data_1BIP # _entry.id 1BIP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1BIP WWPDB D_1000171804 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BIP _pdbx_database_status.recvd_initial_deposition_date 1995-03-31 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Strobl, S.' 1 'Muehlhahn, P.' 2 'Holak, T.' 3 # _citation.id primary _citation.title ;Determination of the three-dimensional structure of the bifunctional alpha-amylase/trypsin inhibitor from ragi seeds by NMR spectroscopy. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 34 _citation.page_first 8281 _citation.page_last 8293 _citation.year 1995 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 7599120 _citation.pdbx_database_id_DOI 10.1021/bi00026a009 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Strobl, S.' 1 primary 'Muhlhahn, P.' 2 primary 'Bernstein, R.' 3 primary 'Wiltscheck, R.' 4 primary 'Maskos, K.' 5 primary 'Wunderlich, M.' 6 primary 'Huber, R.' 7 primary 'Glockshuber, R.' 8 primary 'Holak, T.A.' 9 # _cell.entry_id 1BIP _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BIP _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ALPHA-AMYLASE/TRYPSIN INHIBITOR' _entity.formula_weight 13143.276 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SVGTSCIPGMAIPHNPLDSCRWYVSTRTCGVGPRLATQEMKARCCRQLEAIPAYCRCEAVRILMDGVVTSSGQHEGRLLQ DLPGCPRQVQRAFAPKLVTEVECNLATIHGGPFCLSLLGAGE ; _entity_poly.pdbx_seq_one_letter_code_can ;SVGTSCIPGMAIPHNPLDSCRWYVSTRTCGVGPRLATQEMKARCCRQLEAIPAYCRCEAVRILMDGVVTSSGQHEGRLLQ DLPGCPRQVQRAFAPKLVTEVECNLATIHGGPFCLSLLGAGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 VAL n 1 3 GLY n 1 4 THR n 1 5 SER n 1 6 CYS n 1 7 ILE n 1 8 PRO n 1 9 GLY n 1 10 MET n 1 11 ALA n 1 12 ILE n 1 13 PRO n 1 14 HIS n 1 15 ASN n 1 16 PRO n 1 17 LEU n 1 18 ASP n 1 19 SER n 1 20 CYS n 1 21 ARG n 1 22 TRP n 1 23 TYR n 1 24 VAL n 1 25 SER n 1 26 THR n 1 27 ARG n 1 28 THR n 1 29 CYS n 1 30 GLY n 1 31 VAL n 1 32 GLY n 1 33 PRO n 1 34 ARG n 1 35 LEU n 1 36 ALA n 1 37 THR n 1 38 GLN n 1 39 GLU n 1 40 MET n 1 41 LYS n 1 42 ALA n 1 43 ARG n 1 44 CYS n 1 45 CYS n 1 46 ARG n 1 47 GLN n 1 48 LEU n 1 49 GLU n 1 50 ALA n 1 51 ILE n 1 52 PRO n 1 53 ALA n 1 54 TYR n 1 55 CYS n 1 56 ARG n 1 57 CYS n 1 58 GLU n 1 59 ALA n 1 60 VAL n 1 61 ARG n 1 62 ILE n 1 63 LEU n 1 64 MET n 1 65 ASP n 1 66 GLY n 1 67 VAL n 1 68 VAL n 1 69 THR n 1 70 SER n 1 71 SER n 1 72 GLY n 1 73 GLN n 1 74 HIS n 1 75 GLU n 1 76 GLY n 1 77 ARG n 1 78 LEU n 1 79 LEU n 1 80 GLN n 1 81 ASP n 1 82 LEU n 1 83 PRO n 1 84 GLY n 1 85 CYS n 1 86 PRO n 1 87 ARG n 1 88 GLN n 1 89 VAL n 1 90 GLN n 1 91 ARG n 1 92 ALA n 1 93 PHE n 1 94 ALA n 1 95 PRO n 1 96 LYS n 1 97 LEU n 1 98 VAL n 1 99 THR n 1 100 GLU n 1 101 VAL n 1 102 GLU n 1 103 CYS n 1 104 ASN n 1 105 LEU n 1 106 ALA n 1 107 THR n 1 108 ILE n 1 109 HIS n 1 110 GLY n 1 111 GLY n 1 112 PRO n 1 113 PHE n 1 114 CYS n 1 115 LEU n 1 116 SER n 1 117 LEU n 1 118 LEU n 1 119 GLY n 1 120 ALA n 1 121 GLY n 1 122 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'finger millet' _entity_src_gen.gene_src_genus Eleusine _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Eleusine coracana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4511 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ SEED _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PRBI-PDI _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IAAT_ELECO _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01087 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;SVGTSCIPGMAIPHNPLDSCRWYVSTRTCGVGPRLATQEMKARCCRQLEAIPAYCRCEAVRILMDGVVTPSGQHEGRLLQ DLPGCPRQVQRAFAPKLVTEVECNLATIHGGPFCLSLLGAGE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BIP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01087 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 122 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 122 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1BIP _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 70 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01087 _struct_ref_seq_dif.db_mon_id PRO _struct_ref_seq_dif.pdbx_seq_db_seq_num 70 _struct_ref_seq_dif.details CONFLICT _struct_ref_seq_dif.pdbx_auth_seq_num 70 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1BIP _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1BIP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BIP _struct.title 'BIFUNCTIONAL PROTEINASE INHIBITOR TRYPSIN/A-AMYLASE FROM SEEDS OF RAGI (ELEUSINE CORACANA GAERTNERI)' _struct.pdbx_descriptor 'BIFUNCTIONAL TRYPSIN/ALPHA-AMYLASE INHIBITOR (RBI) (NMR, 20 STRUCTURES)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BIP _struct_keywords.pdbx_keywords 'SERINE PROTEINASE INHIBITOR' _struct_keywords.text 'SERINE PROTEINASE INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ASP A 18 ? CYS A 29 ? ASP A 18 CYS A 29 1 ? 12 HELX_P HELX_P2 H2 THR A 37 ? ILE A 51 ? THR A 37 ILE A 51 1 ? 15 HELX_P HELX_P3 H3 GLU A 58 ? ASP A 65 ? GLU A 58 ASP A 65 1 ? 8 HELX_P HELX_P4 H4 ARG A 87 ? ALA A 94 ? ARG A 87 ALA A 94 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 6 A CYS 55 1_555 ? ? ? ? ? ? ? 2.018 ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 20 A CYS 44 1_555 ? ? ? ? ? ? ? 2.025 ? disulf3 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 85 SG ? ? A CYS 29 A CYS 85 1_555 ? ? ? ? ? ? ? 2.014 ? disulf4 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 103 SG ? ? A CYS 45 A CYS 103 1_555 ? ? ? ? ? ? ? 2.025 ? disulf5 disulf ? ? A CYS 57 SG ? ? ? 1_555 A CYS 114 SG ? ? A CYS 57 A CYS 114 1_555 ? ? ? ? ? ? ? 2.021 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id S1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 VAL A 67 ? THR A 69 ? VAL A 67 THR A 69 S1 2 GLN A 73 ? GLU A 75 ? GLN A 73 GLU A 75 # _pdbx_struct_sheet_hbond.sheet_id S1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 69 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 69 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 73 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 73 # _struct_site.id BND _struct_site.pdbx_evidence_code Unknown _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details ? # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 BND 6 GLY A 32 ? GLY A 32 . ? 1_555 ? 2 BND 6 PRO A 33 ? PRO A 33 . ? 1_555 ? 3 BND 6 ARG A 34 ? ARG A 34 . ? 1_555 ? 4 BND 6 LEU A 35 ? LEU A 35 . ? 1_555 ? 5 BND 6 ALA A 36 ? ALA A 36 . ? 1_555 ? 6 BND 6 THR A 37 ? THR A 37 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BIP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BIP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 PRO 86 86 86 PRO PRO A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 CYS 114 114 114 CYS CYS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 GLU 122 122 122 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-07-10 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? -133.38 -90.85 2 1 SER A 5 ? ? -56.06 171.64 3 1 CYS A 6 ? ? 64.39 118.79 4 1 PRO A 8 ? ? -77.84 -96.03 5 1 ALA A 11 ? ? 84.35 -47.59 6 1 THR A 28 ? ? -97.05 -62.84 7 1 ARG A 56 ? ? -50.22 -93.19 8 1 CYS A 57 ? ? -31.63 -36.29 9 1 LEU A 79 ? ? -58.72 92.48 10 1 LEU A 97 ? ? -74.13 -75.89 11 1 VAL A 98 ? ? -64.56 1.18 12 1 GLU A 102 ? ? -140.25 -83.01 13 1 CYS A 103 ? ? -146.28 42.28 14 1 LEU A 105 ? ? 45.92 25.06 15 1 ALA A 106 ? ? 64.02 141.73 16 1 THR A 107 ? ? -112.50 -161.80 17 1 PHE A 113 ? ? 174.05 161.29 18 1 LEU A 115 ? ? 52.11 -176.88 19 1 SER A 116 ? ? 46.79 24.87 20 1 LEU A 117 ? ? -63.59 -155.56 21 2 THR A 4 ? ? -151.32 52.27 22 2 SER A 5 ? ? -58.38 -170.39 23 2 ALA A 11 ? ? 87.20 -57.11 24 2 THR A 28 ? ? -93.77 -61.09 25 2 TYR A 54 ? ? -45.67 -71.90 26 2 ARG A 56 ? ? -40.38 -83.44 27 2 CYS A 57 ? ? -32.28 -35.88 28 2 LEU A 79 ? ? -61.04 92.90 29 2 PRO A 83 ? ? -68.60 99.81 30 2 LYS A 96 ? ? 164.62 57.28 31 2 GLU A 102 ? ? -133.71 -90.50 32 2 CYS A 103 ? ? -143.63 37.98 33 2 ALA A 106 ? ? 63.23 124.08 34 2 PHE A 113 ? ? 173.99 149.75 35 2 LEU A 115 ? ? 53.32 178.84 36 2 SER A 116 ? ? 58.68 19.09 37 2 LEU A 117 ? ? -62.26 -97.81 38 3 ALA A 11 ? ? 85.72 -56.94 39 3 ASN A 15 ? ? 63.36 61.94 40 3 THR A 28 ? ? -97.23 -64.11 41 3 ARG A 56 ? ? -49.21 -85.23 42 3 LEU A 79 ? ? -57.26 91.99 43 3 PRO A 83 ? ? -66.75 99.40 44 3 PRO A 95 ? ? -70.98 -164.10 45 3 GLU A 100 ? ? -59.06 -4.16 46 3 GLU A 102 ? ? -140.82 -89.39 47 3 CYS A 103 ? ? -145.02 42.38 48 3 LEU A 105 ? ? 46.30 27.76 49 3 ALA A 106 ? ? 70.34 150.34 50 3 THR A 107 ? ? -123.16 -163.78 51 3 PHE A 113 ? ? 174.04 169.16 52 3 CYS A 114 ? ? -178.19 137.08 53 3 LEU A 117 ? ? -49.63 -80.17 54 3 ALA A 120 ? ? -153.13 70.80 55 4 VAL A 2 ? ? -90.90 31.86 56 4 SER A 5 ? ? 59.12 -159.28 57 4 CYS A 6 ? ? 67.64 130.60 58 4 ALA A 11 ? ? 86.77 -56.43 59 4 THR A 28 ? ? -95.66 -63.86 60 4 ARG A 56 ? ? -49.58 -91.38 61 4 CYS A 57 ? ? -32.28 -33.95 62 4 LEU A 79 ? ? -67.46 90.65 63 4 GLU A 102 ? ? -141.09 -91.48 64 4 CYS A 103 ? ? -142.74 45.46 65 4 ALA A 106 ? ? 68.52 163.26 66 4 THR A 107 ? ? -135.92 -159.94 67 4 PHE A 113 ? ? 176.62 -173.01 68 4 CYS A 114 ? ? 160.60 -174.91 69 4 LEU A 115 ? ? 70.48 -83.73 70 4 LEU A 117 ? ? 66.05 -87.40 71 4 ALA A 120 ? ? 60.46 72.85 72 5 VAL A 2 ? ? -72.16 -77.08 73 5 CYS A 6 ? ? 60.30 161.87 74 5 ALA A 11 ? ? 87.04 -59.93 75 5 THR A 28 ? ? -97.30 -63.84 76 5 ARG A 34 ? ? -92.21 52.31 77 5 ILE A 51 ? ? -58.73 103.92 78 5 ALA A 53 ? ? -22.82 -46.19 79 5 ARG A 56 ? ? -44.72 -93.08 80 5 CYS A 57 ? ? -38.94 -22.35 81 5 LEU A 79 ? ? -52.86 95.37 82 5 PRO A 83 ? ? -66.61 99.21 83 5 LEU A 97 ? ? -73.89 -71.27 84 5 GLU A 100 ? ? -59.13 -3.98 85 5 GLU A 102 ? ? -140.23 -86.97 86 5 CYS A 103 ? ? -146.70 43.83 87 5 LEU A 105 ? ? 40.80 29.84 88 5 ALA A 106 ? ? 65.50 155.41 89 5 THR A 107 ? ? -127.88 -160.22 90 5 PHE A 113 ? ? 173.96 163.71 91 5 LEU A 115 ? ? 67.19 -82.91 92 5 SER A 116 ? ? -46.08 -86.48 93 5 LEU A 117 ? ? 56.13 -95.20 94 5 ALA A 120 ? ? -108.61 66.15 95 6 VAL A 2 ? ? -64.83 -71.86 96 6 THR A 4 ? ? -172.64 77.29 97 6 SER A 5 ? ? 61.88 171.73 98 6 CYS A 6 ? ? 58.88 104.01 99 6 ALA A 11 ? ? 86.79 -56.01 100 6 ASN A 15 ? ? 60.68 60.24 101 6 THR A 28 ? ? -97.67 -63.32 102 6 ARG A 56 ? ? -44.93 -83.37 103 6 LEU A 79 ? ? -62.14 95.55 104 6 ASP A 81 ? ? -50.96 107.86 105 6 PRO A 83 ? ? -64.62 99.79 106 6 PRO A 95 ? ? -72.59 -167.24 107 6 GLU A 102 ? ? -138.12 -89.65 108 6 CYS A 103 ? ? -144.92 39.50 109 6 ALA A 106 ? ? 66.58 150.09 110 6 THR A 107 ? ? -119.58 -159.86 111 6 PHE A 113 ? ? 175.39 155.38 112 6 LEU A 115 ? ? 56.36 -177.47 113 6 SER A 116 ? ? 57.19 -89.97 114 6 LEU A 117 ? ? 55.37 -88.80 115 6 ALA A 120 ? ? -96.16 53.50 116 7 VAL A 2 ? ? -54.48 -99.65 117 7 SER A 5 ? ? 42.91 -166.13 118 7 ILE A 7 ? ? -42.64 101.96 119 7 ALA A 11 ? ? 86.09 -58.14 120 7 ASN A 15 ? ? 67.20 63.95 121 7 LEU A 17 ? ? 33.13 47.03 122 7 THR A 28 ? ? -93.00 -67.53 123 7 ILE A 51 ? ? -58.81 106.02 124 7 ALA A 53 ? ? -33.84 -36.15 125 7 CYS A 55 ? ? 76.24 -2.46 126 7 ARG A 56 ? ? -40.01 -87.44 127 7 GLU A 58 ? ? -25.89 -53.50 128 7 LEU A 79 ? ? -64.46 89.26 129 7 ASP A 81 ? ? -39.33 129.35 130 7 PRO A 83 ? ? -66.12 99.38 131 7 LYS A 96 ? ? 159.55 65.35 132 7 LEU A 97 ? ? -109.91 -89.21 133 7 VAL A 98 ? ? -78.74 34.88 134 7 GLU A 100 ? ? -60.59 1.74 135 7 GLU A 102 ? ? -149.93 -98.17 136 7 ASN A 104 ? ? -31.99 -92.17 137 7 LEU A 105 ? ? 66.95 -1.76 138 7 ALA A 106 ? ? 81.08 143.45 139 7 THR A 107 ? ? -114.27 -162.09 140 7 PHE A 113 ? ? 171.77 160.99 141 7 CYS A 114 ? ? -155.73 -155.09 142 7 LEU A 115 ? ? 81.58 -152.23 143 7 SER A 116 ? ? -42.47 -85.52 144 7 LEU A 117 ? ? 53.08 -157.04 145 7 ALA A 120 ? ? -172.92 78.68 146 8 VAL A 2 ? ? -119.56 -111.35 147 8 SER A 5 ? ? -120.99 -160.03 148 8 CYS A 6 ? ? 61.58 -160.96 149 8 ILE A 7 ? ? 71.76 139.79 150 8 ALA A 11 ? ? 86.82 -57.65 151 8 THR A 28 ? ? -93.35 -63.38 152 8 ALA A 53 ? ? -39.48 -29.79 153 8 TYR A 54 ? ? -53.15 -70.47 154 8 ARG A 56 ? ? -47.60 -85.35 155 8 LEU A 79 ? ? -62.11 92.79 156 8 PRO A 83 ? ? -68.60 98.63 157 8 GLU A 102 ? ? -141.07 -89.95 158 8 CYS A 103 ? ? -143.62 43.00 159 8 LEU A 105 ? ? 45.33 29.34 160 8 ALA A 106 ? ? 67.04 157.93 161 8 THR A 107 ? ? -128.82 -163.93 162 8 PHE A 113 ? ? 178.67 156.32 163 8 CYS A 114 ? ? 178.62 158.55 164 8 SER A 116 ? ? -160.74 -69.50 165 8 LEU A 118 ? ? 76.38 -18.69 166 8 ALA A 120 ? ? -97.90 43.98 167 9 THR A 4 ? ? -150.62 58.65 168 9 CYS A 6 ? ? 60.71 139.18 169 9 ALA A 11 ? ? 86.14 -60.58 170 9 ASN A 15 ? ? 60.77 63.95 171 9 THR A 28 ? ? -97.15 -63.06 172 9 ALA A 53 ? ? -37.15 -28.67 173 9 ARG A 56 ? ? -42.42 -87.78 174 9 CYS A 57 ? ? -28.38 -50.71 175 9 LEU A 79 ? ? -45.85 98.62 176 9 PRO A 83 ? ? -65.91 98.88 177 9 PRO A 95 ? ? -72.27 -164.71 178 9 LEU A 97 ? ? -73.77 -71.19 179 9 VAL A 98 ? ? -77.45 22.90 180 9 GLU A 100 ? ? -59.63 -0.31 181 9 GLU A 102 ? ? -145.75 -92.71 182 9 CYS A 103 ? ? -142.13 37.86 183 9 ALA A 106 ? ? 60.28 121.33 184 9 PHE A 113 ? ? 171.77 143.53 185 9 LEU A 115 ? ? 50.88 -174.89 186 9 SER A 116 ? ? 64.12 -103.46 187 9 LEU A 117 ? ? 55.22 -149.90 188 10 VAL A 2 ? ? 85.29 -50.27 189 10 ALA A 11 ? ? 86.73 -58.40 190 10 THR A 28 ? ? -97.00 -61.97 191 10 ARG A 56 ? ? 38.00 -92.96 192 10 ARG A 77 ? ? 56.54 19.84 193 10 LEU A 79 ? ? -61.93 92.88 194 10 ASP A 81 ? ? -51.32 102.01 195 10 PRO A 95 ? ? -77.84 33.15 196 10 LEU A 97 ? ? -73.56 -71.31 197 10 GLU A 102 ? ? -142.25 -91.55 198 10 CYS A 103 ? ? -143.61 42.06 199 10 LEU A 105 ? ? 45.87 23.90 200 10 ALA A 106 ? ? 64.76 123.79 201 10 THR A 107 ? ? -89.89 -159.00 202 10 PHE A 113 ? ? 176.29 154.01 203 10 SER A 116 ? ? -130.20 -89.59 204 10 LEU A 117 ? ? 53.06 -88.53 205 10 ALA A 120 ? ? 57.27 72.42 206 11 ALA A 11 ? ? 86.70 -54.59 207 11 THR A 28 ? ? -95.21 -66.02 208 11 ILE A 51 ? ? -57.12 102.98 209 11 ALA A 53 ? ? -37.19 -32.10 210 11 ARG A 56 ? ? -45.53 -86.52 211 11 CYS A 57 ? ? -38.98 -38.55 212 11 ASP A 81 ? ? -50.43 102.31 213 11 PRO A 95 ? ? -68.61 85.59 214 11 LYS A 96 ? ? -177.80 54.95 215 11 LEU A 97 ? ? -86.27 -81.32 216 11 GLU A 102 ? ? -140.71 -88.07 217 11 CYS A 103 ? ? -143.74 45.56 218 11 LEU A 105 ? ? 43.16 27.27 219 11 ALA A 106 ? ? 63.57 153.66 220 11 THR A 107 ? ? -123.82 -161.18 221 11 PHE A 113 ? ? 173.51 150.80 222 11 LEU A 117 ? ? 81.10 -69.04 223 11 LEU A 118 ? ? 74.09 -17.81 224 11 ALA A 120 ? ? -104.93 47.72 225 12 VAL A 2 ? ? -119.62 -111.09 226 12 SER A 5 ? ? -120.85 -160.01 227 12 CYS A 6 ? ? 61.42 -160.97 228 12 ILE A 7 ? ? 71.91 139.74 229 12 ALA A 11 ? ? 86.73 -57.72 230 12 THR A 28 ? ? -93.65 -62.90 231 12 ALA A 53 ? ? -39.47 -29.76 232 12 TYR A 54 ? ? -53.16 -70.41 233 12 ARG A 56 ? ? -47.58 -85.20 234 12 LEU A 79 ? ? -62.00 92.79 235 12 PRO A 83 ? ? -68.63 98.69 236 12 GLU A 102 ? ? -141.13 -89.97 237 12 CYS A 103 ? ? -143.67 43.08 238 12 LEU A 105 ? ? 45.34 29.39 239 12 ALA A 106 ? ? 67.09 157.98 240 12 THR A 107 ? ? -128.87 -163.92 241 12 PHE A 113 ? ? 178.72 156.30 242 12 CYS A 114 ? ? 178.61 158.61 243 12 SER A 116 ? ? -160.66 -69.31 244 12 LEU A 118 ? ? 76.31 -18.73 245 12 ALA A 120 ? ? -97.94 43.88 246 13 VAL A 2 ? ? -108.13 -95.31 247 13 CYS A 6 ? ? 56.52 102.98 248 13 ALA A 11 ? ? 86.17 -54.09 249 13 THR A 28 ? ? -96.23 -64.38 250 13 ARG A 56 ? ? -49.11 -87.14 251 13 LEU A 79 ? ? -59.34 91.64 252 13 PRO A 83 ? ? -69.58 99.19 253 13 GLU A 100 ? ? -62.60 0.46 254 13 GLU A 102 ? ? -138.46 -88.81 255 13 CYS A 103 ? ? -141.44 42.03 256 13 LEU A 105 ? ? 48.18 26.99 257 13 ALA A 106 ? ? 63.91 154.66 258 13 THR A 107 ? ? -124.51 -151.82 259 13 PHE A 113 ? ? 176.96 88.94 260 13 LEU A 115 ? ? 74.25 109.64 261 13 SER A 116 ? ? 82.56 -69.49 262 13 LEU A 117 ? ? 68.52 -156.81 263 13 ALA A 120 ? ? -108.93 66.68 264 14 VAL A 2 ? ? 173.09 -84.68 265 14 THR A 4 ? ? -175.23 64.08 266 14 SER A 5 ? ? -108.38 -152.74 267 14 ALA A 11 ? ? 85.32 -62.22 268 14 THR A 28 ? ? -92.87 -67.10 269 14 ALA A 36 ? ? -45.95 158.28 270 14 CYS A 55 ? ? -116.43 -73.34 271 14 ARG A 56 ? ? 31.71 -98.89 272 14 ARG A 77 ? ? 56.20 17.77 273 14 LEU A 79 ? ? -47.71 99.32 274 14 PRO A 95 ? ? -73.66 24.00 275 14 LEU A 97 ? ? -80.12 -77.77 276 14 VAL A 98 ? ? -79.81 27.89 277 14 GLU A 100 ? ? -60.39 1.33 278 14 GLU A 102 ? ? -140.17 -94.29 279 14 ASN A 104 ? ? -29.52 -66.02 280 14 ALA A 106 ? ? 55.23 165.60 281 14 THR A 107 ? ? -133.79 -146.08 282 14 PHE A 113 ? ? 173.01 96.80 283 14 LEU A 115 ? ? 84.95 -46.35 284 14 LEU A 118 ? ? 69.52 -15.40 285 14 ALA A 120 ? ? -105.08 71.40 286 15 THR A 4 ? ? 40.73 29.42 287 15 SER A 5 ? ? 49.66 -176.03 288 15 CYS A 6 ? ? 59.17 99.62 289 15 ALA A 11 ? ? 85.61 -59.05 290 15 THR A 28 ? ? -96.83 -60.84 291 15 ALA A 36 ? ? -41.05 160.32 292 15 ALA A 53 ? ? -32.54 -33.76 293 15 ARG A 56 ? ? -41.41 -87.28 294 15 CYS A 57 ? ? -24.90 -49.51 295 15 GLU A 58 ? ? -25.73 -49.90 296 15 ARG A 77 ? ? 56.70 15.90 297 15 LEU A 79 ? ? -43.03 96.22 298 15 LYS A 96 ? ? 176.44 56.51 299 15 LEU A 97 ? ? -96.27 -82.17 300 15 GLU A 100 ? ? -58.79 -2.05 301 15 GLU A 102 ? ? -141.52 -91.17 302 15 CYS A 103 ? ? -142.89 38.58 303 15 LEU A 105 ? ? 40.55 26.94 304 15 ALA A 106 ? ? 62.25 153.85 305 15 PHE A 113 ? ? 173.00 159.96 306 15 LEU A 115 ? ? 173.56 -69.73 307 15 SER A 116 ? ? -170.91 -79.28 308 15 LEU A 117 ? ? 49.81 20.37 309 15 LEU A 118 ? ? 66.51 -11.77 310 15 ALA A 120 ? ? 43.22 73.01 311 16 VAL A 2 ? ? -150.55 -88.88 312 16 THR A 4 ? ? -177.47 69.39 313 16 CYS A 6 ? ? 52.38 -168.97 314 16 ALA A 11 ? ? 86.39 -57.22 315 16 ASN A 15 ? ? 65.04 64.14 316 16 THR A 28 ? ? -97.74 -65.83 317 16 CYS A 55 ? ? 86.39 -15.36 318 16 ARG A 56 ? ? -45.75 -81.94 319 16 CYS A 57 ? ? -24.50 -42.88 320 16 ARG A 77 ? ? 59.17 17.60 321 16 LEU A 79 ? ? -51.93 98.56 322 16 PRO A 83 ? ? -65.30 99.97 323 16 GLU A 102 ? ? -146.95 -90.79 324 16 ASN A 104 ? ? -43.60 -72.68 325 16 ALA A 106 ? ? 63.55 148.22 326 16 THR A 107 ? ? -121.16 -164.41 327 16 PHE A 113 ? ? 174.53 165.29 328 16 CYS A 114 ? ? 176.03 165.55 329 16 LEU A 115 ? ? 75.61 -78.36 330 16 SER A 116 ? ? -54.20 -89.44 331 16 LEU A 117 ? ? 51.61 -88.57 332 17 VAL A 2 ? ? 85.07 -35.13 333 17 SER A 5 ? ? -104.86 -169.03 334 17 ALA A 11 ? ? 87.04 -58.69 335 17 ASN A 15 ? ? 68.14 64.48 336 17 THR A 28 ? ? -95.93 -63.21 337 17 ALA A 36 ? ? -49.88 159.38 338 17 ALA A 53 ? ? -36.49 -32.69 339 17 CYS A 55 ? ? 77.23 -1.04 340 17 ARG A 56 ? ? -57.84 -91.56 341 17 CYS A 57 ? ? -27.51 -42.36 342 17 LEU A 79 ? ? -61.23 93.24 343 17 PRO A 83 ? ? -68.74 99.75 344 17 VAL A 98 ? ? -82.94 35.06 345 17 GLU A 100 ? ? -59.66 -2.46 346 17 GLU A 102 ? ? -148.02 -91.96 347 17 ASN A 104 ? ? -42.23 -82.29 348 17 ALA A 106 ? ? 71.07 152.27 349 17 THR A 107 ? ? -127.85 -163.84 350 17 PHE A 113 ? ? 175.68 -160.03 351 17 LEU A 115 ? ? -37.77 179.38 352 17 SER A 116 ? ? 77.72 41.83 353 17 ALA A 120 ? ? 59.85 71.61 354 18 VAL A 2 ? ? -91.40 31.91 355 18 THR A 4 ? ? -176.12 78.37 356 18 SER A 5 ? ? 61.30 176.81 357 18 ALA A 11 ? ? 86.87 -57.46 358 18 ASN A 15 ? ? 70.46 48.12 359 18 THR A 28 ? ? -92.75 -66.58 360 18 ALA A 53 ? ? -32.63 -32.42 361 18 ARG A 56 ? ? -48.68 -89.06 362 18 ARG A 77 ? ? 44.18 28.61 363 18 LEU A 79 ? ? -49.21 105.27 364 18 PRO A 95 ? ? -73.77 25.46 365 18 LEU A 97 ? ? -74.58 -75.27 366 18 GLU A 100 ? ? -65.09 5.35 367 18 GLU A 102 ? ? -142.07 -85.46 368 18 ASN A 104 ? ? -44.95 -95.76 369 18 LEU A 105 ? ? 87.19 -58.41 370 18 ALA A 106 ? ? 160.95 127.68 371 18 THR A 107 ? ? -91.59 -146.62 372 18 PHE A 113 ? ? 175.66 89.71 373 18 SER A 116 ? ? -163.84 -135.88 374 18 LEU A 117 ? ? 67.35 -119.52 375 18 LEU A 118 ? ? 70.26 -17.02 376 18 ALA A 120 ? ? -129.57 -139.18 377 19 VAL A 2 ? ? 83.59 -60.77 378 19 THR A 4 ? ? -89.25 38.60 379 19 SER A 5 ? ? -46.50 164.63 380 19 CYS A 6 ? ? 59.19 109.82 381 19 ALA A 11 ? ? 86.01 -59.68 382 19 THR A 28 ? ? -95.61 -64.44 383 19 ALA A 36 ? ? -46.55 155.40 384 19 ALA A 53 ? ? -31.29 -35.18 385 19 ARG A 56 ? ? -43.19 -90.24 386 19 CYS A 57 ? ? -21.47 -55.13 387 19 ALA A 59 ? ? -29.05 -56.38 388 19 ARG A 77 ? ? 58.93 16.90 389 19 LEU A 79 ? ? -47.41 94.91 390 19 VAL A 98 ? ? -79.35 26.57 391 19 GLU A 100 ? ? -58.81 -0.93 392 19 GLU A 102 ? ? -145.57 -90.49 393 19 CYS A 103 ? ? -145.22 40.85 394 19 ASN A 104 ? ? -33.28 -89.47 395 19 LEU A 105 ? ? 85.30 -66.87 396 19 ALA A 106 ? ? 155.97 115.10 397 19 PHE A 113 ? ? 168.38 171.43 398 19 CYS A 114 ? ? -174.54 144.66 399 19 SER A 116 ? ? 172.34 -67.33 400 19 LEU A 118 ? ? 69.37 -14.11 401 20 VAL A 2 ? ? -80.74 -88.82 402 20 THR A 4 ? ? -89.26 39.45 403 20 ALA A 11 ? ? 85.35 -60.89 404 20 THR A 28 ? ? -94.62 -65.68 405 20 ALA A 53 ? ? -34.99 -29.53 406 20 CYS A 55 ? ? 81.63 -0.22 407 20 ARG A 56 ? ? -46.98 -89.90 408 20 LYS A 96 ? ? 74.31 32.71 409 20 LEU A 97 ? ? -74.61 -73.08 410 20 VAL A 98 ? ? -77.62 24.69 411 20 GLU A 100 ? ? -59.74 -1.00 412 20 GLU A 102 ? ? -142.17 -91.29 413 20 CYS A 103 ? ? -145.15 39.56 414 20 LEU A 105 ? ? 44.44 24.75 415 20 ALA A 106 ? ? 60.93 122.78 416 20 PHE A 113 ? ? 172.10 149.73 417 20 LEU A 115 ? ? 162.18 -169.14 418 20 ALA A 120 ? ? -131.46 -130.92 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 21 ? ? 0.254 'SIDE CHAIN' 2 1 ARG A 27 ? ? 0.217 'SIDE CHAIN' 3 1 ARG A 34 ? ? 0.253 'SIDE CHAIN' 4 1 ARG A 43 ? ? 0.249 'SIDE CHAIN' 5 1 ARG A 46 ? ? 0.264 'SIDE CHAIN' 6 1 ARG A 56 ? ? 0.160 'SIDE CHAIN' 7 1 ARG A 61 ? ? 0.268 'SIDE CHAIN' 8 1 ARG A 77 ? ? 0.276 'SIDE CHAIN' 9 1 ARG A 87 ? ? 0.301 'SIDE CHAIN' 10 1 ARG A 91 ? ? 0.312 'SIDE CHAIN' 11 2 ARG A 21 ? ? 0.186 'SIDE CHAIN' 12 2 ARG A 27 ? ? 0.308 'SIDE CHAIN' 13 2 ARG A 34 ? ? 0.266 'SIDE CHAIN' 14 2 ARG A 43 ? ? 0.241 'SIDE CHAIN' 15 2 ARG A 46 ? ? 0.224 'SIDE CHAIN' 16 2 ARG A 56 ? ? 0.236 'SIDE CHAIN' 17 2 ARG A 61 ? ? 0.289 'SIDE CHAIN' 18 2 ARG A 77 ? ? 0.299 'SIDE CHAIN' 19 2 ARG A 87 ? ? 0.318 'SIDE CHAIN' 20 2 ARG A 91 ? ? 0.147 'SIDE CHAIN' 21 3 ARG A 21 ? ? 0.233 'SIDE CHAIN' 22 3 ARG A 27 ? ? 0.197 'SIDE CHAIN' 23 3 ARG A 34 ? ? 0.317 'SIDE CHAIN' 24 3 ARG A 43 ? ? 0.281 'SIDE CHAIN' 25 3 ARG A 46 ? ? 0.230 'SIDE CHAIN' 26 3 ARG A 56 ? ? 0.126 'SIDE CHAIN' 27 3 ARG A 61 ? ? 0.235 'SIDE CHAIN' 28 3 ARG A 77 ? ? 0.245 'SIDE CHAIN' 29 3 ARG A 87 ? ? 0.231 'SIDE CHAIN' 30 3 ARG A 91 ? ? 0.269 'SIDE CHAIN' 31 4 ARG A 21 ? ? 0.311 'SIDE CHAIN' 32 4 ARG A 27 ? ? 0.222 'SIDE CHAIN' 33 4 ARG A 34 ? ? 0.315 'SIDE CHAIN' 34 4 ARG A 43 ? ? 0.300 'SIDE CHAIN' 35 4 ARG A 46 ? ? 0.227 'SIDE CHAIN' 36 4 ARG A 56 ? ? 0.306 'SIDE CHAIN' 37 4 ARG A 61 ? ? 0.259 'SIDE CHAIN' 38 4 ARG A 77 ? ? 0.226 'SIDE CHAIN' 39 4 ARG A 87 ? ? 0.237 'SIDE CHAIN' 40 4 ARG A 91 ? ? 0.249 'SIDE CHAIN' 41 5 ARG A 21 ? ? 0.184 'SIDE CHAIN' 42 5 ARG A 27 ? ? 0.224 'SIDE CHAIN' 43 5 ARG A 34 ? ? 0.222 'SIDE CHAIN' 44 5 ARG A 43 ? ? 0.204 'SIDE CHAIN' 45 5 ARG A 46 ? ? 0.309 'SIDE CHAIN' 46 5 ARG A 61 ? ? 0.317 'SIDE CHAIN' 47 5 ARG A 77 ? ? 0.287 'SIDE CHAIN' 48 5 ARG A 87 ? ? 0.204 'SIDE CHAIN' 49 5 ARG A 91 ? ? 0.222 'SIDE CHAIN' 50 6 ARG A 21 ? ? 0.200 'SIDE CHAIN' 51 6 ARG A 27 ? ? 0.316 'SIDE CHAIN' 52 6 ARG A 34 ? ? 0.310 'SIDE CHAIN' 53 6 ARG A 43 ? ? 0.314 'SIDE CHAIN' 54 6 ARG A 46 ? ? 0.227 'SIDE CHAIN' 55 6 ARG A 56 ? ? 0.228 'SIDE CHAIN' 56 6 ARG A 61 ? ? 0.306 'SIDE CHAIN' 57 6 ARG A 77 ? ? 0.264 'SIDE CHAIN' 58 6 ARG A 87 ? ? 0.308 'SIDE CHAIN' 59 6 ARG A 91 ? ? 0.213 'SIDE CHAIN' 60 7 ARG A 27 ? ? 0.190 'SIDE CHAIN' 61 7 ARG A 34 ? ? 0.307 'SIDE CHAIN' 62 7 ARG A 43 ? ? 0.250 'SIDE CHAIN' 63 7 ARG A 46 ? ? 0.234 'SIDE CHAIN' 64 7 ARG A 56 ? ? 0.177 'SIDE CHAIN' 65 7 ARG A 61 ? ? 0.297 'SIDE CHAIN' 66 7 ARG A 77 ? ? 0.292 'SIDE CHAIN' 67 7 ARG A 87 ? ? 0.276 'SIDE CHAIN' 68 7 ARG A 91 ? ? 0.191 'SIDE CHAIN' 69 8 ARG A 21 ? ? 0.315 'SIDE CHAIN' 70 8 ARG A 27 ? ? 0.300 'SIDE CHAIN' 71 8 ARG A 34 ? ? 0.315 'SIDE CHAIN' 72 8 ARG A 43 ? ? 0.269 'SIDE CHAIN' 73 8 ARG A 46 ? ? 0.311 'SIDE CHAIN' 74 8 ARG A 56 ? ? 0.118 'SIDE CHAIN' 75 8 ARG A 61 ? ? 0.306 'SIDE CHAIN' 76 8 ARG A 77 ? ? 0.317 'SIDE CHAIN' 77 8 ARG A 87 ? ? 0.274 'SIDE CHAIN' 78 8 ARG A 91 ? ? 0.226 'SIDE CHAIN' 79 9 ARG A 21 ? ? 0.176 'SIDE CHAIN' 80 9 ARG A 27 ? ? 0.317 'SIDE CHAIN' 81 9 ARG A 34 ? ? 0.210 'SIDE CHAIN' 82 9 ARG A 43 ? ? 0.317 'SIDE CHAIN' 83 9 ARG A 46 ? ? 0.197 'SIDE CHAIN' 84 9 ARG A 56 ? ? 0.307 'SIDE CHAIN' 85 9 ARG A 61 ? ? 0.245 'SIDE CHAIN' 86 9 ARG A 77 ? ? 0.314 'SIDE CHAIN' 87 9 ARG A 87 ? ? 0.093 'SIDE CHAIN' 88 9 ARG A 91 ? ? 0.314 'SIDE CHAIN' 89 10 ARG A 27 ? ? 0.177 'SIDE CHAIN' 90 10 ARG A 34 ? ? 0.242 'SIDE CHAIN' 91 10 ARG A 43 ? ? 0.318 'SIDE CHAIN' 92 10 ARG A 46 ? ? 0.304 'SIDE CHAIN' 93 10 ARG A 56 ? ? 0.258 'SIDE CHAIN' 94 10 ARG A 61 ? ? 0.215 'SIDE CHAIN' 95 10 ARG A 77 ? ? 0.232 'SIDE CHAIN' 96 10 ARG A 87 ? ? 0.300 'SIDE CHAIN' 97 10 ARG A 91 ? ? 0.306 'SIDE CHAIN' 98 11 ARG A 21 ? ? 0.192 'SIDE CHAIN' 99 11 ARG A 27 ? ? 0.258 'SIDE CHAIN' 100 11 ARG A 34 ? ? 0.263 'SIDE CHAIN' 101 11 ARG A 43 ? ? 0.159 'SIDE CHAIN' 102 11 ARG A 46 ? ? 0.301 'SIDE CHAIN' 103 11 ARG A 56 ? ? 0.284 'SIDE CHAIN' 104 11 ARG A 61 ? ? 0.265 'SIDE CHAIN' 105 11 ARG A 77 ? ? 0.218 'SIDE CHAIN' 106 11 ARG A 87 ? ? 0.261 'SIDE CHAIN' 107 11 ARG A 91 ? ? 0.307 'SIDE CHAIN' 108 12 ARG A 21 ? ? 0.315 'SIDE CHAIN' 109 12 ARG A 27 ? ? 0.300 'SIDE CHAIN' 110 12 ARG A 34 ? ? 0.315 'SIDE CHAIN' 111 12 ARG A 43 ? ? 0.269 'SIDE CHAIN' 112 12 ARG A 46 ? ? 0.312 'SIDE CHAIN' 113 12 ARG A 56 ? ? 0.120 'SIDE CHAIN' 114 12 ARG A 61 ? ? 0.306 'SIDE CHAIN' 115 12 ARG A 77 ? ? 0.317 'SIDE CHAIN' 116 12 ARG A 87 ? ? 0.275 'SIDE CHAIN' 117 12 ARG A 91 ? ? 0.227 'SIDE CHAIN' 118 13 ARG A 21 ? ? 0.186 'SIDE CHAIN' 119 13 ARG A 27 ? ? 0.271 'SIDE CHAIN' 120 13 ARG A 34 ? ? 0.318 'SIDE CHAIN' 121 13 ARG A 43 ? ? 0.212 'SIDE CHAIN' 122 13 ARG A 46 ? ? 0.318 'SIDE CHAIN' 123 13 ARG A 56 ? ? 0.253 'SIDE CHAIN' 124 13 ARG A 61 ? ? 0.219 'SIDE CHAIN' 125 13 ARG A 77 ? ? 0.315 'SIDE CHAIN' 126 13 ARG A 87 ? ? 0.200 'SIDE CHAIN' 127 13 ARG A 91 ? ? 0.148 'SIDE CHAIN' 128 14 ARG A 21 ? ? 0.080 'SIDE CHAIN' 129 14 ARG A 27 ? ? 0.304 'SIDE CHAIN' 130 14 ARG A 34 ? ? 0.195 'SIDE CHAIN' 131 14 ARG A 43 ? ? 0.195 'SIDE CHAIN' 132 14 ARG A 46 ? ? 0.308 'SIDE CHAIN' 133 14 ARG A 61 ? ? 0.204 'SIDE CHAIN' 134 14 ARG A 77 ? ? 0.274 'SIDE CHAIN' 135 14 ARG A 87 ? ? 0.277 'SIDE CHAIN' 136 14 ARG A 91 ? ? 0.264 'SIDE CHAIN' 137 15 ARG A 21 ? ? 0.315 'SIDE CHAIN' 138 15 ARG A 27 ? ? 0.190 'SIDE CHAIN' 139 15 ARG A 34 ? ? 0.308 'SIDE CHAIN' 140 15 ARG A 43 ? ? 0.289 'SIDE CHAIN' 141 15 ARG A 46 ? ? 0.191 'SIDE CHAIN' 142 15 ARG A 56 ? ? 0.096 'SIDE CHAIN' 143 15 ARG A 61 ? ? 0.314 'SIDE CHAIN' 144 15 ARG A 77 ? ? 0.103 'SIDE CHAIN' 145 15 ARG A 87 ? ? 0.264 'SIDE CHAIN' 146 15 ARG A 91 ? ? 0.239 'SIDE CHAIN' 147 16 ARG A 21 ? ? 0.195 'SIDE CHAIN' 148 16 ARG A 27 ? ? 0.258 'SIDE CHAIN' 149 16 ARG A 34 ? ? 0.239 'SIDE CHAIN' 150 16 ARG A 43 ? ? 0.240 'SIDE CHAIN' 151 16 ARG A 46 ? ? 0.287 'SIDE CHAIN' 152 16 ARG A 56 ? ? 0.216 'SIDE CHAIN' 153 16 ARG A 61 ? ? 0.303 'SIDE CHAIN' 154 16 ARG A 77 ? ? 0.260 'SIDE CHAIN' 155 16 ARG A 87 ? ? 0.250 'SIDE CHAIN' 156 16 ARG A 91 ? ? 0.095 'SIDE CHAIN' 157 17 ARG A 21 ? ? 0.304 'SIDE CHAIN' 158 17 ARG A 27 ? ? 0.219 'SIDE CHAIN' 159 17 ARG A 34 ? ? 0.316 'SIDE CHAIN' 160 17 ARG A 43 ? ? 0.308 'SIDE CHAIN' 161 17 ARG A 46 ? ? 0.218 'SIDE CHAIN' 162 17 ARG A 56 ? ? 0.204 'SIDE CHAIN' 163 17 ARG A 61 ? ? 0.315 'SIDE CHAIN' 164 17 ARG A 77 ? ? 0.266 'SIDE CHAIN' 165 17 ARG A 87 ? ? 0.267 'SIDE CHAIN' 166 17 ARG A 91 ? ? 0.251 'SIDE CHAIN' 167 18 ARG A 21 ? ? 0.194 'SIDE CHAIN' 168 18 ARG A 27 ? ? 0.276 'SIDE CHAIN' 169 18 ARG A 34 ? ? 0.300 'SIDE CHAIN' 170 18 ARG A 43 ? ? 0.313 'SIDE CHAIN' 171 18 ARG A 46 ? ? 0.219 'SIDE CHAIN' 172 18 ARG A 56 ? ? 0.319 'SIDE CHAIN' 173 18 ARG A 61 ? ? 0.262 'SIDE CHAIN' 174 18 ARG A 77 ? ? 0.236 'SIDE CHAIN' 175 18 ARG A 87 ? ? 0.313 'SIDE CHAIN' 176 18 ARG A 91 ? ? 0.176 'SIDE CHAIN' 177 19 ARG A 21 ? ? 0.317 'SIDE CHAIN' 178 19 ARG A 27 ? ? 0.304 'SIDE CHAIN' 179 19 ARG A 43 ? ? 0.314 'SIDE CHAIN' 180 19 ARG A 46 ? ? 0.119 'SIDE CHAIN' 181 19 ARG A 56 ? ? 0.194 'SIDE CHAIN' 182 19 ARG A 61 ? ? 0.316 'SIDE CHAIN' 183 19 ARG A 77 ? ? 0.269 'SIDE CHAIN' 184 19 ARG A 87 ? ? 0.238 'SIDE CHAIN' 185 19 ARG A 91 ? ? 0.247 'SIDE CHAIN' 186 20 ARG A 21 ? ? 0.304 'SIDE CHAIN' 187 20 ARG A 27 ? ? 0.079 'SIDE CHAIN' 188 20 ARG A 34 ? ? 0.252 'SIDE CHAIN' 189 20 ARG A 43 ? ? 0.305 'SIDE CHAIN' 190 20 ARG A 46 ? ? 0.289 'SIDE CHAIN' 191 20 ARG A 56 ? ? 0.303 'SIDE CHAIN' 192 20 ARG A 61 ? ? 0.278 'SIDE CHAIN' 193 20 ARG A 77 ? ? 0.285 'SIDE CHAIN' 194 20 ARG A 87 ? ? 0.311 'SIDE CHAIN' 195 20 ARG A 91 ? ? 0.252 'SIDE CHAIN' #