data_1BMB # _entry.id 1BMB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1BMB RCSB RCSB008211 WWPDB D_1000008211 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BMB _pdbx_database_status.recvd_initial_deposition_date 1998-07-23 _pdbx_database_status.deposit_site BNL _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rondeau, J.M.' 1 'Zurini, M.' 2 # _citation.id primary _citation.title 'Structural and conformational requirements for high-affinity binding to the SH2 domain of Grb2(1).' _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 42 _citation.page_first 971 _citation.page_last 980 _citation.year 1999 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10090780 _citation.pdbx_database_id_DOI 10.1021/jm9811007 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ettmayer, P.' 1 primary 'France, D.' 2 primary 'Gounarides, J.' 3 primary 'Jarosinski, M.' 4 primary 'Martin, M.S.' 5 primary 'Rondeau, J.M.' 6 primary 'Sabio, M.' 7 primary 'Topiol, S.' 8 primary 'Weidmann, B.' 9 primary 'Zurini, M.' 10 primary 'Bair, K.W.' 11 # _cell.entry_id 1BMB _cell.length_a 51.130 _cell.length_b 51.130 _cell.length_c 90.250 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BMB _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (GROWTH FACTOR RECEPTOR BOUND PROTEIN 2)' 14346.239 1 ? ? 'SH2 DOMAIN' ? 2 polymer syn 'PROTEIN (PKF270-974)' 1223.288 1 ? ? '174-182 OF BCR-ABL' 'PTR: PHOSPHOTYROSINE' 3 water nat water 18.015 115 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GRB2 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGSPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKF NSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFD ; ;MGSPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKF NSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFD ; A ? 2 'polypeptide(L)' no yes 'KPF(PTR)VNVEF' KPFYVNVEF I ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 PRO n 1 5 LYS n 1 6 ASN n 1 7 TYR n 1 8 ILE n 1 9 GLU n 1 10 MET n 1 11 LYS n 1 12 PRO n 1 13 HIS n 1 14 PRO n 1 15 TRP n 1 16 PHE n 1 17 PHE n 1 18 GLY n 1 19 LYS n 1 20 ILE n 1 21 PRO n 1 22 ARG n 1 23 ALA n 1 24 LYS n 1 25 ALA n 1 26 GLU n 1 27 GLU n 1 28 MET n 1 29 LEU n 1 30 SER n 1 31 LYS n 1 32 GLN n 1 33 ARG n 1 34 HIS n 1 35 ASP n 1 36 GLY n 1 37 ALA n 1 38 PHE n 1 39 LEU n 1 40 ILE n 1 41 ARG n 1 42 GLU n 1 43 SER n 1 44 GLU n 1 45 SER n 1 46 ALA n 1 47 PRO n 1 48 GLY n 1 49 ASP n 1 50 PHE n 1 51 SER n 1 52 LEU n 1 53 SER n 1 54 VAL n 1 55 LYS n 1 56 PHE n 1 57 GLY n 1 58 ASN n 1 59 ASP n 1 60 VAL n 1 61 GLN n 1 62 HIS n 1 63 PHE n 1 64 LYS n 1 65 VAL n 1 66 LEU n 1 67 ARG n 1 68 ASP n 1 69 GLY n 1 70 ALA n 1 71 GLY n 1 72 LYS n 1 73 TYR n 1 74 PHE n 1 75 LEU n 1 76 TRP n 1 77 VAL n 1 78 VAL n 1 79 LYS n 1 80 PHE n 1 81 ASN n 1 82 SER n 1 83 LEU n 1 84 ASN n 1 85 GLU n 1 86 LEU n 1 87 VAL n 1 88 ASP n 1 89 TYR n 1 90 HIS n 1 91 ARG n 1 92 SER n 1 93 THR n 1 94 SER n 1 95 VAL n 1 96 SER n 1 97 ARG n 1 98 ASN n 1 99 GLN n 1 100 GLN n 1 101 ILE n 1 102 PHE n 1 103 LEU n 1 104 ARG n 1 105 ASP n 1 106 ILE n 1 107 GLU n 1 108 GLN n 1 109 VAL n 1 110 PRO n 1 111 GLN n 1 112 GLN n 1 113 PRO n 1 114 THR n 1 115 TYR n 1 116 VAL n 1 117 GLN n 1 118 ALA n 1 119 LEU n 1 120 PHE n 1 121 ASP n 1 122 PHE n 1 123 ASP n 2 1 LYS n 2 2 PRO n 2 3 PHE n 2 4 PTR n 2 5 VAL n 2 6 ASN n 2 7 VAL n 2 8 GLU n 2 9 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene GRB2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location CYTOPLASM _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant PLYSS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location CYTOPLASM _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'THE PROTEIN WAS CHEMICALLY SYNTHESIZED' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP GRB2_HUMAN 1 P62993 ? ? ? 2 PDB 1BMB 2 1BMB ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1BMB A 1 ? 123 ? P62993 46 ? 168 ? 46 168 2 2 1BMB I 1 ? 9 ? 1BMB 1 ? 9 ? 1 9 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1BMB MET A 1 ? UNP P62993 GLY 46 'CLONING ARTIFACT' 46 1 1 1BMB GLY A 2 ? UNP P62993 PHE 47 'CLONING ARTIFACT' 47 2 1 1BMB SER A 3 ? UNP P62993 ILE 48 'CLONING ARTIFACT' 48 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BMB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.2 _exptl_crystal.density_percent_sol 44 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details ;PROTEIN (15MG/ML IN 100MM SODIUM CHLORIDE, 0.02% SODIUM AZIDE) WAS CRYSTALLIZED FROM 46% SATURATED AMMONIUM SULFATE, 100MM SODIUM MES PH 6.5, IN PRESENCE OF A 2-FOLD EXCESS OF LIGAND ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'MAC Science DIP-2020' _diffrn_detector.pdbx_collection_date 1996-09-19 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DOUBLE MIRRORS' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'ENRAF-NONIUS FR591' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BMB _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 10.0 _reflns.d_resolution_high 1.80 _reflns.number_obs 11579 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.0740000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.5 _reflns.B_iso_Wilson_estimate 15.5 _reflns.pdbx_redundancy 8.7 _reflns.R_free_details ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.83 _reflns_shell.percent_possible_all 99.8 _reflns_shell.Rmerge_I_obs 0.1990000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.6 _reflns_shell.pdbx_redundancy 8.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1BMB _refine.ls_number_reflns_obs 11579 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 100000000.00 _refine.pdbx_data_cutoff_low_absF 0.00000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.00 _refine.ls_d_res_high 1.80 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.1870000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1870000 _refine.ls_R_factor_R_free 0.2180000 _refine.ls_R_factor_R_free_error 0.006 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.4 _refine.ls_number_reflns_R_free 1202 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 22.5 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1GRI' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1BMB _refine_analyze.Luzzati_coordinate_error_obs 0.18 _refine_analyze.Luzzati_sigma_a_obs 0.16 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.20 _refine_analyze.Luzzati_sigma_a_free 0.14 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 903 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 115 _refine_hist.number_atoms_total 1018 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 10.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 25.8 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.10 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 1.95 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 3.26 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 3.50 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 5.62 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.80 _refine_ls_shell.d_res_low 1.91 _refine_ls_shell.number_reflns_R_work 1660 _refine_ls_shell.R_factor_R_work 0.2690000 _refine_ls_shell.percent_reflns_obs 100.0 _refine_ls_shell.R_factor_R_free 0.2770000 _refine_ls_shell.R_factor_R_free_error 0.019 _refine_ls_shell.percent_reflns_R_free 11.2 _refine_ls_shell.number_reflns_R_free 209 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 2 WATER.PAR WATER.TOP 'X-RAY DIFFRACTION' 3 PO4.PAR ? 'X-RAY DIFFRACTION' # _struct.entry_id 1BMB _struct.title 'GRB2-SH2 DOMAIN IN COMPLEX WITH KPFY*VNVEF (PKF270-974)' _struct.pdbx_descriptor 'GROWTH FACTOR RECEPTOR BOUND PROTEIN 2, PKF270-974' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BMB _struct_keywords.pdbx_keywords 'HORMONE/GROWTH FACTOR' _struct_keywords.text 'SH2 DOMAIN, SIGNAL TRANSDUCTION, ADAPTOR PROTEIN, RAS PATHWAY, HORMONE-GROWTH FACTOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 22 ? LYS A 31 ? ARG A 67 LYS A 76 1 ? 10 HELX_P HELX_P2 2 LEU A 83 ? ARG A 91 ? LEU A 128 ARG A 136 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? B PHE 3 C ? ? ? 1_555 B PTR 4 N ? ? I PHE 3 I PTR 4 1_555 ? ? ? ? ? ? ? 1.325 ? covale2 covale ? ? B PTR 4 C ? ? ? 1_555 B VAL 5 N ? ? I PTR 4 I VAL 5 1_555 ? ? ? ? ? ? ? 1.324 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 38 ? GLU A 42 ? PHE A 83 GLU A 87 A 2 PHE A 50 ? PHE A 56 ? PHE A 95 PHE A 101 A 3 ASP A 59 ? LYS A 64 ? ASP A 104 LYS A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 39 ? O LEU A 84 N SER A 53 ? N SER A 98 A 2 3 O LEU A 52 ? O LEU A 97 N PHE A 63 ? N PHE A 108 # _database_PDB_matrix.entry_id 1BMB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BMB _atom_sites.fract_transf_matrix[1][1] 0.019558 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019558 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011080 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 46 ? ? ? A . n A 1 2 GLY 2 47 ? ? ? A . n A 1 3 SER 3 48 ? ? ? A . n A 1 4 PRO 4 49 ? ? ? A . n A 1 5 LYS 5 50 ? ? ? A . n A 1 6 ASN 6 51 ? ? ? A . n A 1 7 TYR 7 52 ? ? ? A . n A 1 8 ILE 8 53 ? ? ? A . n A 1 9 GLU 9 54 ? ? ? A . n A 1 10 MET 10 55 ? ? ? A . n A 1 11 LYS 11 56 56 LYS LYS A . n A 1 12 PRO 12 57 57 PRO PRO A . n A 1 13 HIS 13 58 58 HIS HIS A . n A 1 14 PRO 14 59 59 PRO PRO A . n A 1 15 TRP 15 60 60 TRP TRP A . n A 1 16 PHE 16 61 61 PHE PHE A . n A 1 17 PHE 17 62 62 PHE PHE A . n A 1 18 GLY 18 63 63 GLY GLY A . n A 1 19 LYS 19 64 64 LYS LYS A . n A 1 20 ILE 20 65 65 ILE ILE A . n A 1 21 PRO 21 66 66 PRO PRO A . n A 1 22 ARG 22 67 67 ARG ARG A . n A 1 23 ALA 23 68 68 ALA ALA A . n A 1 24 LYS 24 69 69 LYS LYS A . n A 1 25 ALA 25 70 70 ALA ALA A . n A 1 26 GLU 26 71 71 GLU GLU A . n A 1 27 GLU 27 72 72 GLU GLU A . n A 1 28 MET 28 73 73 MET MET A . n A 1 29 LEU 29 74 74 LEU LEU A . n A 1 30 SER 30 75 75 SER SER A . n A 1 31 LYS 31 76 76 LYS LYS A . n A 1 32 GLN 32 77 77 GLN GLN A . n A 1 33 ARG 33 78 78 ARG ARG A . n A 1 34 HIS 34 79 79 HIS HIS A . n A 1 35 ASP 35 80 80 ASP ASP A . n A 1 36 GLY 36 81 81 GLY GLY A . n A 1 37 ALA 37 82 82 ALA ALA A . n A 1 38 PHE 38 83 83 PHE PHE A . n A 1 39 LEU 39 84 84 LEU LEU A . n A 1 40 ILE 40 85 85 ILE ILE A . n A 1 41 ARG 41 86 86 ARG ARG A . n A 1 42 GLU 42 87 87 GLU GLU A . n A 1 43 SER 43 88 88 SER SER A . n A 1 44 GLU 44 89 89 GLU GLU A . n A 1 45 SER 45 90 90 SER SER A . n A 1 46 ALA 46 91 91 ALA ALA A . n A 1 47 PRO 47 92 92 PRO PRO A . n A 1 48 GLY 48 93 93 GLY GLY A . n A 1 49 ASP 49 94 94 ASP ASP A . n A 1 50 PHE 50 95 95 PHE PHE A . n A 1 51 SER 51 96 96 SER SER A . n A 1 52 LEU 52 97 97 LEU LEU A . n A 1 53 SER 53 98 98 SER SER A . n A 1 54 VAL 54 99 99 VAL VAL A . n A 1 55 LYS 55 100 100 LYS LYS A . n A 1 56 PHE 56 101 101 PHE PHE A . n A 1 57 GLY 57 102 102 GLY GLY A . n A 1 58 ASN 58 103 103 ASN ASN A . n A 1 59 ASP 59 104 104 ASP ASP A . n A 1 60 VAL 60 105 105 VAL VAL A . n A 1 61 GLN 61 106 106 GLN GLN A . n A 1 62 HIS 62 107 107 HIS HIS A . n A 1 63 PHE 63 108 108 PHE PHE A . n A 1 64 LYS 64 109 109 LYS LYS A . n A 1 65 VAL 65 110 110 VAL VAL A . n A 1 66 LEU 66 111 111 LEU LEU A . n A 1 67 ARG 67 112 112 ARG ARG A . n A 1 68 ASP 68 113 113 ASP ASP A . n A 1 69 GLY 69 114 114 GLY GLY A . n A 1 70 ALA 70 115 115 ALA ALA A . n A 1 71 GLY 71 116 116 GLY GLY A . n A 1 72 LYS 72 117 117 LYS LYS A . n A 1 73 TYR 73 118 118 TYR TYR A . n A 1 74 PHE 74 119 119 PHE PHE A . n A 1 75 LEU 75 120 120 LEU LEU A . n A 1 76 TRP 76 121 121 TRP TRP A . n A 1 77 VAL 77 122 122 VAL VAL A . n A 1 78 VAL 78 123 123 VAL VAL A . n A 1 79 LYS 79 124 124 LYS LYS A . n A 1 80 PHE 80 125 125 PHE PHE A . n A 1 81 ASN 81 126 126 ASN ASN A . n A 1 82 SER 82 127 127 SER SER A . n A 1 83 LEU 83 128 128 LEU LEU A . n A 1 84 ASN 84 129 129 ASN ASN A . n A 1 85 GLU 85 130 130 GLU GLU A . n A 1 86 LEU 86 131 131 LEU LEU A . n A 1 87 VAL 87 132 132 VAL VAL A . n A 1 88 ASP 88 133 133 ASP ASP A . n A 1 89 TYR 89 134 134 TYR TYR A . n A 1 90 HIS 90 135 135 HIS HIS A . n A 1 91 ARG 91 136 136 ARG ARG A . n A 1 92 SER 92 137 137 SER SER A . n A 1 93 THR 93 138 138 THR THR A . n A 1 94 SER 94 139 139 SER SER A . n A 1 95 VAL 95 140 140 VAL VAL A . n A 1 96 SER 96 141 141 SER SER A . n A 1 97 ARG 97 142 142 ARG ARG A . n A 1 98 ASN 98 143 143 ASN ASN A . n A 1 99 GLN 99 144 144 GLN GLN A . n A 1 100 GLN 100 145 145 GLN GLN A . n A 1 101 ILE 101 146 146 ILE ILE A . n A 1 102 PHE 102 147 147 PHE PHE A . n A 1 103 LEU 103 148 148 LEU LEU A . n A 1 104 ARG 104 149 149 ARG ARG A . n A 1 105 ASP 105 150 150 ASP ASP A . n A 1 106 ILE 106 151 151 ILE ILE A . n A 1 107 GLU 107 152 152 GLU GLU A . n A 1 108 GLN 108 153 153 GLN GLN A . n A 1 109 VAL 109 154 ? ? ? A . n A 1 110 PRO 110 155 ? ? ? A . n A 1 111 GLN 111 156 ? ? ? A . n A 1 112 GLN 112 157 ? ? ? A . n A 1 113 PRO 113 158 ? ? ? A . n A 1 114 THR 114 159 ? ? ? A . n A 1 115 TYR 115 160 ? ? ? A . n A 1 116 VAL 116 161 ? ? ? A . n A 1 117 GLN 117 162 ? ? ? A . n A 1 118 ALA 118 163 ? ? ? A . n A 1 119 LEU 119 164 ? ? ? A . n A 1 120 PHE 120 165 ? ? ? A . n A 1 121 ASP 121 166 ? ? ? A . n A 1 122 PHE 122 167 ? ? ? A . n A 1 123 ASP 123 168 ? ? ? A . n B 2 1 LYS 1 1 1 LYS LYS I . n B 2 2 PRO 2 2 2 PRO PRO I . n B 2 3 PHE 3 3 3 PHE PHE I . n B 2 4 PTR 4 4 4 PTR PTR I . n B 2 5 VAL 5 5 5 VAL VAL I . n B 2 6 ASN 6 6 6 ASN ASN I . n B 2 7 VAL 7 7 7 VAL VAL I . n B 2 8 GLU 8 8 8 GLU GLU I . n B 2 9 PHE 9 9 9 PHE PHE I . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 4 _pdbx_struct_mod_residue.auth_asym_id I _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 4 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details O-PHOSPHOTYROSINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 900 ? 1 MORE -9 ? 1 'SSA (A^2)' 6430 ? 2 'ABSA (A^2)' 3490 ? 2 MORE -30 ? 2 'SSA (A^2)' 11160 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 171 ? C HOH . 2 1 A HOH 215 ? C HOH . 3 1 A HOH 253 ? C HOH . 4 1 A HOH 257 ? C HOH . 5 1 A HOH 264 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-29 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 X-PLOR refinement 3.1 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id TRP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 121 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -132.11 _pdbx_validate_torsion.psi -71.55 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 46 ? A MET 1 2 1 Y 1 A GLY 47 ? A GLY 2 3 1 Y 1 A SER 48 ? A SER 3 4 1 Y 1 A PRO 49 ? A PRO 4 5 1 Y 1 A LYS 50 ? A LYS 5 6 1 Y 1 A ASN 51 ? A ASN 6 7 1 Y 1 A TYR 52 ? A TYR 7 8 1 Y 1 A ILE 53 ? A ILE 8 9 1 Y 1 A GLU 54 ? A GLU 9 10 1 Y 1 A MET 55 ? A MET 10 11 1 Y 1 A VAL 154 ? A VAL 109 12 1 Y 1 A PRO 155 ? A PRO 110 13 1 Y 1 A GLN 156 ? A GLN 111 14 1 Y 1 A GLN 157 ? A GLN 112 15 1 Y 1 A PRO 158 ? A PRO 113 16 1 Y 1 A THR 159 ? A THR 114 17 1 Y 1 A TYR 160 ? A TYR 115 18 1 Y 1 A VAL 161 ? A VAL 116 19 1 Y 1 A GLN 162 ? A GLN 117 20 1 Y 1 A ALA 163 ? A ALA 118 21 1 Y 1 A LEU 164 ? A LEU 119 22 1 Y 1 A PHE 165 ? A PHE 120 23 1 Y 1 A ASP 166 ? A ASP 121 24 1 Y 1 A PHE 167 ? A PHE 122 25 1 Y 1 A ASP 168 ? A ASP 123 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 169 1 HOH HOH A . C 3 HOH 2 170 2 HOH HOH A . C 3 HOH 3 171 3 HOH HOH A . C 3 HOH 4 172 4 HOH HOH A . C 3 HOH 5 173 5 HOH HOH A . C 3 HOH 6 174 6 HOH HOH A . C 3 HOH 7 175 7 HOH HOH A . C 3 HOH 8 176 8 HOH HOH A . C 3 HOH 9 177 9 HOH HOH A . C 3 HOH 10 178 10 HOH HOH A . C 3 HOH 11 179 11 HOH HOH A . C 3 HOH 12 180 12 HOH HOH A . C 3 HOH 13 181 13 HOH HOH A . C 3 HOH 14 182 14 HOH HOH A . C 3 HOH 15 183 16 HOH HOH A . C 3 HOH 16 184 17 HOH HOH A . C 3 HOH 17 185 18 HOH HOH A . C 3 HOH 18 186 19 HOH HOH A . C 3 HOH 19 187 20 HOH HOH A . C 3 HOH 20 188 21 HOH HOH A . C 3 HOH 21 189 22 HOH HOH A . C 3 HOH 22 190 24 HOH HOH A . C 3 HOH 23 191 25 HOH HOH A . C 3 HOH 24 192 26 HOH HOH A . C 3 HOH 25 193 27 HOH HOH A . C 3 HOH 26 194 28 HOH HOH A . C 3 HOH 27 195 29 HOH HOH A . C 3 HOH 28 196 30 HOH HOH A . C 3 HOH 29 197 31 HOH HOH A . C 3 HOH 30 198 32 HOH HOH A . C 3 HOH 31 199 33 HOH HOH A . C 3 HOH 32 200 34 HOH HOH A . C 3 HOH 33 201 36 HOH HOH A . C 3 HOH 34 202 37 HOH HOH A . C 3 HOH 35 203 38 HOH HOH A . C 3 HOH 36 204 39 HOH HOH A . C 3 HOH 37 205 40 HOH HOH A . C 3 HOH 38 206 41 HOH HOH A . C 3 HOH 39 207 42 HOH HOH A . C 3 HOH 40 208 43 HOH HOH A . C 3 HOH 41 209 44 HOH HOH A . C 3 HOH 42 210 45 HOH HOH A . C 3 HOH 43 211 46 HOH HOH A . C 3 HOH 44 212 47 HOH HOH A . C 3 HOH 45 213 48 HOH HOH A . C 3 HOH 46 214 49 HOH HOH A . C 3 HOH 47 215 50 HOH HOH A . C 3 HOH 48 216 51 HOH HOH A . C 3 HOH 49 217 52 HOH HOH A . C 3 HOH 50 218 53 HOH HOH A . C 3 HOH 51 219 54 HOH HOH A . C 3 HOH 52 220 56 HOH HOH A . C 3 HOH 53 221 57 HOH HOH A . C 3 HOH 54 222 58 HOH HOH A . C 3 HOH 55 223 59 HOH HOH A . C 3 HOH 56 224 60 HOH HOH A . C 3 HOH 57 225 61 HOH HOH A . C 3 HOH 58 226 62 HOH HOH A . C 3 HOH 59 227 63 HOH HOH A . C 3 HOH 60 228 64 HOH HOH A . C 3 HOH 61 229 65 HOH HOH A . C 3 HOH 62 230 66 HOH HOH A . C 3 HOH 63 231 67 HOH HOH A . C 3 HOH 64 232 68 HOH HOH A . C 3 HOH 65 233 69 HOH HOH A . C 3 HOH 66 234 70 HOH HOH A . C 3 HOH 67 235 72 HOH HOH A . C 3 HOH 68 236 73 HOH HOH A . C 3 HOH 69 237 75 HOH HOH A . C 3 HOH 70 238 77 HOH HOH A . C 3 HOH 71 239 78 HOH HOH A . C 3 HOH 72 240 79 HOH HOH A . C 3 HOH 73 241 80 HOH HOH A . C 3 HOH 74 242 81 HOH HOH A . C 3 HOH 75 243 82 HOH HOH A . C 3 HOH 76 244 83 HOH HOH A . C 3 HOH 77 245 84 HOH HOH A . C 3 HOH 78 246 85 HOH HOH A . C 3 HOH 79 247 86 HOH HOH A . C 3 HOH 80 248 87 HOH HOH A . C 3 HOH 81 249 88 HOH HOH A . C 3 HOH 82 250 89 HOH HOH A . C 3 HOH 83 251 91 HOH HOH A . C 3 HOH 84 252 92 HOH HOH A . C 3 HOH 85 253 93 HOH HOH A . C 3 HOH 86 254 94 HOH HOH A . C 3 HOH 87 255 95 HOH HOH A . C 3 HOH 88 256 97 HOH HOH A . C 3 HOH 89 257 98 HOH HOH A . C 3 HOH 90 258 99 HOH HOH A . C 3 HOH 91 259 102 HOH HOH A . C 3 HOH 92 260 103 HOH HOH A . C 3 HOH 93 261 104 HOH HOH A . C 3 HOH 94 262 105 HOH HOH A . C 3 HOH 95 263 106 HOH HOH A . C 3 HOH 96 264 107 HOH HOH A . C 3 HOH 97 265 108 HOH HOH A . C 3 HOH 98 266 109 HOH HOH A . C 3 HOH 99 267 110 HOH HOH A . C 3 HOH 100 268 112 HOH HOH A . C 3 HOH 101 269 113 HOH HOH A . C 3 HOH 102 270 114 HOH HOH A . C 3 HOH 103 271 115 HOH HOH A . D 3 HOH 1 15 15 HOH HOH I . D 3 HOH 2 23 23 HOH HOH I . D 3 HOH 3 35 35 HOH HOH I . D 3 HOH 4 55 55 HOH HOH I . D 3 HOH 5 71 71 HOH HOH I . D 3 HOH 6 74 74 HOH HOH I . D 3 HOH 7 76 76 HOH HOH I . D 3 HOH 8 90 90 HOH HOH I . D 3 HOH 9 96 96 HOH HOH I . D 3 HOH 10 100 100 HOH HOH I . D 3 HOH 11 101 101 HOH HOH I . D 3 HOH 12 111 111 HOH HOH I . #