data_1BJX # _entry.id 1BJX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BJX pdb_00001bjx 10.2210/pdb1bjx/pdb WWPDB D_1000171844 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-01-13 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BJX _pdbx_database_status.recvd_initial_deposition_date 1998-06-29 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kemmink, J.' 1 'Dijkstra, K.' 2 'Mariani, M.' 3 'Scheek, R.M.' 4 'Penka, E.' 5 'Nilges, M.' 6 'Darby, N.J.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The structure in solution of the b domain of protein disulfide isomerase.' J.Biomol.NMR 13 357 368 1999 JBNME9 NE 0925-2738 0800 ? 10383197 10.1023/A:1008341820489 1 'The Folding Catalyst Protein Disulfide Isomerase is Constructed of Active and Inactive Thioredoxin Modules' Curr.Biol. 7 239 ? 1997 CUBLE2 UK 0960-9822 2060 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kemmink, J.' 1 ? primary 'Dijkstra, K.' 2 ? primary 'Mariani, M.' 3 ? primary 'Scheek, R.M.' 4 ? primary 'Penka, E.' 5 ? primary 'Nilges, M.' 6 ? primary 'Darby, N.J.' 7 ? 1 'Kemmink, J.' 8 ? 1 'Darby, N.J.' 9 ? 1 'Dijkstra, K.' 10 ? 1 'Nilges, M.' 11 ? 1 'Creighton, T.E.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PROTEIN DISULFIDE ISOMERASE' _entity.formula_weight 12072.295 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 5.3.4.1 _entity.pdbx_mutation ? _entity.pdbx_fragment 'B DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNN FEGEVTKENLLDFIKHNQLPLVIEFTEQTA ; _entity_poly.pdbx_seq_one_letter_code_can ;AATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNN FEGEVTKENLLDFIKHNQLPLVIEFTEQTA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ALA n 1 3 THR n 1 4 THR n 1 5 LEU n 1 6 PRO n 1 7 ASP n 1 8 GLY n 1 9 ALA n 1 10 ALA n 1 11 ALA n 1 12 GLU n 1 13 SER n 1 14 LEU n 1 15 VAL n 1 16 GLU n 1 17 SER n 1 18 SER n 1 19 GLU n 1 20 VAL n 1 21 ALA n 1 22 VAL n 1 23 ILE n 1 24 GLY n 1 25 PHE n 1 26 PHE n 1 27 LYS n 1 28 ASP n 1 29 VAL n 1 30 GLU n 1 31 SER n 1 32 ASP n 1 33 SER n 1 34 ALA n 1 35 LYS n 1 36 GLN n 1 37 PHE n 1 38 LEU n 1 39 GLN n 1 40 ALA n 1 41 ALA n 1 42 GLU n 1 43 ALA n 1 44 ILE n 1 45 ASP n 1 46 ASP n 1 47 ILE n 1 48 PRO n 1 49 PHE n 1 50 GLY n 1 51 ILE n 1 52 THR n 1 53 SER n 1 54 ASN n 1 55 SER n 1 56 ASP n 1 57 VAL n 1 58 PHE n 1 59 SER n 1 60 LYS n 1 61 TYR n 1 62 GLN n 1 63 LEU n 1 64 ASP n 1 65 LYS n 1 66 ASP n 1 67 GLY n 1 68 VAL n 1 69 VAL n 1 70 LEU n 1 71 PHE n 1 72 LYS n 1 73 LYS n 1 74 PHE n 1 75 ASP n 1 76 GLU n 1 77 GLY n 1 78 ARG n 1 79 ASN n 1 80 ASN n 1 81 PHE n 1 82 GLU n 1 83 GLY n 1 84 GLU n 1 85 VAL n 1 86 THR n 1 87 LYS n 1 88 GLU n 1 89 ASN n 1 90 LEU n 1 91 LEU n 1 92 ASP n 1 93 PHE n 1 94 ILE n 1 95 LYS n 1 96 HIS n 1 97 ASN n 1 98 GLN n 1 99 LEU n 1 100 PRO n 1 101 LEU n 1 102 VAL n 1 103 ILE n 1 104 GLU n 1 105 PHE n 1 106 THR n 1 107 GLU n 1 108 GLN n 1 109 THR n 1 110 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET12A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 119 119 ALA ALA A . n A 1 2 ALA 2 120 120 ALA ALA A . n A 1 3 THR 3 121 121 THR THR A . n A 1 4 THR 4 122 122 THR THR A . n A 1 5 LEU 5 123 123 LEU LEU A . n A 1 6 PRO 6 124 124 PRO PRO A . n A 1 7 ASP 7 125 125 ASP ASP A . n A 1 8 GLY 8 126 126 GLY GLY A . n A 1 9 ALA 9 127 127 ALA ALA A . n A 1 10 ALA 10 128 128 ALA ALA A . n A 1 11 ALA 11 129 129 ALA ALA A . n A 1 12 GLU 12 130 130 GLU GLU A . n A 1 13 SER 13 131 131 SER SER A . n A 1 14 LEU 14 132 132 LEU LEU A . n A 1 15 VAL 15 133 133 VAL VAL A . n A 1 16 GLU 16 134 134 GLU GLU A . n A 1 17 SER 17 135 135 SER SER A . n A 1 18 SER 18 136 136 SER SER A . n A 1 19 GLU 19 137 137 GLU GLU A . n A 1 20 VAL 20 138 138 VAL VAL A . n A 1 21 ALA 21 139 139 ALA ALA A . n A 1 22 VAL 22 140 140 VAL VAL A . n A 1 23 ILE 23 141 141 ILE ILE A . n A 1 24 GLY 24 142 142 GLY GLY A . n A 1 25 PHE 25 143 143 PHE PHE A . n A 1 26 PHE 26 144 144 PHE PHE A . n A 1 27 LYS 27 145 145 LYS LYS A . n A 1 28 ASP 28 146 146 ASP ASP A . n A 1 29 VAL 29 147 147 VAL VAL A . n A 1 30 GLU 30 148 148 GLU GLU A . n A 1 31 SER 31 149 149 SER SER A . n A 1 32 ASP 32 150 150 ASP ASP A . n A 1 33 SER 33 151 151 SER SER A . n A 1 34 ALA 34 152 152 ALA ALA A . n A 1 35 LYS 35 153 153 LYS LYS A . n A 1 36 GLN 36 154 154 GLN GLN A . n A 1 37 PHE 37 155 155 PHE PHE A . n A 1 38 LEU 38 156 156 LEU LEU A . n A 1 39 GLN 39 157 157 GLN GLN A . n A 1 40 ALA 40 158 158 ALA ALA A . n A 1 41 ALA 41 159 159 ALA ALA A . n A 1 42 GLU 42 160 160 GLU GLU A . n A 1 43 ALA 43 161 161 ALA ALA A . n A 1 44 ILE 44 162 162 ILE ILE A . n A 1 45 ASP 45 163 163 ASP ASP A . n A 1 46 ASP 46 164 164 ASP ASP A . n A 1 47 ILE 47 165 165 ILE ILE A . n A 1 48 PRO 48 166 166 PRO PRO A . n A 1 49 PHE 49 167 167 PHE PHE A . n A 1 50 GLY 50 168 168 GLY GLY A . n A 1 51 ILE 51 169 169 ILE ILE A . n A 1 52 THR 52 170 170 THR THR A . n A 1 53 SER 53 171 171 SER SER A . n A 1 54 ASN 54 172 172 ASN ASN A . n A 1 55 SER 55 173 173 SER SER A . n A 1 56 ASP 56 174 174 ASP ASP A . n A 1 57 VAL 57 175 175 VAL VAL A . n A 1 58 PHE 58 176 176 PHE PHE A . n A 1 59 SER 59 177 177 SER SER A . n A 1 60 LYS 60 178 178 LYS LYS A . n A 1 61 TYR 61 179 179 TYR TYR A . n A 1 62 GLN 62 180 180 GLN GLN A . n A 1 63 LEU 63 181 181 LEU LEU A . n A 1 64 ASP 64 182 182 ASP ASP A . n A 1 65 LYS 65 183 183 LYS LYS A . n A 1 66 ASP 66 184 184 ASP ASP A . n A 1 67 GLY 67 185 185 GLY GLY A . n A 1 68 VAL 68 186 186 VAL VAL A . n A 1 69 VAL 69 187 187 VAL VAL A . n A 1 70 LEU 70 188 188 LEU LEU A . n A 1 71 PHE 71 189 189 PHE PHE A . n A 1 72 LYS 72 190 190 LYS LYS A . n A 1 73 LYS 73 191 191 LYS LYS A . n A 1 74 PHE 74 192 192 PHE PHE A . n A 1 75 ASP 75 193 193 ASP ASP A . n A 1 76 GLU 76 194 194 GLU GLU A . n A 1 77 GLY 77 195 195 GLY GLY A . n A 1 78 ARG 78 196 196 ARG ARG A . n A 1 79 ASN 79 197 197 ASN ASN A . n A 1 80 ASN 80 198 198 ASN ASN A . n A 1 81 PHE 81 199 199 PHE PHE A . n A 1 82 GLU 82 200 200 GLU GLU A . n A 1 83 GLY 83 201 201 GLY GLY A . n A 1 84 GLU 84 202 202 GLU GLU A . n A 1 85 VAL 85 203 203 VAL VAL A . n A 1 86 THR 86 204 204 THR THR A . n A 1 87 LYS 87 205 205 LYS LYS A . n A 1 88 GLU 88 206 206 GLU GLU A . n A 1 89 ASN 89 207 207 ASN ASN A . n A 1 90 LEU 90 208 208 LEU LEU A . n A 1 91 LEU 91 209 209 LEU LEU A . n A 1 92 ASP 92 210 210 ASP ASP A . n A 1 93 PHE 93 211 211 PHE PHE A . n A 1 94 ILE 94 212 212 ILE ILE A . n A 1 95 LYS 95 213 213 LYS LYS A . n A 1 96 HIS 96 214 214 HIS HIS A . n A 1 97 ASN 97 215 215 ASN ASN A . n A 1 98 GLN 98 216 216 GLN GLN A . n A 1 99 LEU 99 217 217 LEU LEU A . n A 1 100 PRO 100 218 218 PRO PRO A . n A 1 101 LEU 101 219 219 LEU LEU A . n A 1 102 VAL 102 220 220 VAL VAL A . n A 1 103 ILE 103 221 221 ILE ILE A . n A 1 104 GLU 104 222 222 GLU GLU A . n A 1 105 PHE 105 223 223 PHE PHE A . n A 1 106 THR 106 224 224 THR THR A . n A 1 107 GLU 107 225 225 GLU GLU A . n A 1 108 GLN 108 226 226 GLN GLN A . n A 1 109 THR 109 227 227 THR THR A . n A 1 110 ALA 110 228 228 ALA ALA A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1BJX _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BJX _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1BJX _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1BJX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1BJX _struct.title 'HUMAN PROTEIN DISULFIDE ISOMERASE, NMR, 24 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BJX _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT, REDOX-ACTIVE CENTER, ISOMERASE, ENDOPLASMIC RETICULUM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PDIA1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P07237 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLA KVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGF FKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEF TEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITL EEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHC KQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGD DDDLEDLEEAEEPDMEEDDDQKAVKDEL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BJX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07237 _struct_ref_seq.db_align_beg 136 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 245 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 119 _struct_ref_seq.pdbx_auth_seq_align_end 228 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 8 ? SER A 17 ? GLY A 126 SER A 135 1 ? 10 HELX_P HELX_P2 2 ASP A 32 ? ALA A 43 ? ASP A 150 ALA A 161 1 ? 12 HELX_P HELX_P3 3 ASP A 56 ? TYR A 61 ? ASP A 174 TYR A 179 1 ? 6 HELX_P HELX_P4 4 LYS A 87 ? ASN A 97 ? LYS A 205 ASN A 215 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 2 ? THR A 4 ? ALA A 120 THR A 122 A 2 PRO A 48 ? ILE A 51 ? PRO A 166 ILE A 169 A 3 VAL A 20 ? PHE A 25 ? VAL A 138 PHE A 143 A 4 GLY A 67 ? LYS A 72 ? GLY A 185 LYS A 190 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 3 ? O THR A 121 N PHE A 49 ? N PHE A 167 A 2 3 O PRO A 48 ? O PRO A 166 N VAL A 22 ? N VAL A 140 A 3 4 O ALA A 21 ? O ALA A 139 N PHE A 71 ? N PHE A 189 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A THR 121 ? ? O A PHE 167 ? ? 1.57 2 2 OD2 A ASP 146 ? ? HB3 A SER 149 ? ? 0.65 3 2 O A GLY 126 ? ? OE1 A GLU 130 ? ? 1.27 4 2 OE2 A GLU 137 ? ? HG3 A LYS 191 ? ? 1.43 5 2 CG A ASP 146 ? ? HB3 A SER 149 ? ? 1.49 6 2 OD1 A ASP 125 ? ? HB3 A ASP 174 ? ? 1.53 7 2 OD2 A ASP 146 ? ? CB A SER 149 ? ? 1.55 8 2 O A GLY 126 ? ? CD A GLU 130 ? ? 1.91 9 2 C A GLY 126 ? ? OE1 A GLU 130 ? ? 2.12 10 2 O A GLY 126 ? ? OE2 A GLU 130 ? ? 2.18 11 3 HD3 A LYS 145 ? ? OD2 A ASP 146 ? ? 1.41 12 3 O A THR 204 ? ? H A LEU 208 ? ? 1.60 13 3 O A ASN 198 ? ? OE1 A GLU 200 ? ? 1.90 14 4 OE1 A GLU 137 ? ? HD3 A LYS 191 ? ? 1.37 15 4 O A THR 204 ? ? H A LEU 208 ? ? 1.55 16 5 O A ASN 198 ? ? OE1 A GLU 200 ? ? 1.34 17 5 HA A ALA 119 ? ? OE2 A GLU 160 ? ? 1.46 18 5 OD1 A ASP 193 ? ? H A GLY 195 ? ? 1.60 19 5 OD1 A ASP 193 ? ? N A GLU 194 ? ? 1.63 20 5 O A ASN 198 ? ? CD A GLU 200 ? ? 1.99 21 5 O A GLY 126 ? ? OE1 A GLU 130 ? ? 2.17 22 6 H3 A ALA 119 ? ? OE1 A GLU 160 ? ? 1.21 23 6 OD2 A ASP 146 ? ? HB3 A SER 149 ? ? 1.29 24 6 N A ALA 119 ? ? OE1 A GLU 160 ? ? 2.09 25 6 OD2 A ASP 146 ? ? CB A SER 149 ? ? 2.16 26 7 OD1 A ASP 125 ? ? HB3 A ASP 174 ? ? 1.45 27 7 HA A ALA 119 ? ? OE2 A GLU 160 ? ? 1.54 28 7 O A VAL 140 ? ? H A GLY 168 ? ? 1.54 29 7 OD1 A ASP 146 ? ? HG A SER 149 ? ? 1.56 30 7 OD1 A ASP 146 ? ? OG A SER 149 ? ? 1.58 31 7 OD1 A ASP 125 ? ? CB A ASP 174 ? ? 1.83 32 7 OD2 A ASP 125 ? ? CG A ASP 174 ? ? 1.91 33 7 OE2 A GLU 202 ? ? CG2 A THR 204 ? ? 2.01 34 7 OD2 A ASP 125 ? ? OD1 A ASP 174 ? ? 2.04 35 7 OD1 A ASP 146 ? ? CB A SER 149 ? ? 2.08 36 7 OD2 A ASP 125 ? ? OD2 A ASP 174 ? ? 2.10 37 7 OD1 A ASP 125 ? ? ND2 A ASN 172 ? ? 2.19 38 8 O A ASN 198 ? ? OE1 A GLU 200 ? ? 1.94 39 9 OD1 A ASP 146 ? ? HB3 A SER 149 ? ? 1.18 40 9 O A ALA 139 ? ? H A PHE 189 ? ? 1.59 41 9 OD1 A ASP 146 ? ? CB A SER 149 ? ? 2.14 42 10 O A PRO 124 ? ? HD21 A ASN 172 ? ? 1.55 43 10 H A PHE 143 ? ? O A GLY 185 ? ? 1.59 44 11 OE2 A GLU 130 ? ? HZ2 A LYS 178 ? ? 0.97 45 11 N A ALA 119 ? ? OE2 A GLU 160 ? ? 1.15 46 11 H2 A ALA 119 ? ? OE2 A GLU 160 ? ? 1.20 47 11 OE2 A GLU 130 ? ? NZ A LYS 178 ? ? 1.27 48 11 OD1 A ASP 146 ? ? HB3 A SER 149 ? ? 1.31 49 11 OE2 A GLU 130 ? ? HZ3 A LYS 178 ? ? 1.32 50 11 H3 A ALA 119 ? ? OE2 A GLU 160 ? ? 1.35 51 11 CG A ASP 146 ? ? HB3 A SER 149 ? ? 1.46 52 11 HA A ALA 119 ? ? OE2 A GLU 160 ? ? 1.50 53 11 HA A ALA 119 ? ? CD A GLU 160 ? ? 1.53 54 11 CA A ALA 119 ? ? OE2 A GLU 160 ? ? 1.54 55 11 OD1 A ASP 146 ? ? HG A SER 149 ? ? 1.56 56 11 O A ALA 139 ? ? H A PHE 189 ? ? 1.59 57 11 O A GLY 126 ? ? OE1 A GLU 130 ? ? 1.81 58 11 OD1 A ASP 146 ? ? CB A SER 149 ? ? 2.03 59 11 OE2 A GLU 130 ? ? CE A LYS 178 ? ? 2.10 60 11 OD1 A ASP 146 ? ? OG A SER 149 ? ? 2.14 61 12 OE1 A GLU 222 ? ? H A PHE 223 ? ? 1.47 62 13 OD2 A ASP 125 ? ? OD2 A ASP 174 ? ? 0.97 63 13 OE1 A GLU 202 ? ? HG22 A THR 204 ? ? 1.07 64 13 OD2 A ASP 146 ? ? HG A SER 149 ? ? 1.10 65 13 OD2 A ASP 146 ? ? OG A SER 149 ? ? 1.15 66 13 OD1 A ASP 125 ? ? HB3 A ASP 174 ? ? 1.26 67 13 OD2 A ASP 146 ? ? HB3 A SER 149 ? ? 1.46 68 13 OD2 A ASP 146 ? ? CB A SER 149 ? ? 1.54 69 13 CD A GLU 202 ? ? HG22 A THR 204 ? ? 1.57 70 13 O A PHE 199 ? ? OE1 A GLU 200 ? ? 1.61 71 13 OD2 A ASP 125 ? ? CG A ASP 174 ? ? 1.64 72 13 OD1 A ASP 125 ? ? CB A ASP 174 ? ? 1.86 73 13 OE1 A GLU 202 ? ? CG2 A THR 204 ? ? 1.95 74 13 OE2 A GLU 202 ? ? CG2 A THR 204 ? ? 1.96 75 13 O A ASN 198 ? ? OE2 A GLU 200 ? ? 2.03 76 13 OD1 A ASP 125 ? ? ND2 A ASN 172 ? ? 2.04 77 13 CG A ASP 125 ? ? OD2 A ASP 174 ? ? 2.08 78 13 CE1 A PHE 144 ? ? OD2 A ASP 184 ? ? 2.12 79 13 CD A GLU 202 ? ? CG2 A THR 204 ? ? 2.18 80 14 O A GLU 130 ? ? OE1 A GLU 134 ? ? 1.97 81 15 OD2 A ASP 146 ? ? HB3 A SER 149 ? ? 0.97 82 15 O A PHE 199 ? ? OE1 A GLU 200 ? ? 1.04 83 15 OD1 A ASP 125 ? ? HB3 A ASP 174 ? ? 1.07 84 15 OD2 A ASP 125 ? ? CG A ASP 174 ? ? 1.36 85 15 C A PHE 199 ? ? OE1 A GLU 200 ? ? 1.44 86 15 OD2 A ASP 125 ? ? OD1 A ASP 174 ? ? 1.73 87 15 OD1 A ASP 125 ? ? CB A ASP 174 ? ? 1.73 88 15 OD2 A ASP 125 ? ? OD2 A ASP 174 ? ? 1.75 89 15 OD1 A ASP 125 ? ? ND2 A ASN 172 ? ? 1.82 90 15 OD2 A ASP 146 ? ? CB A SER 149 ? ? 1.99 91 15 O A ASN 198 ? ? OE2 A GLU 200 ? ? 2.02 92 15 CG A ASP 125 ? ? CG A ASP 174 ? ? 2.17 93 16 H1 A ALA 119 ? ? OE2 A GLU 160 ? ? 1.07 94 16 N A ALA 119 ? ? OE2 A GLU 160 ? ? 1.45 95 16 H1 A ALA 119 ? ? CD A GLU 160 ? ? 1.52 96 16 O A THR 224 ? ? OE1 A GLU 225 ? ? 1.61 97 16 CA A ALA 119 ? ? OE2 A GLU 160 ? ? 1.70 98 17 O A LEU 132 ? ? HG A SER 135 ? ? 1.56 99 17 O A THR 121 ? ? H A ILE 169 ? ? 1.57 100 17 O A PRO 124 ? ? HD21 A ASN 172 ? ? 1.60 101 17 O A THR 224 ? ? OE1 A GLU 225 ? ? 1.62 102 17 O A ASN 198 ? ? OE1 A GLU 200 ? ? 1.68 103 17 CE1 A PHE 144 ? ? OD2 A ASP 184 ? ? 1.81 104 17 O A ASN 198 ? ? CD A GLU 200 ? ? 2.06 105 17 O A ASN 198 ? ? OE2 A GLU 200 ? ? 2.16 106 18 OD2 A ASP 146 ? ? HB3 A SER 149 ? ? 0.98 107 18 O A THR 204 ? ? H A LEU 208 ? ? 1.53 108 18 CE1 A PHE 144 ? ? OD2 A ASP 184 ? ? 1.79 109 18 CD1 A PHE 144 ? ? OD2 A ASP 184 ? ? 1.99 110 18 OD2 A ASP 146 ? ? CB A SER 149 ? ? 2.05 111 19 C A GLY 201 ? ? OE1 A GLU 202 ? ? 1.20 112 19 O A ASN 198 ? ? OE1 A GLU 200 ? ? 1.21 113 19 HD21 A ASN 198 ? ? OE2 A GLU 200 ? ? 1.25 114 19 OD1 A ASP 146 ? ? HB3 A SER 149 ? ? 1.31 115 19 O A THR 204 ? ? H A LEU 208 ? ? 1.60 116 19 C A ASN 198 ? ? OE1 A GLU 200 ? ? 1.98 117 20 HA A ASN 207 ? ? OD2 A ASP 210 ? ? 1.17 118 20 O A GLY 126 ? ? OE1 A GLU 130 ? ? 1.18 119 20 OE2 A GLU 130 ? ? HZ2 A LYS 178 ? ? 1.22 120 20 O A THR 204 ? ? H A LEU 208 ? ? 1.59 121 20 C A GLY 126 ? ? OE1 A GLU 130 ? ? 2.04 122 20 CA A ASN 207 ? ? OD2 A ASP 210 ? ? 2.11 123 21 OE2 A GLU 225 ? ? HB2 A GLN 226 ? ? 1.41 124 21 OD1 A ASP 163 ? ? HG12 A ILE 165 ? ? 1.47 125 21 OD1 A ASP 163 ? ? CG1 A ILE 165 ? ? 1.89 126 21 OD1 A ASP 163 ? ? CD1 A ILE 165 ? ? 2.12 127 22 OE1 A GLU 137 ? ? HD3 A LYS 191 ? ? 1.47 128 22 O A SER 131 ? ? HG A SER 135 ? ? 1.49 129 23 OD1 A ASP 193 ? ? N A GLU 194 ? ? 1.55 130 23 O A ASP 210 ? ? H A HIS 214 ? ? 1.58 131 23 H A THR 121 ? ? O A PHE 167 ? ? 1.59 132 23 O A SER 173 ? ? H A SER 177 ? ? 1.60 133 24 O A GLY 126 ? ? OE1 A GLU 130 ? ? 1.27 134 24 HA A ALA 119 ? ? OE2 A GLU 160 ? ? 1.45 135 24 O A GLY 126 ? ? CD A GLU 130 ? ? 1.93 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 172 ? ? -53.56 -177.41 2 1 ASP A 193 ? ? 48.02 -154.52 3 1 ASN A 197 ? ? -133.34 -153.57 4 1 ASN A 198 ? ? -174.57 88.30 5 1 GLU A 200 ? ? -130.00 -151.33 6 1 ASN A 215 ? ? -89.06 -81.99 7 1 LEU A 217 ? ? 54.59 100.03 8 1 LEU A 219 ? ? -61.00 -165.32 9 1 PHE A 223 ? ? 53.83 -170.12 10 1 THR A 224 ? ? -154.61 22.44 11 1 GLN A 226 ? ? -59.54 96.31 12 1 THR A 227 ? ? -140.10 -61.33 13 2 ALA A 139 ? ? -173.13 146.90 14 2 PHE A 143 ? ? -114.07 79.38 15 2 ASP A 193 ? ? 53.54 -160.58 16 2 ASN A 197 ? ? -134.65 -148.90 17 2 ASN A 198 ? ? -173.73 81.25 18 2 LEU A 217 ? ? -145.53 57.95 19 2 GLU A 222 ? ? 52.90 89.27 20 2 PHE A 223 ? ? -55.39 171.37 21 2 GLN A 226 ? ? -146.17 -55.82 22 3 ASP A 125 ? ? 179.40 -170.03 23 3 ALA A 139 ? ? -175.27 130.45 24 3 ASP A 193 ? ? 48.79 -159.17 25 3 ASN A 197 ? ? -134.47 -37.30 26 3 ASN A 198 ? ? 57.73 83.29 27 3 ASN A 215 ? ? -91.89 -64.41 28 3 PRO A 218 ? ? -77.39 -168.54 29 3 GLU A 222 ? ? -136.00 -72.63 30 3 PHE A 223 ? ? -108.50 -169.40 31 4 ALA A 139 ? ? -174.40 137.79 32 4 PHE A 143 ? ? -103.48 71.25 33 4 VAL A 147 ? ? 72.97 -51.08 34 4 SER A 149 ? ? -70.34 -164.68 35 4 ASP A 163 ? ? -145.23 19.20 36 4 LYS A 183 ? ? -175.26 -157.40 37 4 ASP A 193 ? ? 46.22 -159.13 38 4 ASN A 198 ? ? -156.82 80.69 39 4 GLU A 202 ? ? -55.96 107.52 40 4 ILE A 221 ? ? 52.67 85.17 41 4 GLU A 222 ? ? -162.52 104.33 42 4 GLU A 225 ? ? -99.00 -69.99 43 5 ALA A 139 ? ? -175.27 126.34 44 5 SER A 149 ? ? -85.97 -159.52 45 5 LYS A 183 ? ? 179.13 -163.34 46 5 ASP A 193 ? ? 51.95 -159.73 47 5 ASN A 197 ? ? -128.72 -151.31 48 5 ASN A 198 ? ? -174.37 78.37 49 5 VAL A 203 ? ? -51.33 102.26 50 5 VAL A 220 ? ? -150.14 59.31 51 5 GLN A 226 ? ? 53.94 82.49 52 5 THR A 227 ? ? -56.69 94.36 53 6 ASP A 125 ? ? -170.50 -169.93 54 6 ALA A 139 ? ? -170.89 121.94 55 6 PHE A 143 ? ? -101.63 67.48 56 6 LYS A 183 ? ? -152.51 -159.74 57 6 ASP A 193 ? ? 47.23 -154.67 58 6 ASN A 197 ? ? -134.93 -44.99 59 6 ASN A 198 ? ? 65.46 89.04 60 6 LEU A 219 ? ? -59.74 104.07 61 6 PHE A 223 ? ? 56.53 168.23 62 6 THR A 224 ? ? -109.71 72.36 63 6 GLU A 225 ? ? -152.18 64.03 64 6 THR A 227 ? ? -143.40 47.06 65 7 LYS A 183 ? ? -171.09 -174.67 66 7 ASP A 193 ? ? 51.93 -159.43 67 7 ASN A 197 ? ? -132.49 -34.70 68 7 ASN A 198 ? ? 61.89 87.81 69 7 ASN A 215 ? ? -88.48 -79.68 70 7 GLN A 216 ? ? -64.97 -174.79 71 7 LEU A 217 ? ? 52.81 89.76 72 7 GLU A 222 ? ? -128.43 -150.28 73 7 THR A 224 ? ? 55.70 -86.17 74 7 GLU A 225 ? ? 55.70 79.67 75 7 GLN A 226 ? ? 52.92 -178.20 76 7 THR A 227 ? ? -154.25 -43.51 77 8 SER A 149 ? ? -86.27 -156.92 78 8 ASP A 163 ? ? -142.28 21.92 79 8 LYS A 183 ? ? -162.73 -163.91 80 8 ASP A 193 ? ? 50.94 -159.10 81 8 ASN A 198 ? ? 58.11 83.93 82 8 ASN A 215 ? ? -89.27 -79.62 83 8 GLN A 216 ? ? -59.02 -171.62 84 8 GLU A 225 ? ? 56.98 -86.14 85 8 THR A 227 ? ? 52.68 78.59 86 9 ASP A 125 ? ? -179.71 -171.13 87 9 ALA A 139 ? ? -174.42 142.05 88 9 PHE A 143 ? ? -101.95 76.29 89 9 SER A 149 ? ? -78.93 -165.25 90 9 LYS A 183 ? ? -175.29 -142.25 91 9 ASP A 193 ? ? 47.22 -159.46 92 9 ASN A 197 ? ? -138.44 -152.67 93 9 ASN A 198 ? ? -175.57 76.69 94 9 ASN A 215 ? ? -97.66 -61.26 95 9 LEU A 219 ? ? 49.53 179.51 96 9 VAL A 220 ? ? -146.01 46.59 97 9 PHE A 223 ? ? 52.68 74.10 98 9 THR A 224 ? ? -91.89 -159.49 99 10 ALA A 139 ? ? -176.03 139.52 100 10 PHE A 143 ? ? -103.20 66.56 101 10 ASP A 163 ? ? -69.42 62.89 102 10 GLN A 180 ? ? 53.83 70.63 103 10 LYS A 183 ? ? -175.20 -145.02 104 10 ASP A 193 ? ? 50.43 -160.15 105 10 ASN A 197 ? ? -141.96 -152.39 106 10 ASN A 198 ? ? -171.57 79.81 107 10 LEU A 219 ? ? -103.26 53.75 108 10 PHE A 223 ? ? -168.88 60.29 109 10 GLN A 226 ? ? -112.54 -71.94 110 11 ASP A 125 ? ? -172.76 -170.33 111 11 ALA A 139 ? ? -172.15 146.00 112 11 SER A 149 ? ? -81.00 -159.36 113 11 LYS A 183 ? ? -163.75 -148.22 114 11 ASP A 193 ? ? 49.87 -159.92 115 11 ASN A 197 ? ? -144.22 -155.21 116 11 ASN A 198 ? ? -169.52 86.93 117 11 ILE A 221 ? ? -111.85 54.82 118 11 PHE A 223 ? ? -150.63 46.65 119 11 GLU A 225 ? ? 52.52 -166.54 120 11 GLN A 226 ? ? 53.47 90.99 121 11 THR A 227 ? ? 55.86 170.49 122 12 ALA A 139 ? ? -173.99 133.26 123 12 PHE A 143 ? ? -105.36 67.20 124 12 ASP A 184 ? ? -58.65 -173.18 125 12 ASP A 193 ? ? 50.01 -160.00 126 12 ASN A 197 ? ? -142.53 -151.76 127 12 ASN A 198 ? ? -176.51 79.31 128 12 ILE A 212 ? ? -48.53 -72.52 129 12 GLU A 222 ? ? -171.88 -152.70 130 12 PHE A 223 ? ? 53.47 -151.37 131 12 THR A 224 ? ? -49.88 156.37 132 12 GLU A 225 ? ? -167.41 71.40 133 13 ALA A 139 ? ? -176.75 138.51 134 13 PHE A 143 ? ? -100.24 70.03 135 13 VAL A 147 ? ? 73.10 -51.53 136 13 SER A 149 ? ? -70.01 -163.87 137 13 LYS A 183 ? ? -168.84 -146.96 138 13 ASP A 193 ? ? 48.91 -158.37 139 13 ASN A 197 ? ? -142.70 -153.70 140 13 ASN A 198 ? ? -171.94 80.93 141 13 ASN A 215 ? ? -92.25 -60.06 142 13 GLN A 216 ? ? -85.09 -143.56 143 13 LEU A 219 ? ? 50.93 92.60 144 13 VAL A 220 ? ? -90.29 41.02 145 13 ILE A 221 ? ? -140.65 27.92 146 14 ALA A 139 ? ? -174.95 136.75 147 14 PRO A 166 ? ? -68.59 91.30 148 14 ASP A 193 ? ? 54.68 -160.34 149 14 ASN A 197 ? ? -147.63 -155.11 150 14 ASN A 198 ? ? -169.44 85.48 151 14 GLN A 216 ? ? -85.57 43.87 152 14 LEU A 217 ? ? -154.92 57.11 153 14 GLU A 222 ? ? -170.02 65.99 154 14 GLU A 225 ? ? -109.33 -66.82 155 15 ALA A 139 ? ? -175.85 137.36 156 15 LYS A 183 ? ? -134.17 -149.24 157 15 ASP A 193 ? ? 44.55 -158.24 158 15 ASN A 197 ? ? -144.54 -152.29 159 15 ASN A 198 ? ? -173.77 76.06 160 15 GLN A 216 ? ? -41.18 -72.60 161 15 THR A 224 ? ? 52.11 86.50 162 15 THR A 227 ? ? -154.67 56.32 163 16 ASP A 125 ? ? -173.27 -170.46 164 16 ALA A 139 ? ? -173.64 138.06 165 16 PHE A 143 ? ? -112.97 72.84 166 16 SER A 149 ? ? -69.95 -159.69 167 16 ASP A 193 ? ? 46.52 -157.97 168 16 ASN A 197 ? ? -138.21 -151.51 169 16 ASN A 198 ? ? -175.60 77.00 170 16 LEU A 219 ? ? 42.63 76.58 171 16 GLU A 222 ? ? -131.29 -77.15 172 16 PHE A 223 ? ? -100.26 74.58 173 17 ALA A 139 ? ? -175.26 127.11 174 17 SER A 149 ? ? -78.61 -164.73 175 17 LYS A 183 ? ? -175.94 -165.91 176 17 ASP A 193 ? ? 47.68 -159.06 177 17 ASN A 197 ? ? -136.49 -153.82 178 17 ASN A 198 ? ? -172.89 80.84 179 17 VAL A 203 ? ? -66.95 83.28 180 17 LEU A 219 ? ? 50.57 96.23 181 17 VAL A 220 ? ? -105.03 42.24 182 17 GLU A 222 ? ? 51.88 -170.21 183 17 GLU A 225 ? ? -117.24 -161.50 184 18 ASP A 125 ? ? -163.26 -169.50 185 18 ALA A 139 ? ? -176.38 125.42 186 18 PHE A 143 ? ? -105.87 69.07 187 18 SER A 149 ? ? -75.55 -164.89 188 18 TYR A 179 ? ? -94.78 30.47 189 18 GLN A 180 ? ? 29.57 62.02 190 18 LYS A 183 ? ? -174.77 -147.06 191 18 ASP A 193 ? ? 56.11 -153.86 192 18 ASN A 197 ? ? -139.70 -44.64 193 18 ASN A 198 ? ? 63.66 87.42 194 18 ASN A 215 ? ? -95.55 -61.99 195 18 VAL A 220 ? ? -96.58 57.01 196 18 THR A 227 ? ? -137.92 -51.59 197 19 ALA A 139 ? ? -170.47 144.55 198 19 PHE A 143 ? ? -101.74 78.98 199 19 SER A 149 ? ? -78.52 -164.37 200 19 ASP A 193 ? ? 48.00 -159.11 201 19 ASN A 197 ? ? -141.89 -152.73 202 19 ASN A 198 ? ? -175.43 79.10 203 19 VAL A 203 ? ? -51.17 93.86 204 19 ILE A 212 ? ? -48.92 -71.29 205 19 ILE A 221 ? ? -172.01 124.10 206 19 PHE A 223 ? ? -145.09 37.20 207 20 ASP A 125 ? ? -173.77 -169.88 208 20 ALA A 139 ? ? -175.32 142.61 209 20 ASP A 163 ? ? -136.73 -40.61 210 20 LYS A 183 ? ? -162.49 -165.30 211 20 ASP A 193 ? ? 47.08 -159.24 212 20 ASN A 197 ? ? -131.66 -35.12 213 20 ASN A 198 ? ? 63.71 85.45 214 20 ILE A 212 ? ? -50.72 -73.32 215 20 GLN A 216 ? ? -51.52 178.66 216 20 LEU A 217 ? ? 53.32 72.88 217 20 LEU A 219 ? ? -110.37 -168.76 218 20 ILE A 221 ? ? -105.19 77.45 219 21 ALA A 120 ? ? -59.44 -178.27 220 21 ASP A 125 ? ? -174.31 -170.64 221 21 PHE A 143 ? ? -103.95 69.69 222 21 ASP A 163 ? ? -69.48 63.36 223 21 ASP A 193 ? ? 48.04 -154.77 224 21 ASN A 197 ? ? -145.36 -155.33 225 21 ASN A 198 ? ? -171.02 81.77 226 21 ILE A 221 ? ? 53.74 98.27 227 21 THR A 224 ? ? -143.86 42.38 228 21 GLU A 225 ? ? 54.49 -90.32 229 21 GLN A 226 ? ? 178.79 -63.73 230 22 ALA A 139 ? ? -173.76 134.13 231 22 ASP A 193 ? ? 47.01 -159.67 232 22 ASN A 197 ? ? -125.15 -153.91 233 22 ASN A 198 ? ? -178.77 78.12 234 22 VAL A 203 ? ? -58.84 91.38 235 22 LEU A 219 ? ? -94.43 56.45 236 22 GLU A 225 ? ? -116.29 73.48 237 22 GLN A 226 ? ? -164.35 66.63 238 23 SER A 149 ? ? -75.19 -166.29 239 23 ASP A 163 ? ? -147.11 19.16 240 23 ASP A 193 ? ? 46.79 -158.76 241 23 ASN A 197 ? ? -134.14 -40.36 242 23 ASN A 198 ? ? 63.98 94.23 243 23 GLU A 200 ? ? -121.00 -147.38 244 23 GLN A 216 ? ? -46.55 156.10 245 23 LEU A 217 ? ? 54.94 92.70 246 23 GLU A 222 ? ? -149.33 -57.60 247 23 PHE A 223 ? ? -128.08 -52.58 248 24 ALA A 139 ? ? -173.41 134.48 249 24 PHE A 143 ? ? -100.74 78.77 250 24 LYS A 183 ? ? -178.60 -163.37 251 24 ASP A 193 ? ? 47.89 -155.42 252 24 ASN A 197 ? ? -139.45 -148.16 253 24 ASN A 198 ? ? -175.54 84.27 254 24 ASN A 215 ? ? -89.31 -70.41 255 24 LEU A 217 ? ? 53.59 99.34 256 24 VAL A 220 ? ? -102.16 60.16 257 24 GLU A 222 ? ? -149.69 26.02 258 24 PHE A 223 ? ? 59.22 157.40 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 196 ? ? 0.267 'SIDE CHAIN' 2 2 ARG A 196 ? ? 0.318 'SIDE CHAIN' 3 3 ARG A 196 ? ? 0.203 'SIDE CHAIN' 4 4 ARG A 196 ? ? 0.311 'SIDE CHAIN' 5 5 ARG A 196 ? ? 0.276 'SIDE CHAIN' 6 6 ARG A 196 ? ? 0.222 'SIDE CHAIN' 7 7 ARG A 196 ? ? 0.293 'SIDE CHAIN' 8 8 ARG A 196 ? ? 0.169 'SIDE CHAIN' 9 9 ARG A 196 ? ? 0.297 'SIDE CHAIN' 10 10 ARG A 196 ? ? 0.297 'SIDE CHAIN' 11 11 ARG A 196 ? ? 0.317 'SIDE CHAIN' 12 12 ARG A 196 ? ? 0.317 'SIDE CHAIN' 13 13 ARG A 196 ? ? 0.264 'SIDE CHAIN' 14 14 ARG A 196 ? ? 0.257 'SIDE CHAIN' 15 15 ARG A 196 ? ? 0.185 'SIDE CHAIN' 16 16 ARG A 196 ? ? 0.317 'SIDE CHAIN' 17 17 ARG A 196 ? ? 0.231 'SIDE CHAIN' 18 18 ARG A 196 ? ? 0.289 'SIDE CHAIN' 19 19 ARG A 196 ? ? 0.232 'SIDE CHAIN' 20 20 ARG A 196 ? ? 0.266 'SIDE CHAIN' 21 21 ARG A 196 ? ? 0.236 'SIDE CHAIN' 22 22 ARG A 196 ? ? 0.314 'SIDE CHAIN' 23 23 ARG A 196 ? ? 0.196 'SIDE CHAIN' 24 24 ARG A 196 ? ? 0.206 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1BJX _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 24 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_refine.entry_id 1BJX _pdbx_nmr_refine.method 'DISTANCE GEOMETRY AND SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR ? BRUNGER 1 'structure solution' X-PLOR ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TYR N N N N 284 TYR CA C N S 285 TYR C C N N 286 TYR O O N N 287 TYR CB C N N 288 TYR CG C Y N 289 TYR CD1 C Y N 290 TYR CD2 C Y N 291 TYR CE1 C Y N 292 TYR CE2 C Y N 293 TYR CZ C Y N 294 TYR OH O N N 295 TYR OXT O N N 296 TYR H H N N 297 TYR H2 H N N 298 TYR HA H N N 299 TYR HB2 H N N 300 TYR HB3 H N N 301 TYR HD1 H N N 302 TYR HD2 H N N 303 TYR HE1 H N N 304 TYR HE2 H N N 305 TYR HH H N N 306 TYR HXT H N N 307 VAL N N N N 308 VAL CA C N S 309 VAL C C N N 310 VAL O O N N 311 VAL CB C N N 312 VAL CG1 C N N 313 VAL CG2 C N N 314 VAL OXT O N N 315 VAL H H N N 316 VAL H2 H N N 317 VAL HA H N N 318 VAL HB H N N 319 VAL HG11 H N N 320 VAL HG12 H N N 321 VAL HG13 H N N 322 VAL HG21 H N N 323 VAL HG22 H N N 324 VAL HG23 H N N 325 VAL HXT H N N 326 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TYR N CA sing N N 272 TYR N H sing N N 273 TYR N H2 sing N N 274 TYR CA C sing N N 275 TYR CA CB sing N N 276 TYR CA HA sing N N 277 TYR C O doub N N 278 TYR C OXT sing N N 279 TYR CB CG sing N N 280 TYR CB HB2 sing N N 281 TYR CB HB3 sing N N 282 TYR CG CD1 doub Y N 283 TYR CG CD2 sing Y N 284 TYR CD1 CE1 sing Y N 285 TYR CD1 HD1 sing N N 286 TYR CD2 CE2 doub Y N 287 TYR CD2 HD2 sing N N 288 TYR CE1 CZ doub Y N 289 TYR CE1 HE1 sing N N 290 TYR CE2 CZ sing Y N 291 TYR CE2 HE2 sing N N 292 TYR CZ OH sing N N 293 TYR OH HH sing N N 294 TYR OXT HXT sing N N 295 VAL N CA sing N N 296 VAL N H sing N N 297 VAL N H2 sing N N 298 VAL CA C sing N N 299 VAL CA CB sing N N 300 VAL CA HA sing N N 301 VAL C O doub N N 302 VAL C OXT sing N N 303 VAL CB CG1 sing N N 304 VAL CB CG2 sing N N 305 VAL CB HB sing N N 306 VAL CG1 HG11 sing N N 307 VAL CG1 HG12 sing N N 308 VAL CG1 HG13 sing N N 309 VAL CG2 HG21 sing N N 310 VAL CG2 HG22 sing N N 311 VAL CG2 HG23 sing N N 312 VAL OXT HXT sing N N 313 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 'UNITY INOVA' Varian 600 2 AMX600 Bruker 600 # _atom_sites.entry_id 1BJX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_