARG A 28 ? ? 0.273 'SIDE CHAIN' 96 35 ARG A 10 ? ? 0.195 'SIDE CHAIN' 97 35 ARG A 22 ? ? 0.312 'SIDE CHAIN' 98 36 ARG A 10 ? ? 0.212 'SIDE CHAIN' 99 36 ARG A 22 ? ? 0.152 'SIDE CHAIN' 100 36 ARG A 28 ? ? 0.279 'SIDE CHAIN' 101 37 ARG A 10 ? ? 0.279 'SIDE CHAIN' 102 37 ARG A 22 ? ? 0.280 'SIDE CHAIN' 103 37 ARG A 28 ? ? 0.318 'SIDE CHAIN' 104 38 ARG A 10 ? ? 0.319 'SIDE CHAIN' 105 38 ARG A 22 ? ? 0.275 'SIDE CHAIN' 106 39 ARG A 10 ? ? 0.319 'SIDE CHAIN' 107 39 ARG A 28 ? ? 0.316 'SIDE CHAIN' 108 40 ARG A 10 ? ? 0.318 'SIDE CHAIN' 109 40 ARG A 22 ? ? 0.297 'SIDE CHAIN' 110 40 ARG A 28 ? ? 0.204 'SIDE CHAIN' 111 41 ARG A 10 ? ? 0.286 'SIDE CHAIN' 112 41 ARG A 22 ? ? 0.232 'SIDE CHAIN' 113 41 ARG A 28 ? ? 0.257 'SIDE CHAIN' 114 42 ARG A 10 ? ? 0.284 'SIDE CHAIN' 115 42 ARG A 22 ? ? 0.268 'SIDE CHAIN' 116 42 ARG A 28 ? ? 0.316 'SIDE CHAIN' 117 43 ARG A 10 ? ? 0.256 'SIDE CHAIN' 118 43 ARG A 22 ? ? 0.297 'SIDE CHAIN' 119 43 ARG A 28 ? ? 0.209 'SIDE CHAIN' 120 44 ARG A 10 ? ? 0.292 'SIDE CHAIN' 121 44 ARG A 22 ? ? 0.237 'SIDE CHAIN' 122 44 ARG A 28 ? ? 0.205 'SIDE CHAIN' 123 45 ARG A 10 ? ? 0.188 'SIDE CHAIN' 124 45 ARG A 28 ? ? 0.307 'SIDE CHAIN' 125 46 ARG A 10 ? ? 0.255 'SIDE CHAIN' 126 46 ARG A 22 ? ? 0.285 'SIDE CHAIN' 127 46 ARG A 28 ? ? 0.294 'SIDE CHAIN' 128 47 ARG A 10 ? ? 0.262 'SIDE CHAIN' 129 47 ARG A 22 ? ? 0.308 'SIDE CHAIN' 130 47 ARG A 28 ? ? 0.228 'SIDE CHAIN' 131 48 ARG A 10 ? ? 0.250 'SIDE CHAIN' 132 48 ARG A 22 ? ? 0.204 'SIDE CHAIN' 133 48 ARG A 28 ? ? 0.304 'SIDE CHAIN' 134 49 ARG A 10 ? ? 0.170 'SIDE CHAIN' 135 49 ARG A 22 ? ? 0.319 'SIDE CHAIN' 136 49 ARG A 28 ? ? 0.308 'SIDE CHAIN' 137 50 ARG A 10 ? ? 0.317 'SIDE CHAIN' 138 50 ARG A 22 ? ? 0.146 'SIDE CHAIN' 139 50 ARG A 28 ? ? 0.300 'SIDE CHAIN' 140 51 ARG A 10 ? ? 0.271 'SIDE CHAIN' 141 51 ARG A 22 ? ? 0.316 'SIDE CHAIN' 142 51 ARG A 28 ? ? 0.205 'SIDE CHAIN' 143 52 ARG A 10 ? ? 0.125 'SIDE CHAIN' 144 52 ARG A 22 ? ? 0.164 'SIDE CHAIN' 145 52 ARG A 28 ? ? 0.260 'SIDE CHAIN' 146 53 ARG A 22 ? ? 0.296 'SIDE CHAIN' 147 53 ARG A 28 ? ? 0.201 'SIDE CHAIN' 148 54 ARG A 10 ? ? 0.209 'SIDE CHAIN' 149 54 ARG A 22 ? ? 0.105 'SIDE CHAIN' 150 54 ARG A 28 ? ? 0.319 'SIDE CHAIN' 151 55 ARG A 22 ? ? 0.167 'SIDE CHAIN' 152 55 ARG A 28 ? ? 0.254 'SIDE CHAIN' 153 56 ARG A 10 ? ? 0.286 'SIDE CHAIN' 154 56 ARG A 22 ? ? 0.313 'SIDE CHAIN' 155 56 ARG A 28 ? ? 0.123 'SIDE CHAIN' 156 57 ARG A 10 ? ? 0.319 'SIDE CHAIN' 157 57 ARG A 22 ? ? 0.304 'SIDE CHAIN' 158 57 ARG A 28 ? ? 0.278 'SIDE CHAIN' 159 58 ARG A 10 ? ? 0.300 'SIDE CHAIN' 160 58 ARG A 22 ? ? 0.291 'SIDE CHAIN' 161 58 ARG A 28 ? ? 0.319 'SIDE CHAIN' 162 59 ARG A 10 ? ? 0.250 'SIDE CHAIN' 163 59 ARG A 22 ? ? 0.234 'SIDE CHAIN' 164 60 ARG A 10 ? ? 0.307 'SIDE CHAIN' 165 60 ARG A 22 ? ? 0.297 'SIDE CHAIN' 166 60 ARG A 28 ? ? 0.223 'SIDE CHAIN' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ABA N N N N 1 ABA CA C N S 2 ABA C C N N 3 ABA O O N N 4 ABA CB C N N 5 ABA CG C N N 6 ABA OXT O N N 7 ABA H H N N 8 ABA H2 H N N 9 ABA HA H N N 10 ABA HB3 H N N 11 ABA HB2 H N N 12 ABA HG1 H N N 13 ABA HG3 H N N 14 ABA HG2 H N N 15 ABA HXT H N N 16 ALA N N N N 17 ALA CA C N S 18 ALA C C N N 19 ALA O O N N 20 ALA CB C N N 21 ALA OXT O N N 22 ALA H H N N 23 ALA H2 H N N 24 ALA HA H N N 25 ALA HB1 H N N 26 ALA HB2 H N N 27 ALA HB3 H N N 28 ALA HXT H N N 29 ARG N N N N 30 ARG CA C N S 31 ARG C C N N 32 ARG O O N N 33 ARG CB C N N 34 ARG CG C N N 35 ARG CD C N N 36 ARG NE N N N 37 ARG CZ C N N 38 ARG NH1 N N N 39 ARG NH2 N N N 40 ARG OXT O N N 41 ARG H H N N 42 ARG H2 H N N 43 ARG HA H N N 44 ARG HB2 H N N 45 ARG HB3 H N N 46 ARG HG2 H N N 47 ARG HG3 H N N 48 ARG HD2 H N N 49 ARG HD3 H N N 50 ARG HE H N N 51 ARG HH11 H N N 52 ARG HH12 H N N 53 ARG HH21 H N N 54 ARG HH22 H N N 55 ARG HXT H N N 56 ASN N N N N 57 ASN CA C N S 58 ASN C C N N 59 ASN O O N N 60 ASN CB C N N 61 ASN CG C N N 62 ASN OD1 O N N 63 ASN ND2 N N N 64 ASN OXT O N N 65 ASN H H N N 66 ASN H2 H N N 67 ASN HA H N N 68 ASN HB2 H N N 69 ASN HB3 H N N 70 ASN HD21 H N N 71 ASN HD22 H N N 72 ASN HXT H N N 73 ASP N N N N 74 ASP CA C N S 75 ASP C C N N 76 ASP O O N N 77 ASP CB C N N 78 ASP CG C N N 79 ASP OD1 O N N 80 ASP OD2 O N N 81 ASP OXT O N N 82 ASP H H N N 83 ASP H2 H N N 84 ASP HA H N N 85 ASP HB2 H N N 86 ASP HB3 H N N 87 ASP HD2 H N N 88 ASP HXT H N N 89 CYS N N N N 90 CYS CA C N R 91 CYS C C N N 92 CYS O O N N 93 CYS CB C N N 94 CYS SG S N N 95 CYS OXT O N N 96 CYS H H N N 97 CYS H2 H N N 98 CYS HA H N N 99 CYS HB2 H N N 100 CYS HB3 H N N 101 CYS HG H N N 102 CYS HXT H N N 103 GLU N N N N 104 GLU CA C N S 105 GLU C C N N 106 GLU O O N N 107 GLU CB C N N 108 GLU CG C N N 109 GLU CD C N N 110 GLU OE1 O N N 111 GLU OE2 O N N 112 GLU OXT O N N 113 GLU H H N N 114 GLU H2 H N N 115 GLU HA H N N 116 GLU HB2 H N N 117 GLU HB3 H N N 118 GLU HG2 H N N 119 GLU HG3 H N N 120 GLU HE2 H N N 121 GLU HXT H N N 122 GLY N N N N 123 GLY CA C N N 124 GLY C C N N 125 GLY O O N N 126 GLY OXT O N N 127 GLY H H N N 128 GLY H2 H N N 129 GLY HA2 H N N 130 GLY HA3 H N N 131 GLY HXT H N N 132 HIS N N N N 133 HIS CA C N S 134 HIS C C N N 135 HIS O O N N 136 HIS CB C N N 137 HIS CG C Y N 138 HIS ND1 N Y N 139 HIS CD2 C Y N 140 HIS CE1 C Y N 141 HIS NE2 N Y N 142 HIS OXT O N N 143 HIS H H N N 144 HIS H2 H N N 145 HIS HA H N N 146 HIS HB2 H N N 147 HIS HB3 H N N 148 HIS HD1 H N N 149 HIS HD2 H N N 150 HIS HE1 H N N 151 HIS HE2 H N N 152 HIS HXT H N N 153 ILE N N N N 154 ILE CA C N S 155 ILE C C N N 156 ILE O O N N 157 ILE CB C N S 158 ILE CG1 C N N 159 ILE CG2 C N N 160 ILE CD1 C N N 161 ILE OXT O N N 162 ILE H H N N 163 ILE H2 H N N 164 ILE HA H N N 165 ILE HB H N N 166 ILE HG12 H N N 167 ILE HG13 H N N 168 ILE HG21 H N N 169 ILE HG22 H N N 170 ILE HG23 H N N 171 ILE HD11 H N N 172 ILE HD12 H N N 173 ILE HD13 H N N 174 ILE HXT H N N 175 LEU N N N N 176 LEU CA C N S 177 LEU C C N N 178 LEU O O N N 179 LEU CB C N N 180 LEU CG C N N 181 LEU CD1 C N N 182 LEU CD2 C N N 183 LEU OXT O N N 184 LEU H H N N 185 LEU H2 H N N 186 LEU HA H N N 187 LEU HB2 H N N 188 LEU HB3 H N N 189 LEU HG H N N 190 LEU HD11 H N N 191 LEU HD12 H N N 192 LEU HD13 H N N 193 LEU HD21 H N N 194 LEU HD22 H N N 195 LEU HD23 H N N 196 LEU HXT H N N 197 LYS N N N N 198 LYS CA C N S 199 LYS C C N N 200 LYS O O N N 201 LYS CB C N N 202 LYS CG C N N 203 LYS CD C N N 204 LYS CE C N N 205 LYS NZ N N N 206 LYS OXT O N N 207 LYS H H N N 208 LYS H2 H N N 209 LYS HA H N N 210 LYS HB2 H N N 211 LYS HB3 H N N 212 LYS HG2 H N N 213 LYS HG3 H N N 214 LYS HD2 H N N 215 LYS HD3 H N N 216 LYS HE2 H N N 217 LYS HE3 H N N 218 LYS HZ1 H N N 219 LYS HZ2 H N N 220 LYS HZ3 H N N 221 LYS HXT H N N 222 MET N N N N 223 MET CA C N S 224 MET C C N N 225 MET O O N N 226 MET CB C N N 227 MET CG C N N 228 MET SD S N N 229 MET CE C N N 230 MET OXT O N N 231 MET H H N N 232 MET H2 H N N 233 MET HA H N N 234 MET HB2 H N N 235 MET HB3 H N N 236 MET HG2 H N N 237 MET HG3 H N N 238 MET HE1 H N N 239 MET HE2 H N N 240 MET HE3 H N N 241 MET HXT H N N 242 PHE N N N N 243 PHE CA C N S 244 PHE C C N N 245 PHE O O N N 246 PHE CB C N N 247 PHE CG C Y N 248 PHE CD1 C Y N 249 PHE CD2 C Y N 250 PHE CE1 C Y N 251 PHE CE2 C Y N 252 PHE CZ C Y N 253 PHE OXT O N N 254 PHE H H N N 255 PHE H2 H N N 256 PHE HA H N N 257 PHE HB2 H N N 258 PHE HB3 H N N 259 PHE HD1 H N N 260 PHE HD2 H N N 261 PHE HE1 H N N 262 PHE HE2 H N N 263 PHE HZ H N N 264 PHE HXT H N N 265 PRO N N N N 266 PRO CA C N S 267 PRO C C N N 268 PRO O O N N 269 PRO CB C N N 270 PRO CG C N N 271 PRO CD C N N 272 PRO OXT O N N 273 PRO H H N N 274 PRO HA H N N 275 PRO HB2 H N N 276 PRO HB3 H N N 277 PRO HG2 H N N 278 PRO HG3 H N N 279 PRO HD2 H N N 280 PRO HD3 H N N 281 PRO HXT H N N 282 SER N N N N 283 SER CA C N S 284 SER C C N N 285 SER O O N N 286 SER CB C N N 287 SER OG O N N 288 SER OXT O N N 289 SER H H N N 290 SER H2 H N N 291 SER HA H N N 292 SER HB2 H N N 293 SER HB3 H N N 294 SER HG H N N 295 SER HXT H N N 296 THR N N N N 297 THR CA C N S 298 THR C C N N 299 THR O O N N 300 THR CB C N R 301 THR OG1 O N N 302 THR CG2 C N N 303 THR OXT O N N 304 THR H H N N 305 THR H2 H N N 306 THR HA H N N 307 THR HB H N N 308 THR HG1 H N N 309 THR HG21 H N N 310 THR HG22 H N N 311 THR HG23 H N N 312 THR HXT H N N 313 TYR N N N N 314 TYR CA C N S 315 TYR C C N N 316 TYR O O N N 317 TYR CB C N N 318 TYR CG C Y N 319 TYR CD1 C Y N 320 TYR CD2 C Y N 321 TYR CE1 C Y N 322 TYR CE2 C Y N 323 TYR CZ C Y N 324 TYR OH O N N 325 TYR OXT O N N 326 TYR H H N N 327 TYR H2 H N N 328 TYR HA H N N 329 TYR HB2 H N N 330 TYR HB3 H N N 331 TYR HD1 H N N 332 TYR HD2 H N N 333 TYR HE1 H N N 334 TYR HE2 H N N 335 TYR HH H N N 336 TYR HXT H N N 337 VAL N N N N 338 VAL CA C N S 339 VAL C C N N 340 VAL O O N N 341 VAL CB C N N 342 VAL CG1 C N N 343 VAL CG2 C N N 344 VAL OXT O N N 345 VAL H H N N 346 VAL H2 H N N 347 VAL HA H N N 348 VAL HB H N N 349 VAL HG11 H N N 350 VAL HG12 H N N 351 VAL HG13 H N N 352 VAL HG21 H N N 353 VAL HG22 H N N 354 VAL HG23 H N N 355 VAL HXT H N N 356 ZN ZN ZN N N 357 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ABA N CA sing N N 1 ABA N H sing N N 2 ABA N H2 sing N N 3 ABA CA C sing N N 4 ABA CA CB sing N N 5 ABA CA HA sing N N 6 ABA C O doub N N 7 ABA C OXT sing N N 8 ABA CB CG sing N N 9 ABA CB HB3 sing N N 10 ABA CB HB2 sing N N 11 ABA CG HG1 sing N N 12 ABA CG HG3 sing N N 13 ABA CG HG2 sing N N 14 ABA OXT HXT sing N N 15 ALA N CA sing N N 16 ALA N H sing N N 17 ALA N H2 sing N N 18 ALA CA C sing N N 19 ALA CA CB sing N N 20 ALA CA HA sing N N 21 ALA C O doub N N 22 ALA C OXT sing N N 23 ALA CB HB1 sing N N 24 ALA CB HB2 sing N N 25 ALA CB HB3 sing N N 26 ALA OXT HXT sing N N 27 ARG N CA sing N N 28 ARG N H sing N N 29 ARG N H2 sing N N 30 ARG CA C sing N N 31 ARG CA CB sing N N 32 ARG CA HA sing N N 33 ARG C O doub N N 34 ARG C OXT sing N N 35 ARG CB CG sing N N 36 ARG CB HB2 sing N N 37 ARG CB HB3 sing N N 38 ARG CG CD sing N N 39 ARG CG HG2 sing N N 40 ARG CG HG3 sing N N 41 ARG CD NE sing N N 42 ARG CD HD2 sing N N 43 ARG CD HD3 sing N N 44 ARG NE CZ sing N N 45 ARG NE HE sing N N 46 ARG CZ NH1 sing N N 47 ARG CZ NH2 doub N N 48 ARG NH1 HH11 sing N N 49 ARG NH1 HH12 sing N N 50 ARG NH2 HH21 sing N N 51 ARG NH2 HH22 sing N N 52 ARG OXT HXT sing N N 53 ASN N CA sing N N 54 ASN N H sing N N 55 ASN N H2 sing N N 56 ASN CA C sing N N 57 ASN CA CB sing N N 58 ASN CA HA sing N N 59 ASN C O doub N N 60 ASN C OXT sing N N 61 ASN CB CG sing N N 62 ASN CB HB2 sing N N 63 ASN CB HB3 sing N N 64 ASN CG OD1 doub N N 65 ASN CG ND2 sing N N 66 ASN ND2 HD21 sing N N 67 ASN ND2 HD22 sing N N 68 ASN OXT HXT sing N N 69 ASP N CA sing N N 70 ASP N H sing N N 71 ASP N H2 sing N N 72 ASP CA C sing N N 73 ASP CA CB sing N N 74 ASP CA HA sing N N 75 ASP C O doub N N 76 ASP C OXT sing N N 77 ASP CB CG sing N N 78 ASP CB HB2 sing N N 79 ASP CB HB3 sing N N 80 ASP CG OD1 doub N N 81 ASP CG OD2 sing N N 82 ASP OD2 HD2 sing N N 83 ASP OXT HXT sing N N 84 CYS N CA sing N N 85 CYS N H sing N N 86 CYS N H2 sing N N 87 CYS CA C sing N N 88 CYS CA CB sing N N 89 CYS CA HA sing N N 90 CYS C O doub N N 91 CYS C OXT sing N N 92 CYS CB SG sing N N 93 CYS CB HB2 sing N N 94 CYS CB HB3 sing N N 95 CYS SG HG sing N N 96 CYS OXT HXT sing N N 97 GLU N CA sing N N 98 GLU N H sing N N 99 GLU N H2 sing N N 100 GLU CA C sing N N 101 GLU CA CB sing N N 102 GLU CA HA sing N N 103 GLU C O doub N N 104 GLU C OXT sing N N 105 GLU CB CG sing N N 106 GLU CB HB2 sing N N 107 GLU CB HB3 sing N N 108 GLU CG CD sing N N 109 GLU CG HG2 sing N N 110 GLU CG HG3 sing N N 111 GLU CD OE1 doub N N 112 GLU CD OE2 sing N N 113 GLU OE2 HE2 sing N N 114 GLU OXT HXT sing N N 115 GLY N CA sing N N 116 GLY N H sing N N 117 GLY N H2 sing N N 118 GLY CA C sing N N 119 GLY CA HA2 sing N N 120 GLY CA HA3 sing N N 121 GLY C O doub N N 122 GLY C OXT sing N N 123 GLY OXT HXT sing N N 124 HIS N CA sing N N 125 HIS N H sing N N 126 HIS N H2 sing N N 127 HIS CA C sing N N 128 HIS CA CB sing N N 129 HIS CA HA sing N N 130 HIS C O doub N N 131 HIS C OXT sing N N 132 HIS CB CG sing N N 133 HIS CB HB2 sing N N 134 HIS CB HB3 sing N N 135 HIS CG ND1 sing Y N 136 HIS CG CD2 doub Y N 137 HIS ND1 CE1 doub Y N 138 HIS ND1 HD1 sing N N 139 HIS CD2 NE2 sing Y N 140 HIS CD2 HD2 sing N N 141 HIS CE1 NE2 sing Y N 142 HIS CE1 HE1 sing N N 143 HIS NE2 HE2 sing N N 144 HIS OXT HXT sing N N 145 ILE N CA sing N N 146 ILE N H sing N N 147 ILE N H2 sing N N 148 ILE CA C sing N N 149 ILE CA CB sing N N 150 ILE CA HA sing N N 151 ILE C O doub N N 152 ILE C OXT sing N N 153 ILE CB CG1 sing N N 154 ILE CB CG2 sing N N 155 ILE CB HB sing N N 156 ILE CG1 CD1 sing N N 157 ILE CG1 HG12 sing N N 158 ILE CG1 HG13 sing N N 159 ILE CG2 HG21 sing N N 160 ILE CG2 HG22 sing N N 161 ILE CG2 HG23 sing N N 162 ILE CD1 HD11 sing N N 163 ILE CD1 HD12 sing N N 164 ILE CD1 HD13 sing N N 165 ILE OXT HXT sing N N 166 LEU N CA sing N N 167 LEU N H sing N N 168 LEU N H2 sing N N 169 LEU CA C sing N N 170 LEU CA CB sing N N 171 LEU CA HA sing N N 172 LEU C O doub N N 173 LEU C OXT sing N N 174 LEU CB CG sing N N 175 LEU CB HB2 sing N N 176 LEU CB HB3 sing N N 177 LEU CG CD1 sing N N 178 LEU CG CD2 sing N N 179 LEU CG HG sing N N 180 LEU CD1 HD11 sing N N 181 LEU CD1 HD12 sing N N 182 LEU CD1 HD13 sing N N 183 LEU CD2 HD21 sing N N 184 LEU CD2 HD22 sing N N 185 LEU CD2 HD23 sing N N 186 LEU OXT HXT sing N N 187 LYS N CA sing N N 188 LYS N H sing N N 189 LYS N H2 sing N N 190 LYS CA C sing N N 191 LYS CA CB sing N N 192 LYS CA HA sing N N 193 LYS C O doub N N 194 LYS C OXT sing N N 195 LYS CB CG sing N N 196 LYS CB HB2 sing N N 197 LYS CB HB3 sing N N 198 LYS CG CD sing N N 199 LYS CG HG2 sing N N 200 LYS CG HG3 sing N N 201 LYS CD CE sing N N 202 LYS CD HD2 sing N N 203 LYS CD HD3 sing N N 204 LYS CE NZ sing N N 205 LYS CE HE2 sing N N 206 LYS CE HE3 sing N N 207 LYS NZ HZ1 sing N N 208 LYS NZ HZ2 sing N N 209 LYS NZ HZ3 sing N N 210 LYS OXT HXT sing N N 211 MET N CA sing N N 212 MET N H sing N N 213 MET N H2 sing N N 214 MET CA C sing N N 215 MET CA CB sing N N 216 MET CA HA sing N N 217 MET C O doub N N 218 MET C OXT sing N N 219 MET CB CG sing N N 220 MET CB HB2 sing N N 221 MET CB HB3 sing N N 222 MET CG SD sing N N 223 MET CG HG2 sing N N 224 MET CG HG3 sing N N 225 MET SD CE sing N N 226 MET CE HE1 sing N N 227 MET CE HE2 sing N N 228 MET CE HE3 sing N N 229 MET OXT HXT sing N N 230 PHE N CA sing N N 231 PHE N H sing N N 232 PHE N H2 sing N N 233 PHE CA C sing N N 234 PHE CA CB sing N N 235 PHE CA HA sing N N 236 PHE C O doub N N 237 PHE C OXT sing N N 238 PHE CB CG sing N N 239 PHE CB HB2 sing N N 240 PHE CB HB3 sing N N 241 PHE CG CD1 doub Y N 242 PHE CG CD2 sing Y N 243 PHE CD1 CE1 sing Y N 244 PHE CD1 HD1 sing N N 245 PHE CD2 CE2 doub Y N 246 PHE CD2 HD2 sing N N 247 PHE CE1 CZ doub Y N 248 PHE CE1 HE1 sing N N 249 PHE CE2 CZ sing Y N 250 PHE CE2 HE2 sing N N 251 PHE CZ HZ sing N N 252 PHE OXT HXT sing N N 253 PRO N CA sing N N 254 PRO N CD sing N N 255 PRO N H sing N N 256 PRO CA C sing N N 257 PRO CA CB sing N N 258 PRO CA HA sing N N 259 PRO C O doub N N 260 PRO C OXT sing N N 261 PRO CB CG sing N N 262 PRO CB HB2 sing N N 263 PRO CB HB3 sing N N 264 PRO CG CD sing N N 265 PRO CG HG2 sing N N 266 PRO CG HG3 sing N N 267 PRO CD HD2 sing N N 268 PRO CD HD3 sing N N 269 PRO OXT HXT sing N N 270 SER N CA sing N N 271 SER N H sing N N 272 SER N H2 sing N N 273 SER CA C sing N N 274 SER CA CB sing N N 275 SER CA HA sing N N 276 SER C O doub N N 277 SER C OXT sing N N 278 SER CB OG sing N N 279 SER CB HB2 sing N N 280 SER CB HB3 sing N N 281 SER OG HG sing N N 282 SER OXT HXT sing N N 283 THR N CA sing N N 284 THR N H sing N N 285 THR N H2 sing N N 286 THR CA C sing N N 287 THR CA CB sing N N 288 THR CA HA sing N N 289 THR C O doub N N 290 THR C OXT sing N N 291 THR CB OG1 sing N N 292 THR CB CG2 sing N N 293 THR CB HB sing N N 294 THR OG1 HG1 sing N N 295 THR CG2 HG21 sing N N 296 THR CG2 HG22 sing N N 297 THR CG2 HG23 sing N N 298 THR OXT HXT sing N N 299 TYR N CA sing N N 300 TYR N H sing N N 301 TYR N H2 sing N N 302 TYR CA C sing N N 303 TYR CA CB sing N N 304 TYR CA HA sing N N 305 TYR C O doub N N 306 TYR C OXT sing N N 307 TYR CB CG sing N N 308 TYR CB HB2 sing N N 309 TYR CB HB3 sing N N 310 TYR CG CD1 doub Y N 311 TYR CG CD2 sing Y N 312 TYR CD1 CE1 sing Y N 313 TYR CD1 HD1 sing N N 314 TYR CD2 CE2 doub Y N 315 TYR CD2 HD2 sing N N 316 TYR CE1 CZ doub Y N 317 TYR CE1 HE1 sing N N 318 TYR CE2 CZ sing Y N 319 TYR CE2 HE2 sing N N 320 TYR CZ OH sing N N 321 TYR OH HH sing N N 322 TYR OXT HXT sing N N 323 VAL N CA sing N N 324 VAL N H sing N N 325 VAL N H2 sing N N 326 VAL CA C sing N N 327 VAL CA CB sing N N 328 VAL CA HA sing N N 329 VAL C O doub N N 330 VAL C OXT sing N N 331 VAL CB CG1 sing N N 332 VAL CB CG2 sing N N 333 VAL CB HB sing N N 334 VAL CG1 HG11 sing N N 335 VAL CG1 HG12 sing N N 336 VAL CG1 HG13 sing N N 337 VAL CG2 HG21 sing N N 338 VAL CG2 HG22 sing N N 339 VAL CG2 HG23 sing N N 340 VAL OXT HXT sing N N 341 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #