data_1BJ9 # _entry.id 1BJ9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BJ9 pdb_00001bj9 10.2210/pdb1bj9/pdb WWPDB D_1000171821 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BJ9 _pdbx_database_status.recvd_initial_deposition_date 1998-07-03 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miller, M.A.' 1 'Kraut, J.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Effect of Unnatural Heme Substitution on Kinetics of Electron Transfer in Cytochrome C Peroxidase' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'X-Ray Structures of Recombinant Yeast Cytochrome C Peroxidase and Three Heme-Cleft Mutants Prepared by Site-Directed Mutagenesis' Biochemistry 29 7160 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 2 'Crystal Structure of Yeast Cytochrome C Peroxidase Refined at 1.7-A Resolution' J.Biol.Chem. 259 13027 ? 1984 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miller, M.A.' 1 ? primary 'Millett, F.' 2 ? primary 'Durham, B.' 3 ? primary 'Wei, H.K.' 4 ? primary 'Ashford, V.A.' 5 ? primary 'Xuong, N.-H.' 6 ? primary 'Kraut, J.' 7 ? 1 'Wang, J.' 8 ? 1 'Mauro, J.M.' 9 ? 1 'Edwards, S.L.' 10 ? 1 'Oatley, S.J.' 11 ? 1 'Fishel, L.A.' 12 ? 1 'Ashford, V.A.' 13 ? 1 'Xuong, N.H.' 14 ? 1 'Kraut, J.' 15 ? 2 'Finzel, B.C.' 16 ? 2 'Poulos, T.L.' 17 ? 2 'Kraut, J.' 18 ? # _cell.entry_id 1BJ9 _cell.length_a 105.197 _cell.length_b 74.364 _cell.length_c 45.402 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BJ9 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME C PEROXIDASE' 33226.922 1 1.11.1.5 'T53I, D152G, N272D' ? ? 2 non-polymer syn '[7,12-DEACETYL-3,8,13,17-TETRAMETHYL-21H,23H-PORPHINE-2,18-DIPROPANOATO(2-)-N21,N22,N23,N24]-IRON' 648.486 1 ? ? ? ? 3 water nat water 18.015 179 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFNDPSNA GLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNM NDREVVALMGAHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPK YLSIVKEYANDQDKFFKDFSKAFEKLLEDGITFPKDAPSPFIFKTLEEQGL ; _entity_poly.pdbx_seq_one_letter_code_can ;LVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFNDPSNA GLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNM NDREVVALMGAHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPK YLSIVKEYANDQDKFFKDFSKAFEKLLEDGITFPKDAPSPFIFKTLEEQGL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 VAL n 1 3 HIS n 1 4 VAL n 1 5 ALA n 1 6 SER n 1 7 VAL n 1 8 GLU n 1 9 LYS n 1 10 GLY n 1 11 ARG n 1 12 SER n 1 13 TYR n 1 14 GLU n 1 15 ASP n 1 16 PHE n 1 17 GLN n 1 18 LYS n 1 19 VAL n 1 20 TYR n 1 21 ASN n 1 22 ALA n 1 23 ILE n 1 24 ALA n 1 25 LEU n 1 26 LYS n 1 27 LEU n 1 28 ARG n 1 29 GLU n 1 30 ASP n 1 31 ASP n 1 32 GLU n 1 33 TYR n 1 34 ASP n 1 35 ASN n 1 36 TYR n 1 37 ILE n 1 38 GLY n 1 39 TYR n 1 40 GLY n 1 41 PRO n 1 42 VAL n 1 43 LEU n 1 44 VAL n 1 45 ARG n 1 46 LEU n 1 47 ALA n 1 48 TRP n 1 49 HIS n 1 50 ILE n 1 51 SER n 1 52 GLY n 1 53 THR n 1 54 TRP n 1 55 ASP n 1 56 LYS n 1 57 HIS n 1 58 ASP n 1 59 ASN n 1 60 THR n 1 61 GLY n 1 62 GLY n 1 63 SER n 1 64 TYR n 1 65 GLY n 1 66 GLY n 1 67 THR n 1 68 TYR n 1 69 ARG n 1 70 PHE n 1 71 LYS n 1 72 LYS n 1 73 GLU n 1 74 PHE n 1 75 ASN n 1 76 ASP n 1 77 PRO n 1 78 SER n 1 79 ASN n 1 80 ALA n 1 81 GLY n 1 82 LEU n 1 83 GLN n 1 84 ASN n 1 85 GLY n 1 86 PHE n 1 87 LYS n 1 88 PHE n 1 89 LEU n 1 90 GLU n 1 91 PRO n 1 92 ILE n 1 93 HIS n 1 94 LYS n 1 95 GLU n 1 96 PHE n 1 97 PRO n 1 98 TRP n 1 99 ILE n 1 100 SER n 1 101 SER n 1 102 GLY n 1 103 ASP n 1 104 LEU n 1 105 PHE n 1 106 SER n 1 107 LEU n 1 108 GLY n 1 109 GLY n 1 110 VAL n 1 111 THR n 1 112 ALA n 1 113 VAL n 1 114 GLN n 1 115 GLU n 1 116 MET n 1 117 GLN n 1 118 GLY n 1 119 PRO n 1 120 LYS n 1 121 ILE n 1 122 PRO n 1 123 TRP n 1 124 ARG n 1 125 CYS n 1 126 GLY n 1 127 ARG n 1 128 VAL n 1 129 ASP n 1 130 THR n 1 131 PRO n 1 132 GLU n 1 133 ASP n 1 134 THR n 1 135 THR n 1 136 PRO n 1 137 ASP n 1 138 ASN n 1 139 GLY n 1 140 ARG n 1 141 LEU n 1 142 PRO n 1 143 ASP n 1 144 ALA n 1 145 ASP n 1 146 LYS n 1 147 ASP n 1 148 ALA n 1 149 GLY n 1 150 TYR n 1 151 VAL n 1 152 ARG n 1 153 THR n 1 154 PHE n 1 155 PHE n 1 156 GLN n 1 157 ARG n 1 158 LEU n 1 159 ASN n 1 160 MET n 1 161 ASN n 1 162 ASP n 1 163 ARG n 1 164 GLU n 1 165 VAL n 1 166 VAL n 1 167 ALA n 1 168 LEU n 1 169 MET n 1 170 GLY n 1 171 ALA n 1 172 HIS n 1 173 ALA n 1 174 LEU n 1 175 GLY n 1 176 LYS n 1 177 THR n 1 178 HIS n 1 179 LEU n 1 180 LYS n 1 181 ASN n 1 182 SER n 1 183 GLY n 1 184 TYR n 1 185 GLU n 1 186 GLY n 1 187 PRO n 1 188 TRP n 1 189 GLY n 1 190 ALA n 1 191 ALA n 1 192 ASN n 1 193 ASN n 1 194 VAL n 1 195 PHE n 1 196 THR n 1 197 ASN n 1 198 GLU n 1 199 PHE n 1 200 TYR n 1 201 LEU n 1 202 ASN n 1 203 LEU n 1 204 LEU n 1 205 ASN n 1 206 GLU n 1 207 ASP n 1 208 TRP n 1 209 LYS n 1 210 LEU n 1 211 GLU n 1 212 LYS n 1 213 ASN n 1 214 ASP n 1 215 ALA n 1 216 ASN n 1 217 ASN n 1 218 GLU n 1 219 GLN n 1 220 TRP n 1 221 ASP n 1 222 SER n 1 223 LYS n 1 224 SER n 1 225 GLY n 1 226 TYR n 1 227 MET n 1 228 MET n 1 229 LEU n 1 230 PRO n 1 231 THR n 1 232 ASP n 1 233 TYR n 1 234 SER n 1 235 LEU n 1 236 ILE n 1 237 GLN n 1 238 ASP n 1 239 PRO n 1 240 LYS n 1 241 TYR n 1 242 LEU n 1 243 SER n 1 244 ILE n 1 245 VAL n 1 246 LYS n 1 247 GLU n 1 248 TYR n 1 249 ALA n 1 250 ASN n 1 251 ASP n 1 252 GLN n 1 253 ASP n 1 254 LYS n 1 255 PHE n 1 256 PHE n 1 257 LYS n 1 258 ASP n 1 259 PHE n 1 260 SER n 1 261 LYS n 1 262 ALA n 1 263 PHE n 1 264 GLU n 1 265 LYS n 1 266 LEU n 1 267 LEU n 1 268 GLU n 1 269 ASP n 1 270 GLY n 1 271 ILE n 1 272 THR n 1 273 PHE n 1 274 PRO n 1 275 LYS n 1 276 ASP n 1 277 ALA n 1 278 PRO n 1 279 SER n 1 280 PRO n 1 281 PHE n 1 282 ILE n 1 283 PHE n 1 284 LYS n 1 285 THR n 1 286 LEU n 1 287 GLU n 1 288 GLU n 1 289 GLN n 1 290 GLY n 1 291 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCPR_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00431 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MTTAVRLLPSLGRTAHKRSLYLFSAAAAAAAAATFAYSQSQKRSSSSPGGGSNHGWNNWGKAAALASTTPLVHVASVEKG RSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLE PIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMG AHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEYAN DQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BJ9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 291 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00431 _struct_ref_seq.db_align_beg 71 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 361 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 294 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1BJ9 ILE A 50 ? UNP P00431 THR 120 'engineered mutation' 53 1 1 1BJ9 GLY A 149 ? UNP P00431 ASP 219 'engineered mutation' 152 2 1 1BJ9 ASP A 269 ? UNP P00431 ASN 339 'engineered mutation' 272 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DDH non-polymer . '[7,12-DEACETYL-3,8,13,17-TETRAMETHYL-21H,23H-PORPHINE-2,18-DIPROPANOATO(2-)-N21,N22,N23,N24]-IRON' DIACETYLDEUTEROHEME 'C34 H32 Fe N4 O6' 648.486 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BJ9 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_percent_sol 54.0 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 6' # _diffrn.id 1 _diffrn.ambient_temp 273 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 1997-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BJ9 _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high 2.2 _reflns.number_obs 24668 _reflns.number_all ? _reflns.percent_possible_obs 98 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.0670000 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.1970000 _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1BJ9 _refine.ls_number_reflns_obs 24668 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.16 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20 _refine.ls_d_res_high 2.2 _refine.ls_percent_reflns_obs 99.4 _refine.ls_R_factor_obs 0.1790000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model 'TNT BCORREL' _refine.pdbx_stereochemistry_target_values 'TNT PROTGEO' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2292 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.number_atoms_solvent 179 _refine_hist.number_atoms_total 2516 _refine_hist.d_res_high 2.2 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? t_angle_deg 2.648 ? ? ? 'X-RAY DIFFRACTION' ? t_dihedral_angle_d 15.918 ? ? ? 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct 0 ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes 0.024 ? ? ? 'X-RAY DIFFRACTION' ? t_gen_planes 0.006 ? ? ? 'X-RAY DIFFRACTION' ? t_it 4.833 ? ? ? 'X-RAY DIFFRACTION' ? t_nbd 0.025 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1BJ9 _struct.title 'EFFECT OF UNNATURAL HEME SUBSTITUTION ON KINETICS OF ELECTRON TRANSFER IN CYTOCHROME C PEROXIDASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BJ9 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'OXIDOREDUCTASE, PEROXIDASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 13 ? GLU A 29 ? TYR A 16 GLU A 32 1 ? 17 HELX_P HELX_P2 2 TYR A 33 ? TYR A 36 ? TYR A 36 TYR A 39 1 ? 4 HELX_P HELX_P3 3 GLY A 40 ? SER A 51 ? GLY A 43 SER A 54 1 ? 12 HELX_P HELX_P4 4 THR A 67 ? ARG A 69 ? THR A 70 ARG A 72 5 ? 3 HELX_P HELX_P5 5 LYS A 71 ? PHE A 74 ? LYS A 74 PHE A 77 1 ? 4 HELX_P HELX_P6 6 PRO A 77 ? ASN A 79 ? PRO A 80 ASN A 82 5 ? 3 HELX_P HELX_P7 7 LEU A 82 ? GLU A 95 ? LEU A 85 GLU A 98 5 ? 14 HELX_P HELX_P8 8 SER A 101 ? GLU A 115 ? SER A 104 GLU A 118 1 ? 15 HELX_P HELX_P9 9 GLU A 132 ? THR A 134 ? GLU A 135 THR A 137 5 ? 3 HELX_P HELX_P10 10 ALA A 148 ? LEU A 158 ? ALA A 151 LEU A 161 1 ? 11 HELX_P HELX_P11 11 ASP A 162 ? ALA A 173 ? ASP A 165 ALA A 176 1 ? 12 HELX_P HELX_P12 12 LEU A 179 ? SER A 182 ? LEU A 182 SER A 185 1 ? 4 HELX_P HELX_P13 13 GLU A 198 ? ASN A 205 ? GLU A 201 ASN A 208 1 ? 8 HELX_P HELX_P14 14 PRO A 230 ? GLN A 237 ? PRO A 233 GLN A 240 1 ? 8 HELX_P HELX_P15 15 PRO A 239 ? ASN A 250 ? PRO A 242 ASN A 253 1 ? 12 HELX_P HELX_P16 16 GLN A 252 ? GLU A 268 ? GLN A 255 GLU A 271 1 ? 17 HELX_P HELX_P17 17 LEU A 286 ? GLN A 289 ? LEU A 289 GLN A 292 1 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 172 NE2 ? ? ? 1_555 B DDH . FE ? ? A HIS 175 A DDH 296 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc2 metalc ? ? B DDH . FE ? ? ? 1_555 C HOH . O ? ? A DDH 296 A HOH 595 1_555 ? ? ? ? ? ? ? 1.992 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 208 ? LYS A 212 ? TRP A 211 LYS A 215 A 2 GLU A 218 ? SER A 222 ? GLU A 221 SER A 225 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 209 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 212 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ASP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 221 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 224 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id DDH _struct_site.pdbx_auth_seq_id 296 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 22 _struct_site.details 'BINDING SITE FOR RESIDUE DDH A 296' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 22 PRO A 41 ? PRO A 44 . ? 1_555 ? 2 AC1 22 VAL A 44 ? VAL A 47 . ? 1_555 ? 3 AC1 22 ARG A 45 ? ARG A 48 . ? 1_555 ? 4 AC1 22 TRP A 48 ? TRP A 51 . ? 1_555 ? 5 AC1 22 PRO A 142 ? PRO A 145 . ? 1_555 ? 6 AC1 22 ASP A 143 ? ASP A 146 . ? 1_555 ? 7 AC1 22 PHE A 155 ? PHE A 158 . ? 1_555 ? 8 AC1 22 LEU A 168 ? LEU A 171 . ? 1_555 ? 9 AC1 22 ALA A 171 ? ALA A 174 . ? 1_555 ? 10 AC1 22 HIS A 172 ? HIS A 175 . ? 1_555 ? 11 AC1 22 LEU A 174 ? LEU A 177 . ? 1_555 ? 12 AC1 22 GLY A 175 ? GLY A 178 . ? 1_555 ? 13 AC1 22 LYS A 176 ? LYS A 179 . ? 1_555 ? 14 AC1 22 THR A 177 ? THR A 180 . ? 1_555 ? 15 AC1 22 HIS A 178 ? HIS A 181 . ? 1_555 ? 16 AC1 22 ASN A 181 ? ASN A 184 . ? 1_555 ? 17 AC1 22 SER A 182 ? SER A 185 . ? 1_555 ? 18 AC1 22 TRP A 188 ? TRP A 191 . ? 1_555 ? 19 AC1 22 HOH C . ? HOH A 348 . ? 1_555 ? 20 AC1 22 HOH C . ? HOH A 595 . ? 1_555 ? 21 AC1 22 HOH C . ? HOH A 895 . ? 1_555 ? 22 AC1 22 HOH C . ? HOH A 896 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BJ9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BJ9 _atom_sites.fract_transf_matrix[1][1] 0.009506 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013447 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022025 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 4 4 LEU LEU A . n A 1 2 VAL 2 5 5 VAL VAL A . n A 1 3 HIS 3 6 6 HIS HIS A . n A 1 4 VAL 4 7 7 VAL VAL A . n A 1 5 ALA 5 8 8 ALA ALA A . n A 1 6 SER 6 9 9 SER SER A . n A 1 7 VAL 7 10 10 VAL VAL A . n A 1 8 GLU 8 11 11 GLU GLU A . n A 1 9 LYS 9 12 12 LYS LYS A . n A 1 10 GLY 10 13 13 GLY GLY A . n A 1 11 ARG 11 14 14 ARG ARG A . n A 1 12 SER 12 15 15 SER SER A . n A 1 13 TYR 13 16 16 TYR TYR A . n A 1 14 GLU 14 17 17 GLU GLU A . n A 1 15 ASP 15 18 18 ASP ASP A . n A 1 16 PHE 16 19 19 PHE PHE A . n A 1 17 GLN 17 20 20 GLN GLN A . n A 1 18 LYS 18 21 21 LYS LYS A . n A 1 19 VAL 19 22 22 VAL VAL A . n A 1 20 TYR 20 23 23 TYR TYR A . n A 1 21 ASN 21 24 24 ASN ASN A . n A 1 22 ALA 22 25 25 ALA ALA A . n A 1 23 ILE 23 26 26 ILE ILE A . n A 1 24 ALA 24 27 27 ALA ALA A . n A 1 25 LEU 25 28 28 LEU LEU A . n A 1 26 LYS 26 29 29 LYS LYS A . n A 1 27 LEU 27 30 30 LEU LEU A . n A 1 28 ARG 28 31 31 ARG ARG A . n A 1 29 GLU 29 32 32 GLU GLU A . n A 1 30 ASP 30 33 33 ASP ASP A . n A 1 31 ASP 31 34 34 ASP ASP A . n A 1 32 GLU 32 35 35 GLU GLU A . n A 1 33 TYR 33 36 36 TYR TYR A . n A 1 34 ASP 34 37 37 ASP ASP A . n A 1 35 ASN 35 38 38 ASN ASN A . n A 1 36 TYR 36 39 39 TYR TYR A . n A 1 37 ILE 37 40 40 ILE ILE A . n A 1 38 GLY 38 41 41 GLY GLY A . n A 1 39 TYR 39 42 42 TYR TYR A . n A 1 40 GLY 40 43 43 GLY GLY A . n A 1 41 PRO 41 44 44 PRO PRO A . n A 1 42 VAL 42 45 45 VAL VAL A . n A 1 43 LEU 43 46 46 LEU LEU A . n A 1 44 VAL 44 47 47 VAL VAL A . n A 1 45 ARG 45 48 48 ARG ARG A . n A 1 46 LEU 46 49 49 LEU LEU A . n A 1 47 ALA 47 50 50 ALA ALA A . n A 1 48 TRP 48 51 51 TRP TRP A . n A 1 49 HIS 49 52 52 HIS HIS A . n A 1 50 ILE 50 53 53 ILE ILE A . n A 1 51 SER 51 54 54 SER SER A . n A 1 52 GLY 52 55 55 GLY GLY A . n A 1 53 THR 53 56 56 THR THR A . n A 1 54 TRP 54 57 57 TRP TRP A . n A 1 55 ASP 55 58 58 ASP ASP A . n A 1 56 LYS 56 59 59 LYS LYS A . n A 1 57 HIS 57 60 60 HIS HIS A . n A 1 58 ASP 58 61 61 ASP ASP A . n A 1 59 ASN 59 62 62 ASN ASN A . n A 1 60 THR 60 63 63 THR THR A . n A 1 61 GLY 61 64 64 GLY GLY A . n A 1 62 GLY 62 65 65 GLY GLY A . n A 1 63 SER 63 66 66 SER SER A . n A 1 64 TYR 64 67 67 TYR TYR A . n A 1 65 GLY 65 68 68 GLY GLY A . n A 1 66 GLY 66 69 69 GLY GLY A . n A 1 67 THR 67 70 70 THR THR A . n A 1 68 TYR 68 71 71 TYR TYR A . n A 1 69 ARG 69 72 72 ARG ARG A . n A 1 70 PHE 70 73 73 PHE PHE A . n A 1 71 LYS 71 74 74 LYS LYS A . n A 1 72 LYS 72 75 75 LYS LYS A . n A 1 73 GLU 73 76 76 GLU GLU A . n A 1 74 PHE 74 77 77 PHE PHE A . n A 1 75 ASN 75 78 78 ASN ASN A . n A 1 76 ASP 76 79 79 ASP ASP A . n A 1 77 PRO 77 80 80 PRO PRO A . n A 1 78 SER 78 81 81 SER SER A . n A 1 79 ASN 79 82 82 ASN ASN A . n A 1 80 ALA 80 83 83 ALA ALA A . n A 1 81 GLY 81 84 84 GLY GLY A . n A 1 82 LEU 82 85 85 LEU LEU A . n A 1 83 GLN 83 86 86 GLN GLN A . n A 1 84 ASN 84 87 87 ASN ASN A . n A 1 85 GLY 85 88 88 GLY GLY A . n A 1 86 PHE 86 89 89 PHE PHE A . n A 1 87 LYS 87 90 90 LYS LYS A . n A 1 88 PHE 88 91 91 PHE PHE A . n A 1 89 LEU 89 92 92 LEU LEU A . n A 1 90 GLU 90 93 93 GLU GLU A . n A 1 91 PRO 91 94 94 PRO PRO A . n A 1 92 ILE 92 95 95 ILE ILE A . n A 1 93 HIS 93 96 96 HIS HIS A . n A 1 94 LYS 94 97 97 LYS LYS A . n A 1 95 GLU 95 98 98 GLU GLU A . n A 1 96 PHE 96 99 99 PHE PHE A . n A 1 97 PRO 97 100 100 PRO PRO A . n A 1 98 TRP 98 101 101 TRP TRP A . n A 1 99 ILE 99 102 102 ILE ILE A . n A 1 100 SER 100 103 103 SER SER A . n A 1 101 SER 101 104 104 SER SER A . n A 1 102 GLY 102 105 105 GLY GLY A . n A 1 103 ASP 103 106 106 ASP ASP A . n A 1 104 LEU 104 107 107 LEU LEU A . n A 1 105 PHE 105 108 108 PHE PHE A . n A 1 106 SER 106 109 109 SER SER A . n A 1 107 LEU 107 110 110 LEU LEU A . n A 1 108 GLY 108 111 111 GLY GLY A . n A 1 109 GLY 109 112 112 GLY GLY A . n A 1 110 VAL 110 113 113 VAL VAL A . n A 1 111 THR 111 114 114 THR THR A . n A 1 112 ALA 112 115 115 ALA ALA A . n A 1 113 VAL 113 116 116 VAL VAL A . n A 1 114 GLN 114 117 117 GLN GLN A . n A 1 115 GLU 115 118 118 GLU GLU A . n A 1 116 MET 116 119 119 MET MET A . n A 1 117 GLN 117 120 120 GLN GLN A . n A 1 118 GLY 118 121 121 GLY GLY A . n A 1 119 PRO 119 122 122 PRO PRO A . n A 1 120 LYS 120 123 123 LYS LYS A . n A 1 121 ILE 121 124 124 ILE ILE A . n A 1 122 PRO 122 125 125 PRO PRO A . n A 1 123 TRP 123 126 126 TRP TRP A . n A 1 124 ARG 124 127 127 ARG ARG A . n A 1 125 CYS 125 128 128 CYS CYS A . n A 1 126 GLY 126 129 129 GLY GLY A . n A 1 127 ARG 127 130 130 ARG ARG A . n A 1 128 VAL 128 131 131 VAL VAL A . n A 1 129 ASP 129 132 132 ASP ASP A . n A 1 130 THR 130 133 133 THR THR A . n A 1 131 PRO 131 134 134 PRO PRO A . n A 1 132 GLU 132 135 135 GLU GLU A . n A 1 133 ASP 133 136 136 ASP ASP A . n A 1 134 THR 134 137 137 THR THR A . n A 1 135 THR 135 138 138 THR THR A . n A 1 136 PRO 136 139 139 PRO PRO A . n A 1 137 ASP 137 140 140 ASP ASP A . n A 1 138 ASN 138 141 141 ASN ASN A . n A 1 139 GLY 139 142 142 GLY GLY A . n A 1 140 ARG 140 143 143 ARG ARG A . n A 1 141 LEU 141 144 144 LEU LEU A . n A 1 142 PRO 142 145 145 PRO PRO A . n A 1 143 ASP 143 146 146 ASP ASP A . n A 1 144 ALA 144 147 147 ALA ALA A . n A 1 145 ASP 145 148 148 ASP ASP A . n A 1 146 LYS 146 149 149 LYS LYS A . n A 1 147 ASP 147 150 150 ASP ASP A . n A 1 148 ALA 148 151 151 ALA ALA A . n A 1 149 GLY 149 152 152 GLY GLY A . n A 1 150 TYR 150 153 153 TYR TYR A . n A 1 151 VAL 151 154 154 VAL VAL A . n A 1 152 ARG 152 155 155 ARG ARG A . n A 1 153 THR 153 156 156 THR THR A . n A 1 154 PHE 154 157 157 PHE PHE A . n A 1 155 PHE 155 158 158 PHE PHE A . n A 1 156 GLN 156 159 159 GLN GLN A . n A 1 157 ARG 157 160 160 ARG ARG A . n A 1 158 LEU 158 161 161 LEU LEU A . n A 1 159 ASN 159 162 162 ASN ASN A . n A 1 160 MET 160 163 163 MET MET A . n A 1 161 ASN 161 164 164 ASN ASN A . n A 1 162 ASP 162 165 165 ASP ASP A . n A 1 163 ARG 163 166 166 ARG ARG A . n A 1 164 GLU 164 167 167 GLU GLU A . n A 1 165 VAL 165 168 168 VAL VAL A . n A 1 166 VAL 166 169 169 VAL VAL A . n A 1 167 ALA 167 170 170 ALA ALA A . n A 1 168 LEU 168 171 171 LEU LEU A . n A 1 169 MET 169 172 172 MET MET A . n A 1 170 GLY 170 173 173 GLY GLY A . n A 1 171 ALA 171 174 174 ALA ALA A . n A 1 172 HIS 172 175 175 HIS HIS A . n A 1 173 ALA 173 176 176 ALA ALA A . n A 1 174 LEU 174 177 177 LEU LEU A . n A 1 175 GLY 175 178 178 GLY GLY A . n A 1 176 LYS 176 179 179 LYS LYS A . n A 1 177 THR 177 180 180 THR THR A . n A 1 178 HIS 178 181 181 HIS HIS A . n A 1 179 LEU 179 182 182 LEU LEU A . n A 1 180 LYS 180 183 183 LYS LYS A . n A 1 181 ASN 181 184 184 ASN ASN A . n A 1 182 SER 182 185 185 SER SER A . n A 1 183 GLY 183 186 186 GLY GLY A . n A 1 184 TYR 184 187 187 TYR TYR A . n A 1 185 GLU 185 188 188 GLU GLU A . n A 1 186 GLY 186 189 189 GLY GLY A . n A 1 187 PRO 187 190 190 PRO PRO A . n A 1 188 TRP 188 191 191 TRP TRP A . n A 1 189 GLY 189 192 192 GLY GLY A . n A 1 190 ALA 190 193 193 ALA ALA A . n A 1 191 ALA 191 194 194 ALA ALA A . n A 1 192 ASN 192 195 195 ASN ASN A . n A 1 193 ASN 193 196 196 ASN ASN A . n A 1 194 VAL 194 197 197 VAL VAL A . n A 1 195 PHE 195 198 198 PHE PHE A . n A 1 196 THR 196 199 199 THR THR A . n A 1 197 ASN 197 200 200 ASN ASN A . n A 1 198 GLU 198 201 201 GLU GLU A . n A 1 199 PHE 199 202 202 PHE PHE A . n A 1 200 TYR 200 203 203 TYR TYR A . n A 1 201 LEU 201 204 204 LEU LEU A . n A 1 202 ASN 202 205 205 ASN ASN A . n A 1 203 LEU 203 206 206 LEU LEU A . n A 1 204 LEU 204 207 207 LEU LEU A . n A 1 205 ASN 205 208 208 ASN ASN A . n A 1 206 GLU 206 209 209 GLU GLU A . n A 1 207 ASP 207 210 210 ASP ASP A . n A 1 208 TRP 208 211 211 TRP TRP A . n A 1 209 LYS 209 212 212 LYS LYS A . n A 1 210 LEU 210 213 213 LEU LEU A . n A 1 211 GLU 211 214 214 GLU GLU A . n A 1 212 LYS 212 215 215 LYS LYS A . n A 1 213 ASN 213 216 216 ASN ASN A . n A 1 214 ASP 214 217 217 ASP ASP A . n A 1 215 ALA 215 218 218 ALA ALA A . n A 1 216 ASN 216 219 219 ASN ASN A . n A 1 217 ASN 217 220 220 ASN ASN A . n A 1 218 GLU 218 221 221 GLU GLU A . n A 1 219 GLN 219 222 222 GLN GLN A . n A 1 220 TRP 220 223 223 TRP TRP A . n A 1 221 ASP 221 224 224 ASP ASP A . n A 1 222 SER 222 225 225 SER SER A . n A 1 223 LYS 223 226 226 LYS LYS A . n A 1 224 SER 224 227 227 SER SER A . n A 1 225 GLY 225 228 228 GLY GLY A . n A 1 226 TYR 226 229 229 TYR TYR A . n A 1 227 MET 227 230 230 MET MET A . n A 1 228 MET 228 231 231 MET MET A . n A 1 229 LEU 229 232 232 LEU LEU A . n A 1 230 PRO 230 233 233 PRO PRO A . n A 1 231 THR 231 234 234 THR THR A . n A 1 232 ASP 232 235 235 ASP ASP A . n A 1 233 TYR 233 236 236 TYR TYR A . n A 1 234 SER 234 237 237 SER SER A . n A 1 235 LEU 235 238 238 LEU LEU A . n A 1 236 ILE 236 239 239 ILE ILE A . n A 1 237 GLN 237 240 240 GLN GLN A . n A 1 238 ASP 238 241 241 ASP ASP A . n A 1 239 PRO 239 242 242 PRO PRO A . n A 1 240 LYS 240 243 243 LYS LYS A . n A 1 241 TYR 241 244 244 TYR TYR A . n A 1 242 LEU 242 245 245 LEU LEU A . n A 1 243 SER 243 246 246 SER SER A . n A 1 244 ILE 244 247 247 ILE ILE A . n A 1 245 VAL 245 248 248 VAL VAL A . n A 1 246 LYS 246 249 249 LYS LYS A . n A 1 247 GLU 247 250 250 GLU GLU A . n A 1 248 TYR 248 251 251 TYR TYR A . n A 1 249 ALA 249 252 252 ALA ALA A . n A 1 250 ASN 250 253 253 ASN ASN A . n A 1 251 ASP 251 254 254 ASP ASP A . n A 1 252 GLN 252 255 255 GLN GLN A . n A 1 253 ASP 253 256 256 ASP ASP A . n A 1 254 LYS 254 257 257 LYS LYS A . n A 1 255 PHE 255 258 258 PHE PHE A . n A 1 256 PHE 256 259 259 PHE PHE A . n A 1 257 LYS 257 260 260 LYS LYS A . n A 1 258 ASP 258 261 261 ASP ASP A . n A 1 259 PHE 259 262 262 PHE PHE A . n A 1 260 SER 260 263 263 SER SER A . n A 1 261 LYS 261 264 264 LYS LYS A . n A 1 262 ALA 262 265 265 ALA ALA A . n A 1 263 PHE 263 266 266 PHE PHE A . n A 1 264 GLU 264 267 267 GLU GLU A . n A 1 265 LYS 265 268 268 LYS LYS A . n A 1 266 LEU 266 269 269 LEU LEU A . n A 1 267 LEU 267 270 270 LEU LEU A . n A 1 268 GLU 268 271 271 GLU GLU A . n A 1 269 ASP 269 272 272 ASP ASP A . n A 1 270 GLY 270 273 273 GLY GLY A . n A 1 271 ILE 271 274 274 ILE ILE A . n A 1 272 THR 272 275 275 THR THR A . n A 1 273 PHE 273 276 276 PHE PHE A . n A 1 274 PRO 274 277 277 PRO PRO A . n A 1 275 LYS 275 278 278 LYS LYS A . n A 1 276 ASP 276 279 279 ASP ASP A . n A 1 277 ALA 277 280 280 ALA ALA A . n A 1 278 PRO 278 281 281 PRO PRO A . n A 1 279 SER 279 282 282 SER SER A . n A 1 280 PRO 280 283 283 PRO PRO A . n A 1 281 PHE 281 284 284 PHE PHE A . n A 1 282 ILE 282 285 285 ILE ILE A . n A 1 283 PHE 283 286 286 PHE PHE A . n A 1 284 LYS 284 287 287 LYS LYS A . n A 1 285 THR 285 288 288 THR THR A . n A 1 286 LEU 286 289 289 LEU LEU A . n A 1 287 GLU 287 290 290 GLU GLU A . n A 1 288 GLU 288 291 291 GLU GLU A . n A 1 289 GLN 289 292 292 GLN GLN A . n A 1 290 GLY 290 293 293 GLY GLY A . n A 1 291 LEU 291 294 294 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DDH 1 296 296 DDH DDH A . C 3 HOH 1 309 309 HOH HOH A . C 3 HOH 2 312 312 HOH HOH A . C 3 HOH 3 313 313 HOH HOH A . C 3 HOH 4 314 314 HOH HOH A . C 3 HOH 5 315 315 HOH HOH A . C 3 HOH 6 317 317 HOH HOH A . C 3 HOH 7 318 318 HOH HOH A . C 3 HOH 8 319 319 HOH HOH A . C 3 HOH 9 320 320 HOH HOH A . C 3 HOH 10 321 321 HOH HOH A . C 3 HOH 11 322 322 HOH HOH A . C 3 HOH 12 323 323 HOH HOH A . C 3 HOH 13 324 324 HOH HOH A . C 3 HOH 14 325 325 HOH HOH A . C 3 HOH 15 326 326 HOH HOH A . C 3 HOH 16 327 327 HOH HOH A . C 3 HOH 17 333 333 HOH HOH A . C 3 HOH 18 335 335 HOH HOH A . C 3 HOH 19 342 342 HOH HOH A . C 3 HOH 20 345 345 HOH HOH A . C 3 HOH 21 348 348 HOH HOH A . C 3 HOH 22 353 353 HOH HOH A . C 3 HOH 23 355 355 HOH HOH A . C 3 HOH 24 365 365 HOH HOH A . C 3 HOH 25 366 366 HOH HOH A . C 3 HOH 26 370 370 HOH HOH A . C 3 HOH 27 376 376 HOH HOH A . C 3 HOH 28 379 379 HOH HOH A . C 3 HOH 29 382 382 HOH HOH A . C 3 HOH 30 384 384 HOH HOH A . C 3 HOH 31 401 401 HOH HOH A . C 3 HOH 32 402 402 HOH HOH A . C 3 HOH 33 408 408 HOH HOH A . C 3 HOH 34 417 417 HOH HOH A . C 3 HOH 35 418 418 HOH HOH A . C 3 HOH 36 421 421 HOH HOH A . C 3 HOH 37 425 425 HOH HOH A . C 3 HOH 38 427 427 HOH HOH A . C 3 HOH 39 428 428 HOH HOH A . C 3 HOH 40 430 430 HOH HOH A . C 3 HOH 41 432 432 HOH HOH A . C 3 HOH 42 433 433 HOH HOH A . C 3 HOH 43 435 435 HOH HOH A . C 3 HOH 44 440 440 HOH HOH A . C 3 HOH 45 441 441 HOH HOH A . C 3 HOH 46 443 443 HOH HOH A . C 3 HOH 47 447 447 HOH HOH A . C 3 HOH 48 450 450 HOH HOH A . C 3 HOH 49 455 455 HOH HOH A . C 3 HOH 50 464 464 HOH HOH A . C 3 HOH 51 465 465 HOH HOH A . C 3 HOH 52 472 472 HOH HOH A . C 3 HOH 53 477 477 HOH HOH A . C 3 HOH 54 487 487 HOH HOH A . C 3 HOH 55 488 488 HOH HOH A . C 3 HOH 56 498 498 HOH HOH A . C 3 HOH 57 500 500 HOH HOH A . C 3 HOH 58 511 511 HOH HOH A . C 3 HOH 59 512 512 HOH HOH A . C 3 HOH 60 513 513 HOH HOH A . C 3 HOH 61 526 526 HOH HOH A . C 3 HOH 62 535 535 HOH HOH A . C 3 HOH 63 539 539 HOH HOH A . C 3 HOH 64 541 541 HOH HOH A . C 3 HOH 65 542 542 HOH HOH A . C 3 HOH 66 546 546 HOH HOH A . C 3 HOH 67 551 551 HOH HOH A . C 3 HOH 68 556 556 HOH HOH A . C 3 HOH 69 561 561 HOH HOH A . C 3 HOH 70 569 569 HOH HOH A . C 3 HOH 71 572 572 HOH HOH A . C 3 HOH 72 573 573 HOH HOH A . C 3 HOH 73 575 575 HOH HOH A . C 3 HOH 74 576 576 HOH HOH A . C 3 HOH 75 577 577 HOH HOH A . C 3 HOH 76 578 578 HOH HOH A . C 3 HOH 77 586 586 HOH HOH A . C 3 HOH 78 595 595 HOH HOH A . C 3 HOH 79 596 596 HOH HOH A . C 3 HOH 80 600 600 HOH HOH A . C 3 HOH 81 602 602 HOH HOH A . C 3 HOH 82 603 603 HOH HOH A . C 3 HOH 83 604 604 HOH HOH A . C 3 HOH 84 605 605 HOH HOH A . C 3 HOH 85 606 606 HOH HOH A . C 3 HOH 86 607 607 HOH HOH A . C 3 HOH 87 609 609 HOH HOH A . C 3 HOH 88 610 610 HOH HOH A . C 3 HOH 89 612 612 HOH HOH A . C 3 HOH 90 614 614 HOH HOH A . C 3 HOH 91 615 615 HOH HOH A . C 3 HOH 92 616 616 HOH HOH A . C 3 HOH 93 617 617 HOH HOH A . C 3 HOH 94 618 618 HOH HOH A . C 3 HOH 95 620 620 HOH HOH A . C 3 HOH 96 623 623 HOH HOH A . C 3 HOH 97 624 624 HOH HOH A . C 3 HOH 98 625 625 HOH HOH A . C 3 HOH 99 626 626 HOH HOH A . C 3 HOH 100 627 627 HOH HOH A . C 3 HOH 101 628 628 HOH HOH A . C 3 HOH 102 629 629 HOH HOH A . C 3 HOH 103 630 630 HOH HOH A . C 3 HOH 104 631 631 HOH HOH A . C 3 HOH 105 632 632 HOH HOH A . C 3 HOH 106 633 633 HOH HOH A . C 3 HOH 107 649 649 HOH HOH A . C 3 HOH 108 700 700 HOH HOH A . C 3 HOH 109 701 701 HOH HOH A . C 3 HOH 110 703 703 HOH HOH A . C 3 HOH 111 705 705 HOH HOH A . C 3 HOH 112 706 706 HOH HOH A . C 3 HOH 113 707 707 HOH HOH A . C 3 HOH 114 709 709 HOH HOH A . C 3 HOH 115 714 714 HOH HOH A . C 3 HOH 116 717 717 HOH HOH A . C 3 HOH 117 720 720 HOH HOH A . C 3 HOH 118 722 722 HOH HOH A . C 3 HOH 119 724 724 HOH HOH A . C 3 HOH 120 725 725 HOH HOH A . C 3 HOH 121 727 727 HOH HOH A . C 3 HOH 122 730 730 HOH HOH A . C 3 HOH 123 731 731 HOH HOH A . C 3 HOH 124 732 732 HOH HOH A . C 3 HOH 125 733 733 HOH HOH A . C 3 HOH 126 734 734 HOH HOH A . C 3 HOH 127 736 736 HOH HOH A . C 3 HOH 128 738 738 HOH HOH A . C 3 HOH 129 739 739 HOH HOH A . C 3 HOH 130 740 740 HOH HOH A . C 3 HOH 131 743 743 HOH HOH A . C 3 HOH 132 751 751 HOH HOH A . C 3 HOH 133 787 787 HOH HOH A . C 3 HOH 134 808 808 HOH HOH A . C 3 HOH 135 843 843 HOH HOH A . C 3 HOH 136 850 850 HOH HOH A . C 3 HOH 137 863 863 HOH HOH A . C 3 HOH 138 864 864 HOH HOH A . C 3 HOH 139 872 872 HOH HOH A . C 3 HOH 140 895 895 HOH HOH A . C 3 HOH 141 896 896 HOH HOH A . C 3 HOH 142 900 900 HOH HOH A . C 3 HOH 143 901 901 HOH HOH A . C 3 HOH 144 903 903 HOH HOH A . C 3 HOH 145 904 904 HOH HOH A . C 3 HOH 146 906 906 HOH HOH A . C 3 HOH 147 909 909 HOH HOH A . C 3 HOH 148 911 911 HOH HOH A . C 3 HOH 149 914 914 HOH HOH A . C 3 HOH 150 915 915 HOH HOH A . C 3 HOH 151 934 934 HOH HOH A . C 3 HOH 152 942 942 HOH HOH A . C 3 HOH 153 944 944 HOH HOH A . C 3 HOH 154 954 954 HOH HOH A . C 3 HOH 155 965 965 HOH HOH A . C 3 HOH 156 967 967 HOH HOH A . C 3 HOH 157 970 970 HOH HOH A . C 3 HOH 158 971 971 HOH HOH A . C 3 HOH 159 972 972 HOH HOH A . C 3 HOH 160 973 973 HOH HOH A . C 3 HOH 161 974 974 HOH HOH A . C 3 HOH 162 975 975 HOH HOH A . C 3 HOH 163 976 976 HOH HOH A . C 3 HOH 164 977 977 HOH HOH A . C 3 HOH 165 978 978 HOH HOH A . C 3 HOH 166 979 979 HOH HOH A . C 3 HOH 167 980 980 HOH HOH A . C 3 HOH 168 981 981 HOH HOH A . C 3 HOH 169 982 982 HOH HOH A . C 3 HOH 170 983 983 HOH HOH A . C 3 HOH 171 984 984 HOH HOH A . C 3 HOH 172 985 985 HOH HOH A . C 3 HOH 173 986 986 HOH HOH A . C 3 HOH 174 987 987 HOH HOH A . C 3 HOH 175 988 988 HOH HOH A . C 3 HOH 176 989 989 HOH HOH A . C 3 HOH 177 990 990 HOH HOH A . C 3 HOH 178 991 991 HOH HOH A . C 3 HOH 179 992 992 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 172 ? A HIS 175 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 NA ? B DDH . ? A DDH 296 ? 1_555 97.1 ? 2 NE2 ? A HIS 172 ? A HIS 175 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 NB ? B DDH . ? A DDH 296 ? 1_555 92.1 ? 3 NA ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 NB ? B DDH . ? A DDH 296 ? 1_555 83.6 ? 4 NE2 ? A HIS 172 ? A HIS 175 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 NC ? B DDH . ? A DDH 296 ? 1_555 87.1 ? 5 NA ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 NC ? B DDH . ? A DDH 296 ? 1_555 174.0 ? 6 NB ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 NC ? B DDH . ? A DDH 296 ? 1_555 92.1 ? 7 NE2 ? A HIS 172 ? A HIS 175 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 ND ? B DDH . ? A DDH 296 ? 1_555 95.6 ? 8 NA ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 ND ? B DDH . ? A DDH 296 ? 1_555 94.2 ? 9 NB ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 ND ? B DDH . ? A DDH 296 ? 1_555 172.2 ? 10 NC ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 ND ? B DDH . ? A DDH 296 ? 1_555 89.6 ? 11 NE2 ? A HIS 172 ? A HIS 175 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 O ? C HOH . ? A HOH 595 ? 1_555 175.5 ? 12 NA ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 O ? C HOH . ? A HOH 595 ? 1_555 78.7 ? 13 NB ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 O ? C HOH . ? A HOH 595 ? 1_555 85.9 ? 14 NC ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 O ? C HOH . ? A HOH 595 ? 1_555 97.0 ? 15 ND ? B DDH . ? A DDH 296 ? 1_555 FE ? B DDH . ? A DDH 296 ? 1_555 O ? C HOH . ? A HOH 595 ? 1_555 86.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-01-13 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_ref_seq_dif.details' 31 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _software.name TNT _software.classification refinement _software.version 1 _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_entry_details.entry_id 1BJ9 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THIS CYTOCHROME C PEROXIDASE DIFFERS FROM THE PREVIOUSLY DEPOSITED STRUCTURE (PROTEIN DATA BANK ENTRY 2CYP) BY TWO STRAIN-RELATED SEQUENCE DIFFERENCES, THR 53 TO ILE AND ASP 152 TO GLY, AND THE ADDITION OF MET-ILE AT THE N-TERMINUS, HENCE CCP(MI). THE OVERALL STRUCTURE IS THE SAME AS THE PREVIOUSLY DEPOSITED ONE BUT IN A DIFFERENT CELL PACKING. THE NATIVE STRUCTURE IS AVAILABLE FROM THE PROTEIN DATA BANK AS ENTRY 1CCP AND THREE HEME-CLEFT MUTANTS PREPARED BY SITE-DIRECTED MUTAGENSIS, CCP(MI,W51F), CCP(MI,W191F), AND CCP(MI,D235N), ARE ALSO AVAILABLE FROM THE PROTEIN DATA BANK AS ENTRIES 2CCP, 3CCP, AND 4CPP, RESPECTIVELY. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 18 ? ? CG A ASP 18 ? ? OD1 A ASP 18 ? ? 112.33 118.30 -5.97 0.90 N 2 1 CB A ASP 18 ? ? CG A ASP 18 ? ? OD2 A ASP 18 ? ? 124.27 118.30 5.97 0.90 N 3 1 CB A ASP 34 ? ? CG A ASP 34 ? ? OD1 A ASP 34 ? ? 124.13 118.30 5.83 0.90 N 4 1 CB A ASP 58 ? ? CG A ASP 58 ? ? OD1 A ASP 58 ? ? 124.68 118.30 6.38 0.90 N 5 1 CB A ASP 58 ? ? CG A ASP 58 ? ? OD2 A ASP 58 ? ? 112.23 118.30 -6.07 0.90 N 6 1 CB A ASP 61 ? ? CG A ASP 61 ? ? OD2 A ASP 61 ? ? 112.45 118.30 -5.85 0.90 N 7 1 CB A GLU 93 ? ? CA A GLU 93 ? ? C A GLU 93 ? ? 126.71 110.40 16.31 2.00 N 8 1 NE A ARG 127 ? ? CZ A ARG 127 ? ? NH1 A ARG 127 ? ? 125.33 120.30 5.03 0.50 N 9 1 NE A ARG 127 ? ? CZ A ARG 127 ? ? NH2 A ARG 127 ? ? 116.04 120.30 -4.26 0.50 N 10 1 NE A ARG 130 ? ? CZ A ARG 130 ? ? NH1 A ARG 130 ? ? 123.92 120.30 3.62 0.50 N 11 1 CB A ASP 132 ? ? CG A ASP 132 ? ? OD1 A ASP 132 ? ? 123.79 118.30 5.49 0.90 N 12 1 CB A ASP 132 ? ? CG A ASP 132 ? ? OD2 A ASP 132 ? ? 111.92 118.30 -6.38 0.90 N 13 1 CB A ASP 140 ? ? CG A ASP 140 ? ? OD2 A ASP 140 ? ? 112.43 118.30 -5.87 0.90 N 14 1 CB A ASP 146 ? ? CG A ASP 146 ? ? OD1 A ASP 146 ? ? 112.40 118.30 -5.90 0.90 N 15 1 CB A ASP 150 ? ? CG A ASP 150 ? ? OD1 A ASP 150 ? ? 124.31 118.30 6.01 0.90 N 16 1 CB A ASP 150 ? ? CG A ASP 150 ? ? OD2 A ASP 150 ? ? 111.46 118.30 -6.84 0.90 N 17 1 CB A ASP 165 ? ? CG A ASP 165 ? ? OD1 A ASP 165 ? ? 125.33 118.30 7.03 0.90 N 18 1 CB A ASP 165 ? ? CG A ASP 165 ? ? OD2 A ASP 165 ? ? 111.47 118.30 -6.83 0.90 N 19 1 NE A ARG 166 ? ? CZ A ARG 166 ? ? NH1 A ARG 166 ? ? 124.08 120.30 3.78 0.50 N 20 1 CB A ASP 210 ? ? CG A ASP 210 ? ? OD1 A ASP 210 ? ? 112.44 118.30 -5.86 0.90 N 21 1 CB A TYR 229 ? ? CG A TYR 229 ? ? CD2 A TYR 229 ? ? 116.88 121.00 -4.12 0.60 N 22 1 CB A ASP 254 ? ? CG A ASP 254 ? ? OD1 A ASP 254 ? ? 123.84 118.30 5.54 0.90 N 23 1 CB A ASP 254 ? ? CG A ASP 254 ? ? OD2 A ASP 254 ? ? 110.56 118.30 -7.74 0.90 N 24 1 CB A ASP 279 ? ? CG A ASP 279 ? ? OD1 A ASP 279 ? ? 112.08 118.30 -6.22 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 33 ? ? -91.92 57.98 2 1 ASP A 148 ? ? -92.39 35.01 3 1 LYS A 149 ? ? -118.30 -168.75 4 1 ASN A 219 ? ? 71.75 31.66 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 12 ? CD ? A LYS 9 CD 2 1 Y 1 A LYS 12 ? CE ? A LYS 9 CE 3 1 Y 1 A LYS 12 ? NZ ? A LYS 9 NZ 4 1 Y 1 A GLU 17 ? CG ? A GLU 14 CG 5 1 Y 1 A GLU 17 ? CD ? A GLU 14 CD 6 1 Y 1 A GLU 17 ? OE1 ? A GLU 14 OE1 7 1 Y 1 A GLU 17 ? OE2 ? A GLU 14 OE2 8 1 Y 1 A GLU 35 ? CG ? A GLU 32 CG 9 1 Y 1 A GLU 35 ? CD ? A GLU 32 CD 10 1 Y 1 A GLU 35 ? OE1 ? A GLU 32 OE1 11 1 Y 1 A GLU 35 ? OE2 ? A GLU 32 OE2 12 1 Y 1 A ASN 38 ? CG ? A ASN 35 CG 13 1 Y 1 A ASN 38 ? OD1 ? A ASN 35 OD1 14 1 Y 1 A ASN 38 ? ND2 ? A ASN 35 ND2 15 1 Y 1 A TYR 39 ? CG ? A TYR 36 CG 16 1 Y 1 A TYR 39 ? CD1 ? A TYR 36 CD1 17 1 Y 1 A TYR 39 ? CD2 ? A TYR 36 CD2 18 1 Y 1 A TYR 39 ? CE1 ? A TYR 36 CE1 19 1 Y 1 A TYR 39 ? CE2 ? A TYR 36 CE2 20 1 Y 1 A TYR 39 ? CZ ? A TYR 36 CZ 21 1 Y 1 A TYR 39 ? OH ? A TYR 36 OH 22 1 Y 1 A LYS 74 ? CG ? A LYS 71 CG 23 1 Y 1 A LYS 74 ? CD ? A LYS 71 CD 24 1 Y 1 A LYS 74 ? CE ? A LYS 71 CE 25 1 Y 1 A LYS 74 ? NZ ? A LYS 71 NZ 26 1 Y 1 A LYS 90 ? CD ? A LYS 87 CD 27 1 Y 1 A LYS 90 ? CE ? A LYS 87 CE 28 1 Y 1 A LYS 90 ? NZ ? A LYS 87 NZ 29 1 Y 1 A GLU 93 ? CD ? A GLU 90 CD 30 1 Y 1 A GLU 93 ? OE1 ? A GLU 90 OE1 31 1 Y 1 A GLU 93 ? OE2 ? A GLU 90 OE2 32 1 Y 1 A LYS 97 ? CD ? A LYS 94 CD 33 1 Y 1 A LYS 97 ? CE ? A LYS 94 CE 34 1 Y 1 A LYS 97 ? NZ ? A LYS 94 NZ 35 1 Y 1 A GLU 98 ? OE1 ? A GLU 95 OE1 36 1 Y 1 A GLU 98 ? OE2 ? A GLU 95 OE2 37 1 Y 1 A ASP 136 ? CG ? A ASP 133 CG 38 1 Y 1 A ASP 136 ? OD1 ? A ASP 133 OD1 39 1 Y 1 A ASP 136 ? OD2 ? A ASP 133 OD2 40 1 Y 1 A LYS 183 ? CG ? A LYS 180 CG 41 1 Y 1 A LYS 183 ? CD ? A LYS 180 CD 42 1 Y 1 A LYS 183 ? CE ? A LYS 180 CE 43 1 Y 1 A LYS 183 ? NZ ? A LYS 180 NZ 44 1 Y 1 A LYS 226 ? CG ? A LYS 223 CG 45 1 Y 1 A LYS 226 ? CD ? A LYS 223 CD 46 1 Y 1 A LYS 226 ? CE ? A LYS 223 CE 47 1 Y 1 A LYS 226 ? NZ ? A LYS 223 NZ 48 1 Y 1 A LYS 243 ? CE ? A LYS 240 CE 49 1 Y 1 A LYS 243 ? NZ ? A LYS 240 NZ 50 1 Y 1 A ASP 256 ? CG ? A ASP 253 CG 51 1 Y 1 A ASP 256 ? OD1 ? A ASP 253 OD1 52 1 Y 1 A ASP 256 ? OD2 ? A ASP 253 OD2 53 1 Y 1 A LYS 260 ? CE ? A LYS 257 CE 54 1 Y 1 A LYS 260 ? NZ ? A LYS 257 NZ 55 1 Y 1 A LYS 264 ? CE ? A LYS 261 CE 56 1 Y 1 A LYS 264 ? NZ ? A LYS 261 NZ 57 1 Y 1 A LYS 287 ? CE ? A LYS 284 CE 58 1 Y 1 A LYS 287 ? NZ ? A LYS 284 NZ # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '[7,12-DEACETYL-3,8,13,17-TETRAMETHYL-21H,23H-PORPHINE-2,18-DIPROPANOATO(2-)-N21,N22,N23,N24]-IRON' DDH 3 water HOH #