data_1BMP # _entry.id 1BMP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1BMP WWPDB D_1000171917 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BMP _pdbx_database_status.recvd_initial_deposition_date 1995-12-14 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Griffith, D.L.' 1 'Scott, D.L.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Three-dimensional structure of recombinant human osteogenic protein 1: structural paradigm for the transforming growth factor beta superfamily. ; Proc.Natl.Acad.Sci.USA 93 878 883 1996 PNASA6 US 0027-8424 0040 ? 8570652 10.1073/pnas.93.2.878 1 'Crystallization and Preliminary Crystallographic Data of Recombinant Human Osteogenic Protein-1 (Hop-1)' J.Mol.Biol. 244 657 ? 1994 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Griffith, D.L.' 1 primary 'Keck, P.C.' 2 primary 'Sampath, T.K.' 3 primary 'Rueger, D.C.' 4 primary 'Carlson, W.D.' 5 1 'Griffith, D.L.' 6 1 'Oppermann, H.' 7 1 'Rueger, D.C.' 8 1 'Sampath, T.K.' 9 1 'Tucker, R.F.' 10 1 'Carlson, W.D.' 11 # _cell.entry_id 1BMP _cell.length_a 99.460 _cell.length_b 99.460 _cell.length_c 42.090 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BMP _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BONE MORPHOGENETIC PROTEIN-7' _entity.formula_weight 15699.730 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'OSTEOGENIC PROTEIN-1, HOP-1, BMP-7' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMN ATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH ; _entity_poly.pdbx_seq_one_letter_code_can ;STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMN ATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 GLY n 1 4 SER n 1 5 LYS n 1 6 GLN n 1 7 ARG n 1 8 SER n 1 9 GLN n 1 10 ASN n 1 11 ARG n 1 12 SER n 1 13 LYS n 1 14 THR n 1 15 PRO n 1 16 LYS n 1 17 ASN n 1 18 GLN n 1 19 GLU n 1 20 ALA n 1 21 LEU n 1 22 ARG n 1 23 MET n 1 24 ALA n 1 25 ASN n 1 26 VAL n 1 27 ALA n 1 28 GLU n 1 29 ASN n 1 30 SER n 1 31 SER n 1 32 SER n 1 33 ASP n 1 34 GLN n 1 35 ARG n 1 36 GLN n 1 37 ALA n 1 38 CYS n 1 39 LYS n 1 40 LYS n 1 41 HIS n 1 42 GLU n 1 43 LEU n 1 44 TYR n 1 45 VAL n 1 46 SER n 1 47 PHE n 1 48 ARG n 1 49 ASP n 1 50 LEU n 1 51 GLY n 1 52 TRP n 1 53 GLN n 1 54 ASP n 1 55 TRP n 1 56 ILE n 1 57 ILE n 1 58 ALA n 1 59 PRO n 1 60 GLU n 1 61 GLY n 1 62 TYR n 1 63 ALA n 1 64 ALA n 1 65 TYR n 1 66 TYR n 1 67 CYS n 1 68 GLU n 1 69 GLY n 1 70 GLU n 1 71 CYS n 1 72 ALA n 1 73 PHE n 1 74 PRO n 1 75 LEU n 1 76 ASN n 1 77 SER n 1 78 TYR n 1 79 MET n 1 80 ASN n 1 81 ALA n 1 82 THR n 1 83 ASN n 1 84 HIS n 1 85 ALA n 1 86 ILE n 1 87 VAL n 1 88 GLN n 1 89 THR n 1 90 LEU n 1 91 VAL n 1 92 HIS n 1 93 PHE n 1 94 ILE n 1 95 ASN n 1 96 PRO n 1 97 GLU n 1 98 THR n 1 99 VAL n 1 100 PRO n 1 101 LYS n 1 102 PRO n 1 103 CYS n 1 104 CYS n 1 105 ALA n 1 106 PRO n 1 107 THR n 1 108 GLN n 1 109 LEU n 1 110 ASN n 1 111 ALA n 1 112 ILE n 1 113 SER n 1 114 VAL n 1 115 LEU n 1 116 TYR n 1 117 PHE n 1 118 ASP n 1 119 ASP n 1 120 SER n 1 121 SER n 1 122 ASN n 1 123 VAL n 1 124 ILE n 1 125 LEU n 1 126 LYS n 1 127 LYS n 1 128 TYR n 1 129 ARG n 1 130 ASN n 1 131 MET n 1 132 VAL n 1 133 VAL n 1 134 ARG n 1 135 ALA n 1 136 CYS n 1 137 GLY n 1 138 CYS n 1 139 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'HOP-1 CDNA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ OVARY _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Chinese hamster' _entity_src_gen.pdbx_host_org_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10029 _entity_src_gen.host_org_genus Cricetulus _entity_src_gen.pdbx_host_org_gene 'HOP-1 CDNA' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'REFERENCE, T.K. SAMPATH, ET AL. (1992) J. BIOL. CHEM. 267, 20452-20362' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BMP7_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P18075 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAP MFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDL SKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAE NSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQ LNAISVLYFDDSSNVILKKYRNMVVRACGCH ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BMP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18075 _struct_ref_seq.db_align_beg 293 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 431 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BMP _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.83 _exptl_crystal.density_percent_sol 60. _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type RIGAKU _diffrn_detector.pdbx_collection_date 1993-11-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source ? _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BMP _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 5502 _reflns.number_all ? _reflns.percent_possible_obs 87. _reflns.pdbx_Rmerge_I_obs 0.067 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.6 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1BMP _refine.ls_number_reflns_obs 5418 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10. _refine.ls_d_res_high 2.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.227 _refine.ls_R_factor_R_free 0.308 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 28.48 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ;LOOP REGION (RESIDUES 118 - 122) IS DISORDERED AND MODELED STEREOCHEMICALLY. NOTE THAT RESIDUE 59 IS DESCRIBED AS TRANS IN THE PAPER CITED ON JRNL RECORDS ABOVE BUT THE CURRENT MODEL PRESENTED IN THIS ENTRY HAS RESIDUE 59 AS CIS. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1BMP _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 828 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 828 _refine_hist.d_res_high 2.8 _refine_hist.d_res_low 10. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.008 0.030 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.025 0.050 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.138 0.100 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr 0.045 0.100 ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr 0.211 1.00 ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd 0.185 1.0 ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd 0.250 1.0 ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd 0.194 1.0 ? ? 'X-RAY DIFFRACTION' ? p_planar_tor 23.2 30. ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor 25.9 50.0 ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor 35.1 50.0 ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1BMP _struct.title 'BONE MORPHOGENETIC PROTEIN-7' _struct.pdbx_descriptor 'BONE MORPHOGENETIC PROTEIN-7' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BMP _struct_keywords.pdbx_keywords 'TRANSFORMING GROWTH FACTOR' _struct_keywords.text 'MORPHOGEN, TRANSFORMING GROWTH FACTOR, CYTOKINE, BONE, CARTILAGE, GLYCOPROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 84 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 93 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 84 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 93 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 38 SG ? ? ? 1_555 A CYS 104 SG ? ? A CYS 38 A CYS 104 1_555 ? ? ? ? ? ? ? 2.022 ? disulf2 disulf ? ? A CYS 67 SG ? ? ? 1_555 A CYS 136 SG ? ? A CYS 67 A CYS 136 1_555 ? ? ? ? ? ? ? 2.054 ? disulf3 disulf ? ? A CYS 71 SG ? ? ? 1_555 A CYS 138 SG ? ? A CYS 71 A CYS 138 1_555 ? ? ? ? ? ? ? 2.014 ? disulf4 disulf ? ? A CYS 103 SG ? ? ? 1_555 A CYS 103 SG ? ? A CYS 103 A CYS 103 4_555 ? ? ? ? ? ? ? 1.948 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 58 A . ? ALA 58 A PRO 59 A ? PRO 59 A 1 -27.14 2 PHE 73 A . ? PHE 73 A PRO 74 A ? PRO 74 A 1 20.83 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 39 ? HIS A 41 ? LYS A 39 HIS A 41 A 2 TYR A 66 ? GLU A 68 ? TYR A 66 GLU A 68 B 1 TYR A 44 ? SER A 46 ? TYR A 44 SER A 46 B 2 GLY A 61 ? ALA A 63 ? GLY A 61 ALA A 63 C 1 ILE A 112 ? PHE A 117 ? ILE A 112 PHE A 117 C 2 VAL A 123 ? TYR A 128 ? VAL A 123 TYR A 128 D 1 CYS A 103 ? GLN A 108 ? CYS A 103 GLN A 108 D 2 ALA A 135 ? HIS A 139 ? ALA A 135 HIS A 139 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 39 ? O LYS A 39 N GLU A 68 ? N GLU A 68 B 1 2 O VAL A 45 ? O VAL A 45 N TYR A 62 ? N TYR A 62 C 1 2 O ILE A 112 ? O ILE A 112 N TYR A 128 ? N TYR A 128 D 1 2 O CYS A 103 ? O CYS A 103 N HIS A 139 ? N HIS A 139 # _database_PDB_matrix.entry_id 1BMP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BMP _atom_sites.fract_transf_matrix[1][1] 0.010054 _atom_sites.fract_transf_matrix[1][2] 0.005805 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011610 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023759 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 LYS 5 5 ? ? ? A . n A 1 6 GLN 6 6 ? ? ? A . n A 1 7 ARG 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 GLN 9 9 ? ? ? A . n A 1 10 ASN 10 10 ? ? ? A . n A 1 11 ARG 11 11 ? ? ? A . n A 1 12 SER 12 12 ? ? ? A . n A 1 13 LYS 13 13 ? ? ? A . n A 1 14 THR 14 14 ? ? ? A . n A 1 15 PRO 15 15 ? ? ? A . n A 1 16 LYS 16 16 ? ? ? A . n A 1 17 ASN 17 17 ? ? ? A . n A 1 18 GLN 18 18 ? ? ? A . n A 1 19 GLU 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 LEU 21 21 ? ? ? A . n A 1 22 ARG 22 22 ? ? ? A . n A 1 23 MET 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 ASN 25 25 ? ? ? A . n A 1 26 VAL 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 GLU 28 28 ? ? ? A . n A 1 29 ASN 29 29 ? ? ? A . n A 1 30 SER 30 30 ? ? ? A . n A 1 31 SER 31 31 ? ? ? A . n A 1 32 SER 32 32 ? ? ? A . n A 1 33 ASP 33 33 ? ? ? A . n A 1 34 GLN 34 34 ? ? ? A . n A 1 35 ARG 35 35 ? ? ? A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 CYS 104 104 104 CYS CYS A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 CYS 136 136 136 CYS CYS A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 CYS 138 138 138 CYS CYS A . n A 1 139 HIS 139 139 139 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2370 ? 1 MORE -26 ? 1 'SSA (A^2)' 11690 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-07-23 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal R-AXIS 'data collection' SOFTWARE ? 1 R-AXIS 'data reduction' SOFTWARE ? 2 X-PLOR 'model building' . ? 3 PROFFT refinement . ? 4 X-PLOR refinement . ? 5 R-AXIS 'data scaling' . ? 6 X-PLOR phasing . ? 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 52 ? ? -64.51 19.70 2 1 TYR A 65 ? ? 63.72 173.88 3 1 TYR A 78 ? ? -81.65 47.59 4 1 MET A 79 ? ? -154.22 6.04 5 1 ASN A 80 ? ? 22.96 96.27 6 1 ASN A 95 ? ? -157.97 78.50 7 1 ASP A 118 ? ? -67.98 -178.51 8 1 ASP A 119 ? ? -52.29 -178.81 9 1 SER A 120 ? ? 68.50 -23.63 10 1 ASN A 130 ? ? 72.46 43.08 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 GLU A 42 ? ? 12.67 2 1 TYR A 44 ? ? 11.12 3 1 VAL A 45 ? ? 12.60 4 1 ASP A 49 ? ? 17.81 5 1 TRP A 55 ? ? 14.50 6 1 ILE A 56 ? ? -13.16 7 1 ILE A 57 ? ? 11.66 8 1 ALA A 58 ? ? -11.58 9 1 PHE A 73 ? ? 15.50 10 1 ALA A 85 ? ? 11.05 11 1 VAL A 91 ? ? 12.43 12 1 PRO A 102 ? ? -10.21 13 1 LEU A 109 ? ? -14.68 14 1 VAL A 123 ? ? -10.37 15 1 CYS A 136 ? ? -10.42 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 129 ? ? 0.095 'SIDE CHAIN' 2 1 ARG A 134 ? ? 0.248 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A LYS 5 ? A LYS 5 6 1 Y 1 A GLN 6 ? A GLN 6 7 1 Y 1 A ARG 7 ? A ARG 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A GLN 9 ? A GLN 9 10 1 Y 1 A ASN 10 ? A ASN 10 11 1 Y 1 A ARG 11 ? A ARG 11 12 1 Y 1 A SER 12 ? A SER 12 13 1 Y 1 A LYS 13 ? A LYS 13 14 1 Y 1 A THR 14 ? A THR 14 15 1 Y 1 A PRO 15 ? A PRO 15 16 1 Y 1 A LYS 16 ? A LYS 16 17 1 Y 1 A ASN 17 ? A ASN 17 18 1 Y 1 A GLN 18 ? A GLN 18 19 1 Y 1 A GLU 19 ? A GLU 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A LEU 21 ? A LEU 21 22 1 Y 1 A ARG 22 ? A ARG 22 23 1 Y 1 A MET 23 ? A MET 23 24 1 Y 1 A ALA 24 ? A ALA 24 25 1 Y 1 A ASN 25 ? A ASN 25 26 1 Y 1 A VAL 26 ? A VAL 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A GLU 28 ? A GLU 28 29 1 Y 1 A ASN 29 ? A ASN 29 30 1 Y 1 A SER 30 ? A SER 30 31 1 Y 1 A SER 31 ? A SER 31 32 1 Y 1 A SER 32 ? A SER 32 33 1 Y 1 A ASP 33 ? A ASP 33 34 1 Y 1 A GLN 34 ? A GLN 34 35 1 Y 1 A ARG 35 ? A ARG 35 #