data_1BQK # _entry.id 1BQK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BQK pdb_00001bqk 10.2210/pdb1bqk/pdb WWPDB D_1000172004 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BQK _pdbx_database_status.recvd_initial_deposition_date 1998-08-17 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, T.' 1 'Nishio, N.' 2 'Hamanaka, S.' 3 'Shimomura, T.' 4 'Harada, S.' 5 'Suzuki, S.' 6 'Kohzuma, T.' 7 'Shidara, S.' 8 'Iwasaki, H.' 9 'Kai, Y.' 10 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Crystal structure determinations of oxidized and reduced pseudoazurins from Achromobacter cycloclastes. Concerted movement of copper site in redox forms with the rearrangement of hydrogen bond at a remote histidine. ; J.Biol.Chem. 274 17845 17852 1999 JBCHA3 US 0021-9258 0071 ? 10364229 10.1074/jbc.274.25.17845 1 ;Crystal Structure Determinations of Oxidized and Reduced Pseudoazurin from Achromobacter Cycloclastes: A Redox-Induced Conformational Change Contains a Peptide Bond Flip ; Thesis ? ? ? ? ? ? ? 9999 'University (Thesis)' ? ? 2 'Crystallization and Preliminary X-Ray Studies on Pseudoazurin from Achromobacter Cycloclastes Iam1013' 'J.Biochem.(Tokyo)' 114 761 ? 1993 JOBIAO JA 0021-924X 0418 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, T.' 1 ? primary 'Nishio, N.' 2 ? primary 'Suzuki, S.' 3 ? primary 'Kataoka, K.' 4 ? primary 'Kohzuma, T.' 5 ? primary 'Kai, Y.' 6 ? 2 'Inoue, T.' 7 ? 2 'Nishio, N.' 8 ? 2 'Kai, Y.' 9 ? 2 'Harada, S.' 10 ? 2 'Ohshiro, Y.' 11 ? 2 'Suzuki, S.' 12 ? 2 'Kohzuma, T.' 13 ? 2 'Shidara, S.' 14 ? 2 'Iwasaki, H.' 15 ? # _cell.entry_id 1BQK _cell.length_a 56.731 _cell.length_b 61.544 _cell.length_c 30.083 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BQK _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat PSEUDOAZURIN 13032.940 1 ? ? ? 'OXIDIZED FORM OF PSEUDOAZURIN' 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 water nat water 18.015 121 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTP HYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN ; _entity_poly.pdbx_seq_one_letter_code_can ;ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTP HYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 PHE n 1 4 GLU n 1 5 VAL n 1 6 HIS n 1 7 MET n 1 8 LEU n 1 9 ASN n 1 10 LYS n 1 11 GLY n 1 12 LYS n 1 13 ASP n 1 14 GLY n 1 15 ALA n 1 16 MET n 1 17 VAL n 1 18 PHE n 1 19 GLU n 1 20 PRO n 1 21 ALA n 1 22 SER n 1 23 LEU n 1 24 LYS n 1 25 VAL n 1 26 ALA n 1 27 PRO n 1 28 GLY n 1 29 ASP n 1 30 THR n 1 31 VAL n 1 32 THR n 1 33 PHE n 1 34 ILE n 1 35 PRO n 1 36 THR n 1 37 ASP n 1 38 LYS n 1 39 GLY n 1 40 HIS n 1 41 ASN n 1 42 VAL n 1 43 GLU n 1 44 THR n 1 45 ILE n 1 46 LYS n 1 47 GLY n 1 48 MET n 1 49 ILE n 1 50 PRO n 1 51 ASP n 1 52 GLY n 1 53 ALA n 1 54 GLU n 1 55 ALA n 1 56 PHE n 1 57 LYS n 1 58 SER n 1 59 LYS n 1 60 ILE n 1 61 ASN n 1 62 GLU n 1 63 ASN n 1 64 TYR n 1 65 LYS n 1 66 VAL n 1 67 THR n 1 68 PHE n 1 69 THR n 1 70 ALA n 1 71 PRO n 1 72 GLY n 1 73 VAL n 1 74 TYR n 1 75 GLY n 1 76 VAL n 1 77 LYS n 1 78 CYS n 1 79 THR n 1 80 PRO n 1 81 HIS n 1 82 TYR n 1 83 GLY n 1 84 MET n 1 85 GLY n 1 86 MET n 1 87 VAL n 1 88 GLY n 1 89 VAL n 1 90 VAL n 1 91 GLN n 1 92 VAL n 1 93 GLY n 1 94 ASP n 1 95 ALA n 1 96 PRO n 1 97 ALA n 1 98 ASN n 1 99 LEU n 1 100 GLU n 1 101 ALA n 1 102 VAL n 1 103 LYS n 1 104 GLY n 1 105 ALA n 1 106 LYS n 1 107 ASN n 1 108 PRO n 1 109 LYS n 1 110 LYS n 1 111 ALA n 1 112 GLN n 1 113 GLU n 1 114 ARG n 1 115 LEU n 1 116 ASP n 1 117 ALA n 1 118 ALA n 1 119 LEU n 1 120 ALA n 1 121 ALA n 1 122 LEU n 1 123 GLY n 1 124 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Achromobacter cycloclastes' _entity_src_nat.pdbx_ncbi_taxonomy_id 223 _entity_src_nat.genus Achromobacter _entity_src_nat.species ? _entity_src_nat.strain IAM1013 _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AZUP_ACHCY _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P19567 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEKTMLNAIKSGFGIAIAAMLVAAPAAAADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDG AEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BQK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19567 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 152 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1BQK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.9 _exptl_crystal.density_percent_sol 40. _exptl_crystal.description 'DATA WERE COLLECTED USING THE WEISSENBERG METHOD' # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 6.0' # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type FUJI _diffrn_detector.pdbx_collection_date 1993-06-25 _diffrn_detector.details MIRROR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-6A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline BL-6A _diffrn_source.pdbx_wavelength 1.0 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BQK _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 8.0 _reflns.d_resolution_high 1.35 _reflns.number_obs 21303 _reflns.number_all ? _reflns.percent_possible_obs 88.8 _reflns.pdbx_Rmerge_I_obs 0.0850000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 8.0 _reflns.B_iso_Wilson_estimate 9.02 _reflns.pdbx_redundancy 10.5 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.35 _reflns_shell.d_res_low 1.4 _reflns_shell.percent_possible_all 56 _reflns_shell.Rmerge_I_obs 0.1820000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1BQK _refine.ls_number_reflns_obs 21303 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 1.35 _refine.ls_percent_reflns_obs 88.8 _refine.ls_R_factor_obs 0.1760000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1780000 _refine.ls_R_factor_R_free 0.1900000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5 _refine.ls_number_reflns_R_free 1084 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 11.3 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'ESTIMATED COORDINATE ERROR. ESD FROM LUZZATI PLOT (A) : 0.137' _refine.pdbx_starting_model 'PDB ENTRY 1PZA' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1BQK _refine_analyze.Luzzati_coordinate_error_obs 0.13 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 913 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 121 _refine_hist.number_atoms_total 1035 _refine_hist.d_res_high 1.35 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.008 0.020 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.022 0.040 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.026 0.050 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it 1.137 2.000 ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it 1.700 3.000 ? ? 'X-RAY DIFFRACTION' ? p_scbond_it 1.912 2.000 ? ? 'X-RAY DIFFRACTION' ? p_scangle_it 2.937 3.000 ? ? 'X-RAY DIFFRACTION' ? p_plane_restr 0.0225 0.03 ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr 0.109 0.150 ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd 0.168 0.300 ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd 0.237 0.300 ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd 0.132 0.300 ? ? 'X-RAY DIFFRACTION' ? p_planar_tor 4.0 7.0 ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor 12.9 15.0 ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor 22.8 20.0 ? ? 'X-RAY DIFFRACTION' ? p_special_tor 11.2 15.0 ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1BQK _struct.title 'OXIDIZED PSEUDOAZURIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BQK _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'CUPROPROTEIN, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 79 ? MET A 84 ? THR A 79 MET A 84 5 ? 6 HELX_P HELX_P2 2 LEU A 99 ? GLY A 104 ? LEU A 99 GLY A 104 1 ? 6 HELX_P HELX_P3 3 LYS A 109 ? LEU A 122 ? LYS A 109 LEU A 122 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 40 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 40 A CU 125 1_555 ? ? ? ? ? ? ? 1.950 ? ? metalc2 metalc ? ? A CYS 78 SG ? ? ? 1_555 B CU . CU ? ? A CYS 78 A CU 125 1_555 ? ? ? ? ? ? ? 2.132 ? ? metalc3 metalc ? ? A HIS 81 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 81 A CU 125 1_555 ? ? ? ? ? ? ? 1.921 ? ? metalc4 metalc ? ? A MET 86 SD ? ? ? 1_555 B CU . CU ? ? A MET 86 A CU 125 1_555 ? ? ? ? ? ? ? 2.710 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 19 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 19 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 20 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 20 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 17 ? GLU A 19 ? VAL A 17 GLU A 19 A 2 ASP A 2 ? LEU A 8 ? ASP A 2 LEU A 8 A 3 THR A 30 ? ILE A 34 ? THR A 30 ILE A 34 A 4 TYR A 64 ? THR A 67 ? TYR A 64 THR A 67 B 1 SER A 22 ? VAL A 25 ? SER A 22 VAL A 25 B 2 VAL A 87 ? VAL A 92 ? VAL A 87 VAL A 92 B 3 GLY A 72 ? LYS A 77 ? GLY A 72 LYS A 77 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 17 ? O VAL A 17 N LEU A 8 ? N LEU A 8 A 2 3 O PHE A 3 ? O PHE A 3 N THR A 30 ? N THR A 30 A 3 4 O VAL A 31 ? O VAL A 31 N VAL A 66 ? N VAL A 66 B 1 2 O LEU A 23 ? O LEU A 23 N VAL A 89 ? N VAL A 89 B 2 3 O GLY A 88 ? O GLY A 88 N VAL A 76 ? N VAL A 76 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details COP Unknown ? ? ? ? 4 'OXIDIZED COPPER COORDINATION' AC1 Software A CU 125 ? 4 'BINDING SITE FOR RESIDUE CU A 125' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 COP 4 HIS A 40 ? HIS A 40 . ? 1_555 ? 2 COP 4 CYS A 78 ? CYS A 78 . ? 1_555 ? 3 COP 4 HIS A 81 ? HIS A 81 . ? 1_555 ? 4 COP 4 MET A 86 ? MET A 86 . ? 1_555 ? 5 AC1 4 HIS A 40 ? HIS A 40 . ? 1_555 ? 6 AC1 4 CYS A 78 ? CYS A 78 . ? 1_555 ? 7 AC1 4 HIS A 81 ? HIS A 81 . ? 1_555 ? 8 AC1 4 MET A 86 ? MET A 86 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BQK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BQK _atom_sites.fract_transf_matrix[1][1] 0.017627 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016249 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.033241 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ASN 124 124 124 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 125 125 CU CU A . C 3 HOH 1 201 201 HOH HOH A . C 3 HOH 2 202 202 HOH HOH A . C 3 HOH 3 203 203 HOH HOH A . C 3 HOH 4 204 204 HOH HOH A . C 3 HOH 5 205 205 HOH HOH A . C 3 HOH 6 206 206 HOH HOH A . C 3 HOH 7 207 207 HOH HOH A . C 3 HOH 8 208 208 HOH HOH A . C 3 HOH 9 209 209 HOH HOH A . C 3 HOH 10 210 210 HOH HOH A . C 3 HOH 11 211 211 HOH HOH A . C 3 HOH 12 212 212 HOH HOH A . C 3 HOH 13 213 213 HOH HOH A . C 3 HOH 14 214 214 HOH HOH A . C 3 HOH 15 215 215 HOH HOH A . C 3 HOH 16 216 216 HOH HOH A . C 3 HOH 17 217 217 HOH HOH A . C 3 HOH 18 218 218 HOH HOH A . C 3 HOH 19 219 219 HOH HOH A . C 3 HOH 20 220 220 HOH HOH A . C 3 HOH 21 221 221 HOH HOH A . C 3 HOH 22 222 222 HOH HOH A . C 3 HOH 23 223 223 HOH HOH A . C 3 HOH 24 224 224 HOH HOH A . C 3 HOH 25 225 225 HOH HOH A . C 3 HOH 26 226 226 HOH HOH A . C 3 HOH 27 227 227 HOH HOH A . C 3 HOH 28 228 228 HOH HOH A . C 3 HOH 29 229 229 HOH HOH A . C 3 HOH 30 230 230 HOH HOH A . C 3 HOH 31 231 231 HOH HOH A . C 3 HOH 32 232 232 HOH HOH A . C 3 HOH 33 233 233 HOH HOH A . C 3 HOH 34 234 234 HOH HOH A . C 3 HOH 35 235 235 HOH HOH A . C 3 HOH 36 236 236 HOH HOH A . C 3 HOH 37 237 237 HOH HOH A . C 3 HOH 38 238 238 HOH HOH A . C 3 HOH 39 239 239 HOH HOH A . C 3 HOH 40 240 240 HOH HOH A . C 3 HOH 41 241 241 HOH HOH A . C 3 HOH 42 242 242 HOH HOH A . C 3 HOH 43 243 243 HOH HOH A . C 3 HOH 44 244 244 HOH HOH A . C 3 HOH 45 245 245 HOH HOH A . C 3 HOH 46 246 246 HOH HOH A . C 3 HOH 47 247 247 HOH HOH A . C 3 HOH 48 248 248 HOH HOH A . C 3 HOH 49 249 249 HOH HOH A . C 3 HOH 50 250 250 HOH HOH A . C 3 HOH 51 251 251 HOH HOH A . C 3 HOH 52 252 252 HOH HOH A . C 3 HOH 53 253 253 HOH HOH A . C 3 HOH 54 254 254 HOH HOH A . C 3 HOH 55 255 255 HOH HOH A . C 3 HOH 56 256 256 HOH HOH A . C 3 HOH 57 257 257 HOH HOH A . C 3 HOH 58 258 258 HOH HOH A . C 3 HOH 59 259 259 HOH HOH A . C 3 HOH 60 260 260 HOH HOH A . C 3 HOH 61 261 261 HOH HOH A . C 3 HOH 62 262 262 HOH HOH A . C 3 HOH 63 263 263 HOH HOH A . C 3 HOH 64 264 264 HOH HOH A . C 3 HOH 65 265 265 HOH HOH A . C 3 HOH 66 266 266 HOH HOH A . C 3 HOH 67 267 267 HOH HOH A . C 3 HOH 68 268 268 HOH HOH A . C 3 HOH 69 269 269 HOH HOH A . C 3 HOH 70 270 270 HOH HOH A . C 3 HOH 71 271 271 HOH HOH A . C 3 HOH 72 272 272 HOH HOH A . C 3 HOH 73 273 273 HOH HOH A . C 3 HOH 74 274 274 HOH HOH A . C 3 HOH 75 275 275 HOH HOH A . C 3 HOH 76 276 276 HOH HOH A . C 3 HOH 77 277 277 HOH HOH A . C 3 HOH 78 278 278 HOH HOH A . C 3 HOH 79 279 279 HOH HOH A . C 3 HOH 80 280 280 HOH HOH A . C 3 HOH 81 281 281 HOH HOH A . C 3 HOH 82 282 282 HOH HOH A . C 3 HOH 83 283 283 HOH HOH A . C 3 HOH 84 284 284 HOH HOH A . C 3 HOH 85 285 285 HOH HOH A . C 3 HOH 86 286 286 HOH HOH A . C 3 HOH 87 287 287 HOH HOH A . C 3 HOH 88 288 288 HOH HOH A . C 3 HOH 89 289 289 HOH HOH A . C 3 HOH 90 290 290 HOH HOH A . C 3 HOH 91 291 291 HOH HOH A . C 3 HOH 92 292 292 HOH HOH A . C 3 HOH 93 293 293 HOH HOH A . C 3 HOH 94 294 294 HOH HOH A . C 3 HOH 95 295 295 HOH HOH A . C 3 HOH 96 296 296 HOH HOH A . C 3 HOH 97 297 297 HOH HOH A . C 3 HOH 98 298 298 HOH HOH A . C 3 HOH 99 299 299 HOH HOH A . C 3 HOH 100 300 300 HOH HOH A . C 3 HOH 101 301 301 HOH HOH A . C 3 HOH 102 302 302 HOH HOH A . C 3 HOH 103 303 303 HOH HOH A . C 3 HOH 104 304 304 HOH HOH A . C 3 HOH 105 305 305 HOH HOH A . C 3 HOH 106 306 306 HOH HOH A . C 3 HOH 107 307 307 HOH HOH A . C 3 HOH 108 308 308 HOH HOH A . C 3 HOH 109 309 309 HOH HOH A . C 3 HOH 110 310 310 HOH HOH A . C 3 HOH 111 311 311 HOH HOH A . C 3 HOH 112 312 312 HOH HOH A . C 3 HOH 113 313 313 HOH HOH A . C 3 HOH 114 314 314 HOH HOH A . C 3 HOH 115 315 315 HOH HOH A . C 3 HOH 116 316 316 HOH HOH A . C 3 HOH 117 317 317 HOH HOH A . C 3 HOH 118 318 318 HOH HOH A . C 3 HOH 119 319 319 HOH HOH A . C 3 HOH 120 320 320 HOH HOH A . C 3 HOH 121 321 321 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 CU ? B CU . ? A CU 125 ? 1_555 SG ? A CYS 78 ? A CYS 78 ? 1_555 135.3 ? 2 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 CU ? B CU . ? A CU 125 ? 1_555 ND1 ? A HIS 81 ? A HIS 81 ? 1_555 100.3 ? 3 SG ? A CYS 78 ? A CYS 78 ? 1_555 CU ? B CU . ? A CU 125 ? 1_555 ND1 ? A HIS 81 ? A HIS 81 ? 1_555 114.5 ? 4 ND1 ? A HIS 40 ? A HIS 40 ? 1_555 CU ? B CU . ? A CU 125 ? 1_555 SD ? A MET 86 ? A MET 86 ? 1_555 86.8 ? 5 SG ? A CYS 78 ? A CYS 78 ? 1_555 CU ? B CU . ? A CU 125 ? 1_555 SD ? A MET 86 ? A MET 86 ? 1_555 107.4 ? 6 ND1 ? A HIS 81 ? A HIS 81 ? 1_555 CU ? B CU . ? A CU 125 ? 1_555 SD ? A MET 86 ? A MET 86 ? 1_555 107.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-08-17 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_initial_refinement_model 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 4 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 5 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 9 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 REFMAC refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 16 ? ? 57.49 77.59 2 1 ASN A 61 ? ? 77.45 -2.79 3 1 THR A 69 ? ? -102.40 -72.61 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1PZA _pdbx_initial_refinement_model.details 'PDB ENTRY 1PZA' #