data_1BE1 # _entry.id 1BE1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BE1 pdb_00001be1 10.2210/pdb1be1/pdb WWPDB D_1000171643 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BE1 _pdbx_database_status.recvd_initial_deposition_date 1998-05-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tollinger, M.' 1 'Konrat, R.' 2 'Hilbert, B.H.' 3 'Marsh, E.N.G.' 4 'Kraeutler, B.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;How a protein prepares for B12 binding: structure and dynamics of the B12-binding subunit of glutamate mutase from Clostridium tetanomorphum ; Structure 6 1021 1033 1998 STRUE6 UK 0969-2126 2005 ? 9739092 '10.1016/S0969-2126(98)00103-8' 1 ;Adenosylcobalamin-Dependent Glutamate Mutase from Clostridium Tetanomorphum. Overexpression in Escherichia Coli, Purification, and Characterization of the Recombinant Enzyme ; J.Biol.Chem. 269 20425 ? 1994 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tollinger, M.' 1 ? primary 'Konrat, R.' 2 ? primary 'Hilbert, B.H.' 3 ? primary 'Marsh, E.N.' 4 ? primary 'Krautler, B.' 5 ? 1 'Holloway, D.E.' 6 ? 1 'Marsh, E.N.' 7 ? # _cell.entry_id 1BE1 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BE1 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'GLUTAMATE MUTASE' _entity.formula_weight 14763.856 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 5.4.99.1 _entity.pdbx_mutation ? _entity.pdbx_fragment 'B12-BINDING SUBUNIT' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name MUTS # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDE AGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDE AGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 LYS n 1 5 THR n 1 6 ILE n 1 7 VAL n 1 8 LEU n 1 9 GLY n 1 10 VAL n 1 11 ILE n 1 12 GLY n 1 13 SER n 1 14 ASP n 1 15 CYS n 1 16 HIS n 1 17 ALA n 1 18 VAL n 1 19 GLY n 1 20 ASN n 1 21 LYS n 1 22 ILE n 1 23 LEU n 1 24 ASP n 1 25 HIS n 1 26 SER n 1 27 PHE n 1 28 THR n 1 29 ASN n 1 30 ALA n 1 31 GLY n 1 32 PHE n 1 33 ASN n 1 34 VAL n 1 35 VAL n 1 36 ASN n 1 37 ILE n 1 38 GLY n 1 39 VAL n 1 40 LEU n 1 41 SER n 1 42 SER n 1 43 GLN n 1 44 GLU n 1 45 ASP n 1 46 PHE n 1 47 ILE n 1 48 ASN n 1 49 ALA n 1 50 ALA n 1 51 ILE n 1 52 GLU n 1 53 THR n 1 54 LYS n 1 55 ALA n 1 56 ASP n 1 57 LEU n 1 58 ILE n 1 59 CYS n 1 60 VAL n 1 61 SER n 1 62 SER n 1 63 LEU n 1 64 TYR n 1 65 GLY n 1 66 GLN n 1 67 GLY n 1 68 GLU n 1 69 ILE n 1 70 ASP n 1 71 CYS n 1 72 LYS n 1 73 GLY n 1 74 LEU n 1 75 ARG n 1 76 GLU n 1 77 LYS n 1 78 CYS n 1 79 ASP n 1 80 GLU n 1 81 ALA n 1 82 GLY n 1 83 LEU n 1 84 LYS n 1 85 GLY n 1 86 ILE n 1 87 LYS n 1 88 LEU n 1 89 PHE n 1 90 VAL n 1 91 GLY n 1 92 GLY n 1 93 ASN n 1 94 ILE n 1 95 VAL n 1 96 VAL n 1 97 GLY n 1 98 LYS n 1 99 GLN n 1 100 ASN n 1 101 TRP n 1 102 PRO n 1 103 ASP n 1 104 VAL n 1 105 GLU n 1 106 GLN n 1 107 ARG n 1 108 PHE n 1 109 LYS n 1 110 ALA n 1 111 MET n 1 112 GLY n 1 113 PHE n 1 114 ASP n 1 115 ARG n 1 116 VAL n 1 117 TYR n 1 118 PRO n 1 119 PRO n 1 120 GLY n 1 121 THR n 1 122 SER n 1 123 PRO n 1 124 GLU n 1 125 THR n 1 126 THR n 1 127 ILE n 1 128 ALA n 1 129 ASP n 1 130 MET n 1 131 LYS n 1 132 GLU n 1 133 VAL n 1 134 LEU n 1 135 GLY n 1 136 VAL n 1 137 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Clostridium _entity_src_gen.pdbx_gene_src_gene MUTS _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain H1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium tetanomorphum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1553 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 'ATCC 15920' _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene MUTS _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL12 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PT7-7 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PMUTSX _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MAMA_CLOTT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q05488 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICVSSLYGQGEIDCKGLREKCDE AGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPGTSPETTIADMKEVLGVE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BE1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05488 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 137 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 137 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D 15N HSQC' 1 2 1 '2D X-FILT NOESY' 1 3 1 '2D NOESY' 1 4 1 '2D TOCSY' 1 5 1 '3D 15N NOESY-HSQC' 1 6 1 '3D 15N TOCSY-HSQC' 1 7 1 '3D 15N HSQC-NOESY-HSQC' 1 8 1 '3D HNHA' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 299 _pdbx_nmr_exptl_sample_conditions.pressure ATMOSPHERIC _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '11mM KXH3-XPO4' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% H2O,10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1BE1 _pdbx_nmr_refine.method 'DISTANCE GEOMETRY, SIMULATED ANNEALING, ENERGY MINIMIZATION' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1BE1 _pdbx_nmr_ensemble.conformers_calculated_total_number 15 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'MINIMIZED AVERAGE' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' NMRPipe ? ? 2 'structure solution' ANSIG ? ? 3 'structure solution' Felix ? ? 4 'structure solution' X-PLOR 3.1 ? 5 # _exptl.entry_id 1BE1 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BE1 _struct.title 'GLUTAMATE MUTASE (B12-BINDING SUBUNIT), NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BE1 _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'ISOMERASE, GLUTAMATE MUTASE, B12-BINDING SUBUNIT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 2 GLN A 43 ? LYS A 54 ? GLN A 43 LYS A 54 1 ? 12 HELX_P HELX_P2 3 GLU A 68 ? GLU A 80 ? GLU A 68 GLU A 80 1 ? 13 HELX_P HELX_P3 4 PRO A 102 ? MET A 111 ? PRO A 102 MET A 111 1 ? 10 HELX_P HELX_P4 5 PRO A 123 ? GLY A 135 ? PRO A 123 GLY A 135 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id 1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense 1 1 2 ? parallel 1 2 3 ? parallel 1 3 4 ? parallel 1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id 1 1 ASN A 33 ? ILE A 37 ? ASN A 33 ILE A 37 1 2 THR A 5 ? VAL A 10 ? THR A 5 VAL A 10 1 3 LEU A 57 ? SER A 62 ? LEU A 57 SER A 62 1 4 LYS A 87 ? GLY A 91 ? LYS A 87 GLY A 91 1 5 ASP A 114 ? TYR A 117 ? ASP A 114 TYR A 117 # _database_PDB_matrix.entry_id 1BE1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BE1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 TRP 101 101 101 TRP TRP A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 GLU 137 137 137 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-08-26 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 10 ? ? 48.34 -110.19 2 1 ILE A 11 ? ? -84.14 -119.34 3 1 ASP A 14 ? ? -161.29 -42.48 4 1 CYS A 15 ? ? 86.32 102.05 5 1 HIS A 16 ? ? -96.20 53.46 6 1 ASN A 20 ? ? -124.33 -67.89 7 1 LYS A 21 ? ? -160.37 -132.47 8 1 LEU A 23 ? ? 78.28 53.88 9 1 HIS A 25 ? ? -171.26 46.17 10 1 SER A 26 ? ? -164.88 -25.49 11 1 PHE A 27 ? ? -68.20 -89.02 12 1 ASN A 29 ? ? 63.31 -78.08 13 1 LEU A 40 ? ? 71.28 -104.18 14 1 SER A 41 ? ? 161.57 -12.94 15 1 SER A 42 ? ? -30.42 92.27 16 1 GLU A 52 ? ? -64.71 -71.41 17 1 LYS A 54 ? ? 80.59 48.89 18 1 SER A 61 ? ? -100.11 68.74 19 1 ALA A 81 ? ? 70.80 -3.41 20 1 LYS A 84 ? ? -76.28 -168.78 21 1 ASN A 93 ? ? 74.46 -84.05 22 1 ILE A 94 ? ? -109.74 -123.07 23 1 VAL A 95 ? ? -135.68 -148.64 24 1 LYS A 98 ? ? -132.19 -58.23 25 1 ASN A 100 ? ? 70.25 64.60 26 1 VAL A 104 ? ? -54.07 -76.70 27 1 ARG A 115 ? ? -110.59 -169.99 28 1 LYS A 131 ? ? -82.07 -71.77 #