data_1BED # _entry.id 1BED # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BED pdb_00001bed 10.2210/pdb1bed/pdb WWPDB D_1000171655 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BED _pdbx_database_status.recvd_initial_deposition_date 1996-09-16 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hu, S.-H.' 1 'Martin, J.L.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of TcpG, the DsbA protein folding catalyst from Vibrio cholerae.' J.Mol.Biol. 268 137 146 1997 JMOBAK UK 0022-2836 0070 ? 9149147 10.1006/jmbi.1997.0940 1 ;Characterization of a Periplasmic Thiol:Disulfide Interchange Protein Required for the Functional Maturation of Secreted Virulence Factors of Vibrio Cholerae ; Proc.Natl.Acad.Sci.USA 89 6210 ? 1992 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hu, S.H.' 1 ? primary 'Peek, J.A.' 2 ? primary 'Rattigan, E.' 3 ? primary 'Taylor, R.K.' 4 ? primary 'Martin, J.L.' 5 ? 1 'Peek, J.A.' 6 ? 1 'Taylor, R.K.' 7 ? # _cell.entry_id 1BED _cell.length_a 64.000 _cell.length_b 91.500 _cell.length_c 64.800 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BED _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'DSBA OXIDOREDUCTASE' 20523.418 1 ? ? ? ? 2 water nat water 18.015 53 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TCPG, DISULFIDE BOND FORMATION PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AQFKEGEHYQVLKTPASSSPVVSEFFSFYCPHCNTFEPIIAQLKQQLPEGAKFQKNHVSFMGGNMGQAMSKAYATMIALE VEDKMVPVMFNRIHTLRKPPKDEQELRQIFLDEGIDAAKFDAAYNGFAVDSMVRRFDKQFQDSGLTGVPAVVVNNRYLVQ GQSVKSLDEYFDLVNYLLTLK ; _entity_poly.pdbx_seq_one_letter_code_can ;AQFKEGEHYQVLKTPASSSPVVSEFFSFYCPHCNTFEPIIAQLKQQLPEGAKFQKNHVSFMGGNMGQAMSKAYATMIALE VEDKMVPVMFNRIHTLRKPPKDEQELRQIFLDEGIDAAKFDAAYNGFAVDSMVRRFDKQFQDSGLTGVPAVVVNNRYLVQ GQSVKSLDEYFDLVNYLLTLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLN n 1 3 PHE n 1 4 LYS n 1 5 GLU n 1 6 GLY n 1 7 GLU n 1 8 HIS n 1 9 TYR n 1 10 GLN n 1 11 VAL n 1 12 LEU n 1 13 LYS n 1 14 THR n 1 15 PRO n 1 16 ALA n 1 17 SER n 1 18 SER n 1 19 SER n 1 20 PRO n 1 21 VAL n 1 22 VAL n 1 23 SER n 1 24 GLU n 1 25 PHE n 1 26 PHE n 1 27 SER n 1 28 PHE n 1 29 TYR n 1 30 CYS n 1 31 PRO n 1 32 HIS n 1 33 CYS n 1 34 ASN n 1 35 THR n 1 36 PHE n 1 37 GLU n 1 38 PRO n 1 39 ILE n 1 40 ILE n 1 41 ALA n 1 42 GLN n 1 43 LEU n 1 44 LYS n 1 45 GLN n 1 46 GLN n 1 47 LEU n 1 48 PRO n 1 49 GLU n 1 50 GLY n 1 51 ALA n 1 52 LYS n 1 53 PHE n 1 54 GLN n 1 55 LYS n 1 56 ASN n 1 57 HIS n 1 58 VAL n 1 59 SER n 1 60 PHE n 1 61 MET n 1 62 GLY n 1 63 GLY n 1 64 ASN n 1 65 MET n 1 66 GLY n 1 67 GLN n 1 68 ALA n 1 69 MET n 1 70 SER n 1 71 LYS n 1 72 ALA n 1 73 TYR n 1 74 ALA n 1 75 THR n 1 76 MET n 1 77 ILE n 1 78 ALA n 1 79 LEU n 1 80 GLU n 1 81 VAL n 1 82 GLU n 1 83 ASP n 1 84 LYS n 1 85 MET n 1 86 VAL n 1 87 PRO n 1 88 VAL n 1 89 MET n 1 90 PHE n 1 91 ASN n 1 92 ARG n 1 93 ILE n 1 94 HIS n 1 95 THR n 1 96 LEU n 1 97 ARG n 1 98 LYS n 1 99 PRO n 1 100 PRO n 1 101 LYS n 1 102 ASP n 1 103 GLU n 1 104 GLN n 1 105 GLU n 1 106 LEU n 1 107 ARG n 1 108 GLN n 1 109 ILE n 1 110 PHE n 1 111 LEU n 1 112 ASP n 1 113 GLU n 1 114 GLY n 1 115 ILE n 1 116 ASP n 1 117 ALA n 1 118 ALA n 1 119 LYS n 1 120 PHE n 1 121 ASP n 1 122 ALA n 1 123 ALA n 1 124 TYR n 1 125 ASN n 1 126 GLY n 1 127 PHE n 1 128 ALA n 1 129 VAL n 1 130 ASP n 1 131 SER n 1 132 MET n 1 133 VAL n 1 134 ARG n 1 135 ARG n 1 136 PHE n 1 137 ASP n 1 138 LYS n 1 139 GLN n 1 140 PHE n 1 141 GLN n 1 142 ASP n 1 143 SER n 1 144 GLY n 1 145 LEU n 1 146 THR n 1 147 GLY n 1 148 VAL n 1 149 PRO n 1 150 ALA n 1 151 VAL n 1 152 VAL n 1 153 VAL n 1 154 ASN n 1 155 ASN n 1 156 ARG n 1 157 TYR n 1 158 LEU n 1 159 VAL n 1 160 GLN n 1 161 GLY n 1 162 GLN n 1 163 SER n 1 164 VAL n 1 165 LYS n 1 166 SER n 1 167 LEU n 1 168 ASP n 1 169 GLU n 1 170 TYR n 1 171 PHE n 1 172 ASP n 1 173 LEU n 1 174 VAL n 1 175 ASN n 1 176 TYR n 1 177 LEU n 1 178 LEU n 1 179 THR n 1 180 LEU n 1 181 LYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Vibrio cholerae' _entity_src_nat.pdbx_ncbi_taxonomy_id 666 _entity_src_nat.genus Vibrio _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DSBA_VIBCH _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P32557 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKKLFALVATLMLSVSAYAAQFKEGEHYQVLKTPASSSPVVNEFFSFYCPHCNTFEPIIAQLKQQLPEGAKFQKNHVSFM GGNMGQAMSKAYATMIALEVEDKMVPVMFNRIHTLRKPPKDEQELRQIFLDEGIDAAKFDAAYNGFAVDSMVRRFDKQFQ DSGLTGVPAVVVNNRYLVQGQSVKSLDEYFDLVNYLLTLK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BED _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 181 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32557 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 181 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1BED _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 23 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P32557 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 42 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 23 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BED _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_percent_sol 48. _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range 6.0-6.5 _exptl_crystal_grow.pdbx_details '10-13% EG 4K, 0.1M MES, PH 6.0-6.5' # _diffrn.id 1 _diffrn.ambient_temp 290 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 1994-08-17 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BED _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.0 _reflns.d_resolution_high 2.0 _reflns.number_obs 12974 _reflns.number_all ? _reflns.percent_possible_obs 98.2 _reflns.pdbx_Rmerge_I_obs 0.062 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.1 _reflns.B_iso_Wilson_estimate 31. _reflns.pdbx_redundancy 5.7 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 91.7 _reflns_shell.Rmerge_I_obs 0.341 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.4 _reflns_shell.pdbx_redundancy 2.9 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1BED _refine.ls_number_reflns_obs 9309 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20. _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs 70. _refine.ls_R_factor_obs 0.205 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.205 _refine.ls_R_factor_R_free 0.241 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10. _refine.ls_number_reflns_R_free 931 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 38.2 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1DSB' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1BED _refine_analyze.Luzzati_coordinate_error_obs 0.24 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs 20.0 _refine_analyze.Luzzati_coordinate_error_free 0.25 _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1385 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 53 _refine_hist.number_atoms_total 1438 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 20. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 23.1 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.2 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? 1.5 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? 2.0 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? 2.0 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? 2.5 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.d_res_high 2.1 _refine_ls_shell.d_res_low 2.2 _refine_ls_shell.number_reflns_R_work 681 _refine_ls_shell.R_factor_R_work 0.277 _refine_ls_shell.percent_reflns_obs 54. _refine_ls_shell.R_factor_R_free 0.368 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5.3 _refine_ls_shell.number_reflns_R_free 75 _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 PARAM19.SOL TOPH19.SOL 'X-RAY DIFFRACTION' # _struct.entry_id 1BED _struct.title 'STRUCTURE OF DISULFIDE OXIDOREDUCTASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BED _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'TCPG, PROTEIN DISULFIDE ISOMERASE, DISULFIDE OXIDOREDUCTASE, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 30 ? GLU A 37 ? CYS A 30 GLU A 37 1 ? 8 HELX_P HELX_P2 "1'" PRO A 38 ? LEU A 47 ? PRO A 38 LEU A 47 1 ? 10 HELX_P HELX_P3 2 GLY A 63 ? LEU A 79 ? GLY A 63 LEU A 79 1 ? 17 HELX_P HELX_P4 3 VAL A 81 ? HIS A 94 ? VAL A 81 HIS A 94 1 ? 14 HELX_P HELX_P5 4 ASP A 102 ? GLU A 113 ? ASP A 102 GLU A 113 1 ? 12 HELX_P HELX_P6 5 ASP A 116 ? ASN A 125 ? ASP A 116 ASN A 125 1 ? 10 HELX_P HELX_P7 6 PHE A 127 ? GLY A 144 ? PHE A 127 GLY A 144 1 ? 18 HELX_P HELX_P8 7 SER A 166 ? THR A 179 ? SER A 166 THR A 179 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 30 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 33 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 30 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 33 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.038 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 148 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 148 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 149 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 149 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.44 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 8 ? LEU A 12 ? HIS A 8 LEU A 12 A 2 ARG A 156 ? GLN A 160 ? ARG A 156 GLN A 160 B 1 LYS A 52 ? VAL A 58 ? LYS A 52 VAL A 58 B 2 VAL A 21 ? PHE A 26 ? VAL A 21 PHE A 26 B 3 ALA A 150 ? ASN A 154 ? ALA A 150 ASN A 154 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 10 ? O GLN A 10 N LEU A 158 ? N LEU A 158 B 1 2 O LYS A 52 ? O LYS A 52 N VAL A 22 ? N VAL A 22 B 2 3 O SER A 23 ? O SER A 23 N VAL A 152 ? N VAL A 152 # _database_PDB_matrix.entry_id 1BED _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BED _atom_sites.fract_transf_matrix[1][1] 0.015625 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010929 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015432 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 MET 132 132 132 MET MET A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 ASP 142 142 142 ASP ASP A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 GLN 160 160 160 GLN GLN A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 GLN 162 162 162 GLN GLN A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 TYR 170 170 170 TYR TYR A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 LYS 181 181 181 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 200 200 HOH HOH A . B 2 HOH 2 201 201 HOH HOH A . B 2 HOH 3 202 202 HOH HOH A . B 2 HOH 4 203 203 HOH HOH A . B 2 HOH 5 204 204 HOH HOH A . B 2 HOH 6 205 205 HOH HOH A . B 2 HOH 7 206 206 HOH HOH A . B 2 HOH 8 207 207 HOH HOH A . B 2 HOH 9 208 208 HOH HOH A . B 2 HOH 10 209 209 HOH HOH A . B 2 HOH 11 210 210 HOH HOH A . B 2 HOH 12 211 211 HOH HOH A . B 2 HOH 13 212 212 HOH HOH A . B 2 HOH 14 213 213 HOH HOH A . B 2 HOH 15 214 214 HOH HOH A . B 2 HOH 16 215 215 HOH HOH A . B 2 HOH 17 216 216 HOH HOH A . B 2 HOH 18 217 217 HOH HOH A . B 2 HOH 19 218 218 HOH HOH A . B 2 HOH 20 219 219 HOH HOH A . B 2 HOH 21 220 220 HOH HOH A . B 2 HOH 22 221 221 HOH HOH A . B 2 HOH 23 222 222 HOH HOH A . B 2 HOH 24 223 223 HOH HOH A . B 2 HOH 25 224 224 HOH HOH A . B 2 HOH 26 225 225 HOH HOH A . B 2 HOH 27 226 226 HOH HOH A . B 2 HOH 28 227 227 HOH HOH A . B 2 HOH 29 228 228 HOH HOH A . B 2 HOH 30 229 229 HOH HOH A . B 2 HOH 31 230 230 HOH HOH A . B 2 HOH 32 231 231 HOH HOH A . B 2 HOH 33 232 232 HOH HOH A . B 2 HOH 34 233 233 HOH HOH A . B 2 HOH 35 234 234 HOH HOH A . B 2 HOH 36 235 235 HOH HOH A . B 2 HOH 37 236 236 HOH HOH A . B 2 HOH 38 237 237 HOH HOH A . B 2 HOH 39 238 238 HOH HOH A . B 2 HOH 40 239 239 HOH HOH A . B 2 HOH 41 240 240 HOH HOH A . B 2 HOH 42 241 241 HOH HOH A . B 2 HOH 43 242 242 HOH HOH A . B 2 HOH 44 243 243 HOH HOH A . B 2 HOH 45 244 244 HOH HOH A . B 2 HOH 46 245 245 HOH HOH A . B 2 HOH 47 246 246 HOH HOH A . B 2 HOH 48 247 247 HOH HOH A . B 2 HOH 49 248 248 HOH HOH A . B 2 HOH 50 249 249 HOH HOH A . B 2 HOH 51 250 250 HOH HOH A . B 2 HOH 52 251 251 HOH HOH A . B 2 HOH 53 252 252 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_556 -x,y,-z+3/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 97.2000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-10-08 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_initial_refinement_model 3 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 X-PLOR 'model building' 3.1 ? 3 X-PLOR refinement 3.1 ? 4 X-PLOR phasing 3.1 ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 7 ? ? -131.51 -54.56 2 1 HIS A 94 ? ? -97.73 -60.01 3 1 ASN A 155 ? ? 70.07 -5.62 4 1 GLN A 160 ? ? -91.75 52.72 5 1 GLN A 162 ? ? -62.21 2.00 6 1 LYS A 165 ? ? -71.84 -91.68 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 4 ? CG ? A LYS 4 CG 2 1 Y 1 A LYS 4 ? CD ? A LYS 4 CD 3 1 Y 1 A LYS 4 ? CE ? A LYS 4 CE 4 1 Y 1 A LYS 4 ? NZ ? A LYS 4 NZ 5 1 Y 1 A GLN 10 ? CG ? A GLN 10 CG 6 1 Y 1 A GLN 10 ? CD ? A GLN 10 CD 7 1 Y 1 A GLN 10 ? OE1 ? A GLN 10 OE1 8 1 Y 1 A GLN 10 ? NE2 ? A GLN 10 NE2 9 1 Y 1 A VAL 11 ? CG1 ? A VAL 11 CG1 10 1 Y 1 A VAL 11 ? CG2 ? A VAL 11 CG2 11 1 Y 1 A LYS 13 ? CG ? A LYS 13 CG 12 1 Y 1 A LYS 13 ? CD ? A LYS 13 CD 13 1 Y 1 A LYS 13 ? CE ? A LYS 13 CE 14 1 Y 1 A LYS 13 ? NZ ? A LYS 13 NZ 15 1 Y 1 A SER 18 ? OG ? A SER 18 OG 16 1 Y 1 A GLN 45 ? CG ? A GLN 45 CG 17 1 Y 1 A GLN 45 ? CD ? A GLN 45 CD 18 1 Y 1 A GLN 45 ? OE1 ? A GLN 45 OE1 19 1 Y 1 A GLN 45 ? NE2 ? A GLN 45 NE2 20 1 Y 1 A GLN 46 ? CG ? A GLN 46 CG 21 1 Y 1 A GLN 46 ? CD ? A GLN 46 CD 22 1 Y 1 A GLN 46 ? OE1 ? A GLN 46 OE1 23 1 Y 1 A GLN 46 ? NE2 ? A GLN 46 NE2 24 1 Y 1 A LYS 52 ? CG ? A LYS 52 CG 25 1 Y 1 A LYS 52 ? CD ? A LYS 52 CD 26 1 Y 1 A LYS 52 ? CE ? A LYS 52 CE 27 1 Y 1 A LYS 52 ? NZ ? A LYS 52 NZ 28 1 Y 1 A ARG 97 ? CG ? A ARG 97 CG 29 1 Y 1 A ARG 97 ? CD ? A ARG 97 CD 30 1 Y 1 A ARG 97 ? NE ? A ARG 97 NE 31 1 Y 1 A ARG 97 ? CZ ? A ARG 97 CZ 32 1 Y 1 A ARG 97 ? NH1 ? A ARG 97 NH1 33 1 Y 1 A ARG 97 ? NH2 ? A ARG 97 NH2 34 1 Y 1 A LYS 98 ? CG ? A LYS 98 CG 35 1 Y 1 A LYS 98 ? CD ? A LYS 98 CD 36 1 Y 1 A LYS 98 ? CE ? A LYS 98 CE 37 1 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 38 1 Y 1 A GLN 160 ? CG ? A GLN 160 CG 39 1 Y 1 A GLN 160 ? CD ? A GLN 160 CD 40 1 Y 1 A GLN 160 ? OE1 ? A GLN 160 OE1 41 1 Y 1 A GLN 160 ? NE2 ? A GLN 160 NE2 42 1 Y 1 A GLN 162 ? CG ? A GLN 162 CG 43 1 Y 1 A GLN 162 ? CD ? A GLN 162 CD 44 1 Y 1 A GLN 162 ? OE1 ? A GLN 162 OE1 45 1 Y 1 A GLN 162 ? NE2 ? A GLN 162 NE2 46 1 Y 1 A VAL 164 ? CG1 ? A VAL 164 CG1 47 1 Y 1 A VAL 164 ? CG2 ? A VAL 164 CG2 48 1 Y 1 A LYS 165 ? CG ? A LYS 165 CG 49 1 Y 1 A LYS 165 ? CD ? A LYS 165 CD 50 1 Y 1 A LYS 165 ? CE ? A LYS 165 CE 51 1 Y 1 A LYS 165 ? NZ ? A LYS 165 NZ 52 1 Y 1 A SER 166 ? OG ? A SER 166 OG 53 1 Y 1 A LEU 167 ? CG ? A LEU 167 CG 54 1 Y 1 A LEU 167 ? CD1 ? A LEU 167 CD1 55 1 Y 1 A LEU 167 ? CD2 ? A LEU 167 CD2 56 1 Y 1 A ASP 168 ? CG ? A ASP 168 CG 57 1 Y 1 A ASP 168 ? OD1 ? A ASP 168 OD1 58 1 Y 1 A ASP 168 ? OD2 ? A ASP 168 OD2 59 1 Y 1 A TYR 176 ? CG ? A TYR 176 CG 60 1 Y 1 A TYR 176 ? CD1 ? A TYR 176 CD1 61 1 Y 1 A TYR 176 ? CD2 ? A TYR 176 CD2 62 1 Y 1 A TYR 176 ? CE1 ? A TYR 176 CE1 63 1 Y 1 A TYR 176 ? CE2 ? A TYR 176 CE2 64 1 Y 1 A TYR 176 ? CZ ? A TYR 176 CZ 65 1 Y 1 A TYR 176 ? OH ? A TYR 176 OH 66 1 Y 1 A LYS 181 ? CG ? A LYS 181 CG 67 1 Y 1 A LYS 181 ? CD ? A LYS 181 CD 68 1 Y 1 A LYS 181 ? CE ? A LYS 181 CE 69 1 Y 1 A LYS 181 ? NZ ? A LYS 181 NZ # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1DSB _pdbx_initial_refinement_model.details 'PDB ENTRY 1DSB' #