data_1BCV # _entry.id 1BCV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BCV pdb_00001bcv 10.2210/pdb1bcv/pdb WWPDB D_1000171602 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-11-25 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature 10 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BCV _pdbx_database_status.recvd_initial_deposition_date 1998-05-03 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Petit, M.C.' 1 'Benkirane, N.' 2 'Guichard, G.' 3 'Phan Chan Du, A.' 4 'Cung, M.T.' 5 'Briand, J.P.' 6 'Muller, S.' 7 # _citation.id primary _citation.title ;Solution structure of a retro-inverso peptide analogue mimicking the foot-and-mouth disease virus major antigenic site. Structural basis for its antigenic cross-reactivity with the parent peptide. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 274 _citation.page_first 3686 _citation.page_last 3692 _citation.year 1999 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9920919 _citation.pdbx_database_id_DOI 10.1074/jbc.274.6.3686 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Petit, M.C.' 1 ? primary 'Benkirane, N.' 2 ? primary 'Guichard, G.' 3 ? primary 'Du, A.P.' 4 ? primary 'Marraud, M.' 5 ? primary 'Cung, M.T.' 6 ? primary 'Briand, J.P.' 7 ? primary 'Muller, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PEPTIDE CORRESPONDING TO THE MAJOR IMMUNOGEN SITE OF FMD VIRUS' _entity.formula_weight 1972.235 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)GSGVRGDFGSLAPRVARQL' _entity_poly.pdbx_seq_one_letter_code_can XGSGVRGDFGSLAPRVARQL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 GLY n 1 3 SER n 1 4 GLY n 1 5 VAL n 1 6 ARG n 1 7 GLY n 1 8 ASP n 1 9 PHE n 1 10 GLY n 1 11 SER n 1 12 LEU n 1 13 ALA n 1 14 PRO n 1 15 ARG n 1 16 VAL n 1 17 ALA n 1 18 ARG n 1 19 GLN n 1 20 LEU n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'G-H LOOP OF THE PROTEIN VP1' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 140 140 ACE ACE A . n A 1 2 GLY 2 141 141 GLY GLY A . n A 1 3 SER 3 142 142 SER SER A . n A 1 4 GLY 4 143 143 GLY GLY A . n A 1 5 VAL 5 144 144 VAL VAL A . n A 1 6 ARG 6 145 145 ARG ARG A . n A 1 7 GLY 7 146 146 GLY GLY A . n A 1 8 ASP 8 147 147 ASP ASP A . n A 1 9 PHE 9 148 148 PHE PHE A . n A 1 10 GLY 10 149 149 GLY GLY A . n A 1 11 SER 11 150 150 SER SER A . n A 1 12 LEU 12 151 151 LEU LEU A . n A 1 13 ALA 13 152 152 ALA ALA A . n A 1 14 PRO 14 153 153 PRO PRO A . n A 1 15 ARG 15 154 154 ARG ARG A . n A 1 16 VAL 16 155 155 VAL VAL A . n A 1 17 ALA 17 156 156 ALA ALA A . n A 1 18 ARG 18 157 157 ARG ARG A . n A 1 19 GLN 19 158 158 GLN GLN A . n A 1 20 LEU 20 159 159 LEU LEU A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DYANA 'model building' . ? 1 DYANA refinement . ? 2 # _cell.entry_id 1BCV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BCV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1BCV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1BCV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1BCV _struct.title 'SYNTHETIC PEPTIDE CORRESPONDING TO THE MAJOR IMMUNOGEN SITE OF FMD VIRUS, NMR, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BCV _struct_keywords.pdbx_keywords 'SYNTHETIC PEPTIDE' _struct_keywords.text 'SYNTHETIC PEPTIDE, ANTIGENE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POLG_FMDVA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03308 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MNTTNCFIALVHAIREIRAFFLSRATGKMEFTLYNGERKTFYSRPNNHDNCWLNTILQLFRYVDEPFFDWVYNSPENLTL AAIKQLEELTGLELHEGGPPALVIWNIKHLLQTGIGTASRPARCMVDGTNMCLADFHAGIFLKEQEHAVFACVTSNGWYA IDDEDFYPWTPDPSDVLVFVPYDQEPLNGGWKANVQRKLKGAGQSSPATGSQNQSGNTGSIINNYYMQQYQNSMDTQLGD NAISGGSNEGSTDTTSTHTTNTQNNDWFSKLASSAFTGLFGALLADKKTEETTLLEDRILTTRNGHTTSTTQSSVGVTYG YSTEEDHVAGPNTSGLETRVVQAERFFKKFLFDWTPDKPFGHRTKLELPTDHHGVFGHLVDSYAYMRNGWDVEVSAVGNQ FNGGCLLVAMVPEWKTFDTREEYQLTLFPHQFISPRTNMTAHITVPYLGVNRYDQYKKHKPWTLVIMVLSPLTVSNTAAT QIKVYANIAPTYVHVAGELPSKVGIFPVACSDGYGGLVTTDPKTADPVYGKEYNPPKTNYPRRFTNLLDVAEACPTFLCF DDGKPYVVTRTDDTRLLAKFDVSLAAKHMSNTYLSGIAQYYTQYSGTINLHFMFTGSTDSKARYMVAYIPPGVETPPETP EGAAHCIHAEWDTGLNSKFTFSIPYVSAADYAYTASDTAETTNVQGWVCIYQITHGKAEDDTLVVSASAGKDFELRLPID PRSQTTATGESADPVTTTVENYGGETQVQRRHHTDVSFIMDRFVKIKSLNPTHVIDLMQTHQHGLVGALLRAATYYFSDL EIVVRHDGNLTWVPNGAPEAALSNTGNPTAYNKAPFTRLALPYTAPHRVLATVYNGTNKYSASGSGVRGDFGSLAPRVAR QLPASFNYGAIKAETIHELLVRMKRAELYCPRPLLAIEVSSQDRHKQKIIAPGKQLLNFDLLKLAGDVESNPRPFFFADV RSNFSKLVDTINQMQEDMSTKHGPDFNRLVSAFEELATGVKAIRTGLDEAKPWYKLIKLLSRLSCMAAVAARTKDPVLVA IMLADTGLEILDSTFVVKKISDSLSSLFHVPAPVFSFGAPVLLAGLVKVASSFLRSTPEDLERAEKQLKARDINDIFAIL KNGEWLVKLILAIRDWIKAWIASEEKFVTMTDLVLGILEKQRDLNDPSKYKEAKEWLDNARQACLKSGNVHIANLCKVVA PAPSKSRPEPVVVCLRGKSGQGKSFLANVLAQAISTHFTGRTDSVWYCPPDPDHFDGYNQQTVVVMDDLGQNPDGKDFKY FAQMVSTTGFIPPMASLEDKGKPFNSKVIIATTNLYSGFTPRTMVCPDALNRRFHFDIDVSAKDGYKINNKLDIVKALED THTNPVAMFQYDCALLNGMAVEMKRMQQDMFKPQPPLQNVYQLVQEVIERVELHEKVSSHPIFKQISIPSQKSVLYFLIE KGQHEAAIEFFEGMVHDSIKEELRPLIQQTSFVKRAFKRLKENFEIVALCLTLLANIVIMIRETRKRQKMVDDAVNEYIE KANITTDDTTLDEAEKNPLETSGASTVGFRERTLTGQRACNDVNSEPARPAEEQPQAEGPYTGPLERQRPLKVRAKLPQQ EGPYAGPLERQKPLKVKAKAPVVKEGPYEGPVKKPVALKVKAKNLIVTESGAPPTDLQKMVMGNTKPVELILDGKTVAIC CATGVFGTAYLVPRHLFAEKYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLHRGNRVRDITKHFRDTARMKK GTPVVGVVNNADVGRLIFSGEALTYKDIVVCMDGDTMPSLFAYKAATKAGYCGGAVLAKDGADTFIVGTHSAGGNGVGYC SCVSKSMLLRMKAHVDPEPQHEGLIVDTRDVEERVHVMRKTKLAPTVAHGVFNPEFGPAALSNKDPRLNEGVVLDEVIFS KHKGDTKMSAEDKALFRACAADYASRLHSVLGTANAPLSIYEAIKGVDGLDAMESDTAPGLPWAFQGKRRGALIDFENGT VGPEVEAALKLMEKREYKFVCQTFLKDEIRPMEKVRAGKTRIVDVLPVEHILYTRMMIGRFCAQMHSNNGPQIGSAVGCN PDVDWQRFGTHFAQYRNVWDVDYSAFDTNHCSDAMNIMFEEVFRTDFGFHPNAEWILKTLVNTEHAYENKRITVEGGMPS DCSATGIINTILNNIYVLYALRRHYEGVELDTYTMISYGDDIVVASDYDLDFEALKPHFKSLGQTITPADKSDKGFVLGH SITDVTFLKRHFHIDYGTGFYKPVMASKTLEAILSFARRGTIQEKLTSVAGLAVHSGPDEYRRLFEPFQGLFEIPSYRSL YLRWVNAVCGDA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BCV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 20 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03308 _struct_ref_seq.db_align_beg 864 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 882 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 141 _struct_ref_seq.pdbx_auth_seq_align_end 159 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ACE _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id GLY _struct_conn.ptnr2_label_seq_id 2 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ACE _struct_conn.ptnr1_auth_seq_id 140 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GLY _struct_conn.ptnr2_auth_seq_id 141 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.325 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ACE _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id GLY _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 2 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id ACE _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 140 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id GLY _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 141 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id GLY _pdbx_modification_feature.ref_pcm_id 12 _pdbx_modification_feature.ref_comp_id ACE _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal acetylation' # _pdbx_entry_details.entry_id 1BCV _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 142 ? ? -99.15 59.47 2 1 VAL A 144 ? ? 175.11 116.49 3 1 ALA A 156 ? ? -139.59 -46.25 4 2 SER A 142 ? ? -51.61 173.49 5 2 VAL A 144 ? ? 175.10 116.47 6 2 ALA A 156 ? ? -139.55 -46.25 7 3 VAL A 144 ? ? 175.03 116.43 8 3 ASP A 147 ? ? -47.36 159.86 9 3 ARG A 154 ? ? -111.01 71.12 10 3 ALA A 156 ? ? -139.58 -46.25 11 4 VAL A 144 ? ? 175.07 116.49 12 4 ARG A 145 ? ? -39.81 112.61 13 4 ALA A 156 ? ? -139.62 -46.17 14 5 VAL A 144 ? ? 175.09 116.46 15 5 ARG A 145 ? ? -166.49 107.71 16 5 ALA A 156 ? ? -139.68 -46.23 17 6 SER A 142 ? ? -113.16 59.64 18 6 VAL A 144 ? ? 175.10 116.47 19 6 PHE A 148 ? ? -46.61 172.44 20 6 ALA A 156 ? ? -139.61 -46.21 21 7 VAL A 144 ? ? 175.07 116.49 22 7 PHE A 148 ? ? -41.69 158.69 23 7 LEU A 151 ? ? -45.06 165.08 24 7 ALA A 156 ? ? -139.60 -46.20 25 8 VAL A 144 ? ? 175.07 116.46 26 8 ARG A 154 ? ? -151.83 88.96 27 8 ALA A 156 ? ? -139.81 -46.26 28 9 SER A 142 ? ? -151.85 55.22 29 9 VAL A 144 ? ? 175.07 116.46 30 9 ARG A 145 ? ? -167.82 96.95 31 9 ALA A 156 ? ? -140.47 -45.90 32 10 SER A 142 ? ? -167.47 58.93 33 10 VAL A 144 ? ? 175.06 116.48 34 10 ARG A 145 ? ? -56.49 106.06 35 10 ALA A 156 ? ? -140.48 -45.86 # _pdbx_nmr_ensemble.entry_id 1BCV _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents H2O # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '0.1M PHOSPHATE' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 COSY 1 2 1 TOCSY 1 3 1 ROESY 1 4 1 NOESY 1 # _pdbx_nmr_refine.entry_id 1BCV _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details 'RESTRAINED ENERGY REFINEMENT.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DYANA 1.4 GUNTERT,WUTHRICH 1 'structure solution' DYANA-1.4 ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 ARG N N N N 21 ARG CA C N S 22 ARG C C N N 23 ARG O O N N 24 ARG CB C N N 25 ARG CG C N N 26 ARG CD C N N 27 ARG NE N N N 28 ARG CZ C N N 29 ARG NH1 N N N 30 ARG NH2 N N N 31 ARG OXT O N N 32 ARG H H N N 33 ARG H2 H N N 34 ARG HA H N N 35 ARG HB2 H N N 36 ARG HB3 H N N 37 ARG HG2 H N N 38 ARG HG3 H N N 39 ARG HD2 H N N 40 ARG HD3 H N N 41 ARG HE H N N 42 ARG HH11 H N N 43 ARG HH12 H N N 44 ARG HH21 H N N 45 ARG HH22 H N N 46 ARG HXT H N N 47 ASP N N N N 48 ASP CA C N S 49 ASP C C N N 50 ASP O O N N 51 ASP CB C N N 52 ASP CG C N N 53 ASP OD1 O N N 54 ASP OD2 O N N 55 ASP OXT O N N 56 ASP H H N N 57 ASP H2 H N N 58 ASP HA H N N 59 ASP HB2 H N N 60 ASP HB3 H N N 61 ASP HD2 H N N 62 ASP HXT H N N 63 GLN N N N N 64 GLN CA C N S 65 GLN C C N N 66 GLN O O N N 67 GLN CB C N N 68 GLN CG C N N 69 GLN CD C N N 70 GLN OE1 O N N 71 GLN NE2 N N N 72 GLN OXT O N N 73 GLN H H N N 74 GLN H2 H N N 75 GLN HA H N N 76 GLN HB2 H N N 77 GLN HB3 H N N 78 GLN HG2 H N N 79 GLN HG3 H N N 80 GLN HE21 H N N 81 GLN HE22 H N N 82 GLN HXT H N N 83 GLY N N N N 84 GLY CA C N N 85 GLY C C N N 86 GLY O O N N 87 GLY OXT O N N 88 GLY H H N N 89 GLY H2 H N N 90 GLY HA2 H N N 91 GLY HA3 H N N 92 GLY HXT H N N 93 LEU N N N N 94 LEU CA C N S 95 LEU C C N N 96 LEU O O N N 97 LEU CB C N N 98 LEU CG C N N 99 LEU CD1 C N N 100 LEU CD2 C N N 101 LEU OXT O N N 102 LEU H H N N 103 LEU H2 H N N 104 LEU HA H N N 105 LEU HB2 H N N 106 LEU HB3 H N N 107 LEU HG H N N 108 LEU HD11 H N N 109 LEU HD12 H N N 110 LEU HD13 H N N 111 LEU HD21 H N N 112 LEU HD22 H N N 113 LEU HD23 H N N 114 LEU HXT H N N 115 PHE N N N N 116 PHE CA C N S 117 PHE C C N N 118 PHE O O N N 119 PHE CB C N N 120 PHE CG C Y N 121 PHE CD1 C Y N 122 PHE CD2 C Y N 123 PHE CE1 C Y N 124 PHE CE2 C Y N 125 PHE CZ C Y N 126 PHE OXT O N N 127 PHE H H N N 128 PHE H2 H N N 129 PHE HA H N N 130 PHE HB2 H N N 131 PHE HB3 H N N 132 PHE HD1 H N N 133 PHE HD2 H N N 134 PHE HE1 H N N 135 PHE HE2 H N N 136 PHE HZ H N N 137 PHE HXT H N N 138 PRO N N N N 139 PRO CA C N S 140 PRO C C N N 141 PRO O O N N 142 PRO CB C N N 143 PRO CG C N N 144 PRO CD C N N 145 PRO OXT O N N 146 PRO H H N N 147 PRO HA H N N 148 PRO HB2 H N N 149 PRO HB3 H N N 150 PRO HG2 H N N 151 PRO HG3 H N N 152 PRO HD2 H N N 153 PRO HD3 H N N 154 PRO HXT H N N 155 SER N N N N 156 SER CA C N S 157 SER C C N N 158 SER O O N N 159 SER CB C N N 160 SER OG O N N 161 SER OXT O N N 162 SER H H N N 163 SER H2 H N N 164 SER HA H N N 165 SER HB2 H N N 166 SER HB3 H N N 167 SER HG H N N 168 SER HXT H N N 169 VAL N N N N 170 VAL CA C N S 171 VAL C C N N 172 VAL O O N N 173 VAL CB C N N 174 VAL CG1 C N N 175 VAL CG2 C N N 176 VAL OXT O N N 177 VAL H H N N 178 VAL H2 H N N 179 VAL HA H N N 180 VAL HB H N N 181 VAL HG11 H N N 182 VAL HG12 H N N 183 VAL HG13 H N N 184 VAL HG21 H N N 185 VAL HG22 H N N 186 VAL HG23 H N N 187 VAL HXT H N N 188 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 ARG N CA sing N N 19 ARG N H sing N N 20 ARG N H2 sing N N 21 ARG CA C sing N N 22 ARG CA CB sing N N 23 ARG CA HA sing N N 24 ARG C O doub N N 25 ARG C OXT sing N N 26 ARG CB CG sing N N 27 ARG CB HB2 sing N N 28 ARG CB HB3 sing N N 29 ARG CG CD sing N N 30 ARG CG HG2 sing N N 31 ARG CG HG3 sing N N 32 ARG CD NE sing N N 33 ARG CD HD2 sing N N 34 ARG CD HD3 sing N N 35 ARG NE CZ sing N N 36 ARG NE HE sing N N 37 ARG CZ NH1 sing N N 38 ARG CZ NH2 doub N N 39 ARG NH1 HH11 sing N N 40 ARG NH1 HH12 sing N N 41 ARG NH2 HH21 sing N N 42 ARG NH2 HH22 sing N N 43 ARG OXT HXT sing N N 44 ASP N CA sing N N 45 ASP N H sing N N 46 ASP N H2 sing N N 47 ASP CA C sing N N 48 ASP CA CB sing N N 49 ASP CA HA sing N N 50 ASP C O doub N N 51 ASP C OXT sing N N 52 ASP CB CG sing N N 53 ASP CB HB2 sing N N 54 ASP CB HB3 sing N N 55 ASP CG OD1 doub N N 56 ASP CG OD2 sing N N 57 ASP OD2 HD2 sing N N 58 ASP OXT HXT sing N N 59 GLN N CA sing N N 60 GLN N H sing N N 61 GLN N H2 sing N N 62 GLN CA C sing N N 63 GLN CA CB sing N N 64 GLN CA HA sing N N 65 GLN C O doub N N 66 GLN C OXT sing N N 67 GLN CB CG sing N N 68 GLN CB HB2 sing N N 69 GLN CB HB3 sing N N 70 GLN CG CD sing N N 71 GLN CG HG2 sing N N 72 GLN CG HG3 sing N N 73 GLN CD OE1 doub N N 74 GLN CD NE2 sing N N 75 GLN NE2 HE21 sing N N 76 GLN NE2 HE22 sing N N 77 GLN OXT HXT sing N N 78 GLY N CA sing N N 79 GLY N H sing N N 80 GLY N H2 sing N N 81 GLY CA C sing N N 82 GLY CA HA2 sing N N 83 GLY CA HA3 sing N N 84 GLY C O doub N N 85 GLY C OXT sing N N 86 GLY OXT HXT sing N N 87 LEU N CA sing N N 88 LEU N H sing N N 89 LEU N H2 sing N N 90 LEU CA C sing N N 91 LEU CA CB sing N N 92 LEU CA HA sing N N 93 LEU C O doub N N 94 LEU C OXT sing N N 95 LEU CB CG sing N N 96 LEU CB HB2 sing N N 97 LEU CB HB3 sing N N 98 LEU CG CD1 sing N N 99 LEU CG CD2 sing N N 100 LEU CG HG sing N N 101 LEU CD1 HD11 sing N N 102 LEU CD1 HD12 sing N N 103 LEU CD1 HD13 sing N N 104 LEU CD2 HD21 sing N N 105 LEU CD2 HD22 sing N N 106 LEU CD2 HD23 sing N N 107 LEU OXT HXT sing N N 108 PHE N CA sing N N 109 PHE N H sing N N 110 PHE N H2 sing N N 111 PHE CA C sing N N 112 PHE CA CB sing N N 113 PHE CA HA sing N N 114 PHE C O doub N N 115 PHE C OXT sing N N 116 PHE CB CG sing N N 117 PHE CB HB2 sing N N 118 PHE CB HB3 sing N N 119 PHE CG CD1 doub Y N 120 PHE CG CD2 sing Y N 121 PHE CD1 CE1 sing Y N 122 PHE CD1 HD1 sing N N 123 PHE CD2 CE2 doub Y N 124 PHE CD2 HD2 sing N N 125 PHE CE1 CZ doub Y N 126 PHE CE1 HE1 sing N N 127 PHE CE2 CZ sing Y N 128 PHE CE2 HE2 sing N N 129 PHE CZ HZ sing N N 130 PHE OXT HXT sing N N 131 PRO N CA sing N N 132 PRO N CD sing N N 133 PRO N H sing N N 134 PRO CA C sing N N 135 PRO CA CB sing N N 136 PRO CA HA sing N N 137 PRO C O doub N N 138 PRO C OXT sing N N 139 PRO CB CG sing N N 140 PRO CB HB2 sing N N 141 PRO CB HB3 sing N N 142 PRO CG CD sing N N 143 PRO CG HG2 sing N N 144 PRO CG HG3 sing N N 145 PRO CD HD2 sing N N 146 PRO CD HD3 sing N N 147 PRO OXT HXT sing N N 148 SER N CA sing N N 149 SER N H sing N N 150 SER N H2 sing N N 151 SER CA C sing N N 152 SER CA CB sing N N 153 SER CA HA sing N N 154 SER C O doub N N 155 SER C OXT sing N N 156 SER CB OG sing N N 157 SER CB HB2 sing N N 158 SER CB HB3 sing N N 159 SER OG HG sing N N 160 SER OXT HXT sing N N 161 VAL N CA sing N N 162 VAL N H sing N N 163 VAL N H2 sing N N 164 VAL CA C sing N N 165 VAL CA CB sing N N 166 VAL CA HA sing N N 167 VAL C O doub N N 168 VAL C OXT sing N N 169 VAL CB CG1 sing N N 170 VAL CB CG2 sing N N 171 VAL CB HB sing N N 172 VAL CG1 HG11 sing N N 173 VAL CG1 HG12 sing N N 174 VAL CG1 HG13 sing N N 175 VAL CG2 HG21 sing N N 176 VAL CG2 HG22 sing N N 177 VAL CG2 HG23 sing N N 178 VAL OXT HXT sing N N 179 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX400 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 400 # _atom_sites.entry_id 1BCV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_