data_1BRV # _entry.id 1BRV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BRV pdb_00001brv 10.2210/pdb1brv/pdb WWPDB D_1000172041 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-06-05 2 'Structure model' 1 1 2008-03-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature 11 5 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BRV _pdbx_database_status.recvd_initial_deposition_date 1996-03-29 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Doreleijers, J.F.' 1 'Langedijk, J.P.M.' 2 'Hard, K.' 3 'Rullmann, J.A.C.' 4 'Boelens, R.' 5 'Schaaper, W.M.' 6 'Van Oirschot, J.T.' 7 'Kaptein, R.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of the immunodominant region of protein G of bovine respiratory syncytial virus.' Biochemistry 35 14684 14688 1996 BICHAW US 0006-2960 0033 ? 8942628 10.1021/bi9621627 1 'Proposed Three-Dimensional Model for the Attachment Protein G of Respiratory Syncytial Virus' J.Gen.Virol. 77 1249 ? 1996 JGVIAY US 0022-1317 2058 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Doreleijers, J.F.' 1 ? primary 'Langedijk, J.P.' 2 ? primary 'Hard, K.' 3 ? primary 'Boelens, R.' 4 ? primary 'Rullmann, J.A.' 5 ? primary 'Schaaper, W.M.' 6 ? primary 'van Oirschot, J.T.' 7 ? primary 'Kaptein, R.' 8 ? 1 'Langedijk, J.P.' 9 ? 1 'Schaaper, W.M.' 10 ? 1 'Meloen, R.H.' 11 ? 1 'Van Oirschot, J.T.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PROTEIN G' _entity.formula_weight 3605.001 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'IMMUNODOMINANT REGION, RESIDUES 158 - 189' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BRSV-G REGION' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NHQDHNNFQTLPYVPCSTCEGNLACLSLCHIE _entity_poly.pdbx_seq_one_letter_code_can NHQDHNNFQTLPYVPCSTCEGNLACLSLCHIE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 HIS n 1 3 GLN n 1 4 ASP n 1 5 HIS n 1 6 ASN n 1 7 ASN n 1 8 PHE n 1 9 GLN n 1 10 THR n 1 11 LEU n 1 12 PRO n 1 13 TYR n 1 14 VAL n 1 15 PRO n 1 16 CYS n 1 17 SER n 1 18 THR n 1 19 CYS n 1 20 GLU n 1 21 GLY n 1 22 ASN n 1 23 LEU n 1 24 ALA n 1 25 CYS n 1 26 LEU n 1 27 SER n 1 28 LEU n 1 29 CYS n 1 30 HIS n 1 31 ILE n 1 32 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pneumovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Bovine respiratory syncytial virus' _entity_src_gen.gene_src_strain 391-2 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bovine respiratory syncytial virus (strain 391-2)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 31611 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 158 ? ? ? A . n A 1 2 HIS 2 159 ? ? ? A . n A 1 3 GLN 3 160 ? ? ? A . n A 1 4 ASP 4 161 ? ? ? A . n A 1 5 HIS 5 162 ? ? ? A . n A 1 6 ASN 6 163 ? ? ? A . n A 1 7 ASN 7 164 ? ? ? A . n A 1 8 PHE 8 165 ? ? ? A . n A 1 9 GLN 9 166 ? ? ? A . n A 1 10 THR 10 167 ? ? ? A . n A 1 11 LEU 11 168 ? ? ? A . n A 1 12 PRO 12 169 ? ? ? A . n A 1 13 TYR 13 170 ? ? ? A . n A 1 14 VAL 14 171 171 VAL VAL A . n A 1 15 PRO 15 172 172 PRO PRO A . n A 1 16 CYS 16 173 173 CYS CYS A . n A 1 17 SER 17 174 174 SER SER A . n A 1 18 THR 18 175 175 THR THR A . n A 1 19 CYS 19 176 176 CYS CYS A . n A 1 20 GLU 20 177 177 GLU GLU A . n A 1 21 GLY 21 178 178 GLY GLY A . n A 1 22 ASN 22 179 179 ASN ASN A . n A 1 23 LEU 23 180 180 LEU LEU A . n A 1 24 ALA 24 181 181 ALA ALA A . n A 1 25 CYS 25 182 182 CYS CYS A . n A 1 26 LEU 26 183 183 LEU LEU A . n A 1 27 SER 27 184 184 SER SER A . n A 1 28 LEU 28 185 185 LEU LEU A . n A 1 29 CYS 29 186 186 CYS CYS A . n A 1 30 HIS 30 187 187 HIS HIS A . n A 1 31 ILE 31 188 188 ILE ILE A . n A 1 32 GLU 32 189 189 GLU GLU A . n # _cell.entry_id 1BRV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BRV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1BRV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1BRV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1BRV _struct.title 'SOLUTION NMR STRUCTURE OF THE IMMUNODOMINANT REGION OF PROTEIN G OF BOVINE RESPIRATORY SYNCYTIAL VIRUS, 48 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BRV _struct_keywords.pdbx_keywords GLYCOPROTEIN _struct_keywords.text 'ATTACHMENT PROTEIN G OF BOVINE RESPIRATORY SYNCYTIAL VIRUS, IMMUNOGLOBULIN-BINDING PROTEIN, TRANSMEMBRANE, GLYCOPROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VGLG_BRSVC _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P22261 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSNHTHHLKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALSTLAMITLTSLVITAIIYISVGNAKAKPTSKPTIQQT QQPQNHTSPFFTEHNYKSTHTSIQSTTLSQLLNIDTTRGITYGHSTNETQNRKIKGQSTLPATRKPPINPSGSIPPENHQ DHNNFQTLPYVPCSTCEGNLACLSLCHIETERAPSRAPTITLKKTPKPKTTKKPTKTTIHHRTSPETKLQPKNNTATPQQ GILSSTEHHTNQSTTQI ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BRV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22261 _struct_ref_seq.db_align_beg 158 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 158 _struct_ref_seq.pdbx_auth_seq_align_end 189 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 CYS A 16 ? CYS A 19 ? CYS A 173 CYS A 176 1 ? 4 HELX_P HELX_P2 H2 LEU A 23 ? LEU A 28 ? LEU A 180 LEU A 185 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 173 A CYS 186 1_555 ? ? ? ? ? ? ? 1.997 ? ? disulf2 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 176 A CYS 182 1_555 ? ? ? ? ? ? ? 1.986 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 16 ? CYS A 29 ? CYS A 173 ? 1_555 CYS A 186 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 19 ? CYS A 25 ? CYS A 176 ? 1_555 CYS A 182 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 1BRV _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 2 1 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 3 2 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 4 2 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.358 1.252 0.106 0.011 N 5 3 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 6 3 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 7 4 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 8 4 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 9 5 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 10 5 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 11 6 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 12 6 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 13 7 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 14 7 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 15 8 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.361 1.252 0.109 0.011 N 16 8 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 17 9 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 18 9 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 19 10 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 20 10 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 21 11 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 22 11 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 23 12 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 24 12 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 25 13 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 26 13 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 27 14 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 28 14 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 29 15 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 30 15 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 31 16 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.361 1.252 0.109 0.011 N 32 16 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 33 17 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 34 17 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 35 18 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 36 18 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.361 1.252 0.109 0.011 N 37 19 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 38 19 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 39 20 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 40 20 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 41 21 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 42 21 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 43 22 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 44 22 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.362 1.252 0.110 0.011 N 45 23 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 46 23 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 47 24 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 48 24 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 49 25 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 50 25 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 51 26 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 52 26 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 53 27 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 54 27 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 55 28 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.358 1.252 0.106 0.011 N 56 28 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.358 1.252 0.106 0.011 N 57 29 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 58 29 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.361 1.252 0.109 0.011 N 59 30 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 60 30 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.362 1.252 0.110 0.011 N 61 31 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 62 31 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 63 32 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 64 32 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 65 33 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 66 33 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 67 34 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 68 34 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 69 35 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 70 35 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 71 36 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.361 1.252 0.109 0.011 N 72 36 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 73 37 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 74 37 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 75 38 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 76 38 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 77 39 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 78 39 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 79 40 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.359 1.252 0.107 0.011 N 80 40 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 81 41 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 82 41 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 83 42 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 84 42 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 85 43 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 86 43 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N 87 44 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 88 44 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.361 1.252 0.109 0.011 N 89 45 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 90 45 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.361 1.252 0.109 0.011 N 91 46 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 92 46 CG A HIS 187 ? ? CD2 A HIS 187 ? ? 1.408 1.354 0.054 0.009 N 93 46 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.359 1.252 0.107 0.011 N 94 47 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.358 1.252 0.106 0.011 N 95 47 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.361 1.252 0.109 0.011 N 96 48 CD A GLU 177 ? ? OE2 A GLU 177 ? ? 1.360 1.252 0.108 0.011 N 97 48 CD A GLU 189 ? ? OE2 A GLU 189 ? ? 1.360 1.252 0.108 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 119.96 111.50 8.46 1.30 N 2 2 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.30 111.50 8.80 1.30 N 3 3 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.23 111.50 8.73 1.30 N 4 4 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.15 111.50 8.65 1.30 N 5 5 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.07 111.50 8.57 1.30 N 6 6 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.10 111.50 8.60 1.30 N 7 7 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.25 111.50 8.75 1.30 N 8 8 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.17 111.50 8.67 1.30 N 9 9 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.09 111.50 8.59 1.30 N 10 10 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 119.97 111.50 8.47 1.30 N 11 11 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.05 111.50 8.55 1.30 N 12 12 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.18 111.50 8.68 1.30 N 13 13 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.19 111.50 8.69 1.30 N 14 14 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.12 111.50 8.62 1.30 N 15 15 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 119.94 111.50 8.44 1.30 N 16 16 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 119.96 111.50 8.46 1.30 N 17 17 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.06 111.50 8.56 1.30 N 18 18 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.12 111.50 8.62 1.30 N 19 19 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.00 111.50 8.50 1.30 N 20 20 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.45 111.50 8.95 1.30 N 21 21 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.13 111.50 8.63 1.30 N 22 22 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 119.99 111.50 8.49 1.30 N 23 23 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.18 111.50 8.68 1.30 N 24 24 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.36 111.50 8.86 1.30 N 25 25 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.35 111.50 8.85 1.30 N 26 26 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.01 111.50 8.51 1.30 N 27 27 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.07 111.50 8.57 1.30 N 28 28 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.00 111.50 8.50 1.30 N 29 29 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.08 111.50 8.58 1.30 N 30 30 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 119.98 111.50 8.48 1.30 N 31 31 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.22 111.50 8.72 1.30 N 32 32 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.16 111.50 8.66 1.30 N 33 33 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.20 111.50 8.70 1.30 N 34 34 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.14 111.50 8.64 1.30 N 35 35 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.05 111.50 8.55 1.30 N 36 36 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 119.95 111.50 8.45 1.30 N 37 37 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.04 111.50 8.54 1.30 N 38 38 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 119.92 111.50 8.42 1.30 N 39 39 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.15 111.50 8.65 1.30 N 40 40 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.31 111.50 8.81 1.30 N 41 41 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 119.91 111.50 8.41 1.30 N 42 42 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.16 111.50 8.66 1.30 N 43 43 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.23 111.50 8.73 1.30 N 44 44 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.08 111.50 8.58 1.30 N 45 45 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.39 111.50 8.89 1.30 N 46 46 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.20 111.50 8.70 1.30 N 47 47 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.14 111.50 8.64 1.30 N 48 48 ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? NE2 A HIS 187 ? ? 120.10 111.50 8.60 1.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 ILE A 188 ? ? -94.17 -64.54 2 9 HIS A 187 ? ? -116.57 -89.85 3 10 ILE A 188 ? ? -93.76 58.20 4 12 SER A 174 ? ? -57.41 -6.42 5 12 ILE A 188 ? ? -100.66 68.77 6 13 SER A 174 ? ? -58.41 -6.36 7 15 HIS A 187 ? ? -98.41 -79.76 8 20 ILE A 188 ? ? -98.04 -62.50 9 21 SER A 174 ? ? -59.21 -6.05 10 22 SER A 174 ? ? -59.22 -4.22 11 25 SER A 174 ? ? -59.74 -4.96 12 28 SER A 174 ? ? -58.37 -5.78 13 34 HIS A 187 ? ? -117.88 -90.31 14 36 ILE A 188 ? ? -97.81 -70.06 15 38 SER A 174 ? ? -57.88 -8.37 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 HIS A 187 ? ? 0.106 'SIDE CHAIN' 2 2 HIS A 187 ? ? 0.150 'SIDE CHAIN' 3 3 HIS A 187 ? ? 0.125 'SIDE CHAIN' 4 4 HIS A 187 ? ? 0.147 'SIDE CHAIN' 5 5 HIS A 187 ? ? 0.108 'SIDE CHAIN' 6 6 HIS A 187 ? ? 0.121 'SIDE CHAIN' 7 7 HIS A 187 ? ? 0.129 'SIDE CHAIN' 8 9 HIS A 187 ? ? 0.170 'SIDE CHAIN' 9 10 HIS A 187 ? ? 0.089 'SIDE CHAIN' 10 12 HIS A 187 ? ? 0.114 'SIDE CHAIN' 11 13 HIS A 187 ? ? 0.143 'SIDE CHAIN' 12 16 HIS A 187 ? ? 0.088 'SIDE CHAIN' 13 18 HIS A 187 ? ? 0.135 'SIDE CHAIN' 14 19 HIS A 187 ? ? 0.102 'SIDE CHAIN' 15 20 HIS A 187 ? ? 0.126 'SIDE CHAIN' 16 21 HIS A 187 ? ? 0.117 'SIDE CHAIN' 17 23 HIS A 187 ? ? 0.129 'SIDE CHAIN' 18 24 HIS A 187 ? ? 0.117 'SIDE CHAIN' 19 25 HIS A 187 ? ? 0.117 'SIDE CHAIN' 20 29 HIS A 187 ? ? 0.131 'SIDE CHAIN' 21 31 HIS A 187 ? ? 0.105 'SIDE CHAIN' 22 32 HIS A 187 ? ? 0.090 'SIDE CHAIN' 23 33 HIS A 187 ? ? 0.117 'SIDE CHAIN' 24 34 HIS A 187 ? ? 0.164 'SIDE CHAIN' 25 38 HIS A 187 ? ? 0.097 'SIDE CHAIN' 26 39 HIS A 187 ? ? 0.164 'SIDE CHAIN' 27 40 HIS A 187 ? ? 0.137 'SIDE CHAIN' 28 41 HIS A 187 ? ? 0.149 'SIDE CHAIN' 29 42 HIS A 187 ? ? 0.100 'SIDE CHAIN' 30 43 HIS A 187 ? ? 0.125 'SIDE CHAIN' 31 45 HIS A 187 ? ? 0.117 'SIDE CHAIN' 32 46 HIS A 187 ? ? 0.131 'SIDE CHAIN' 33 47 HIS A 187 ? ? 0.171 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1BRV _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 48 _pdbx_nmr_ensemble.conformer_selection_criteria 'ERROR FUNCTION DGII' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 TOCSY 1 2 1 NOESY 1 3 1 HSQC 1 4 1 DQF-COSY 1 # _pdbx_nmr_refine.entry_id 1BRV _pdbx_nmr_refine.method 'SEE REMARK 3' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Discover ? BIOSYM 1 'structure solution' REGINE ? ? 2 'structure solution' DGII ? ? 3 'structure solution' Discover ? ? 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 158 ? A ASN 1 2 1 Y 1 A HIS 159 ? A HIS 2 3 1 Y 1 A GLN 160 ? A GLN 3 4 1 Y 1 A ASP 161 ? A ASP 4 5 1 Y 1 A HIS 162 ? A HIS 5 6 1 Y 1 A ASN 163 ? A ASN 6 7 1 Y 1 A ASN 164 ? A ASN 7 8 1 Y 1 A PHE 165 ? A PHE 8 9 1 Y 1 A GLN 166 ? A GLN 9 10 1 Y 1 A THR 167 ? A THR 10 11 1 Y 1 A LEU 168 ? A LEU 11 12 1 Y 1 A PRO 169 ? A PRO 12 13 1 Y 1 A TYR 170 ? A TYR 13 14 2 Y 1 A ASN 158 ? A ASN 1 15 2 Y 1 A HIS 159 ? A HIS 2 16 2 Y 1 A GLN 160 ? A GLN 3 17 2 Y 1 A ASP 161 ? A ASP 4 18 2 Y 1 A HIS 162 ? A HIS 5 19 2 Y 1 A ASN 163 ? A ASN 6 20 2 Y 1 A ASN 164 ? A ASN 7 21 2 Y 1 A PHE 165 ? A PHE 8 22 2 Y 1 A GLN 166 ? A GLN 9 23 2 Y 1 A THR 167 ? A THR 10 24 2 Y 1 A LEU 168 ? A LEU 11 25 2 Y 1 A PRO 169 ? A PRO 12 26 2 Y 1 A TYR 170 ? A TYR 13 27 3 Y 1 A ASN 158 ? A ASN 1 28 3 Y 1 A HIS 159 ? A HIS 2 29 3 Y 1 A GLN 160 ? A GLN 3 30 3 Y 1 A ASP 161 ? A ASP 4 31 3 Y 1 A HIS 162 ? A HIS 5 32 3 Y 1 A ASN 163 ? A ASN 6 33 3 Y 1 A ASN 164 ? A ASN 7 34 3 Y 1 A PHE 165 ? A PHE 8 35 3 Y 1 A GLN 166 ? A GLN 9 36 3 Y 1 A THR 167 ? A THR 10 37 3 Y 1 A LEU 168 ? A LEU 11 38 3 Y 1 A PRO 169 ? A PRO 12 39 3 Y 1 A TYR 170 ? A TYR 13 40 4 Y 1 A ASN 158 ? A ASN 1 41 4 Y 1 A HIS 159 ? A HIS 2 42 4 Y 1 A GLN 160 ? A GLN 3 43 4 Y 1 A ASP 161 ? A ASP 4 44 4 Y 1 A HIS 162 ? A HIS 5 45 4 Y 1 A ASN 163 ? A ASN 6 46 4 Y 1 A ASN 164 ? A ASN 7 47 4 Y 1 A PHE 165 ? A PHE 8 48 4 Y 1 A GLN 166 ? A GLN 9 49 4 Y 1 A THR 167 ? A THR 10 50 4 Y 1 A LEU 168 ? A LEU 11 51 4 Y 1 A PRO 169 ? A PRO 12 52 4 Y 1 A TYR 170 ? A TYR 13 53 5 Y 1 A ASN 158 ? A ASN 1 54 5 Y 1 A HIS 159 ? A HIS 2 55 5 Y 1 A GLN 160 ? A GLN 3 56 5 Y 1 A ASP 161 ? A ASP 4 57 5 Y 1 A HIS 162 ? A HIS 5 58 5 Y 1 A ASN 163 ? A ASN 6 59 5 Y 1 A ASN 164 ? A ASN 7 60 5 Y 1 A PHE 165 ? A PHE 8 61 5 Y 1 A GLN 166 ? A GLN 9 62 5 Y 1 A THR 167 ? A THR 10 63 5 Y 1 A LEU 168 ? A LEU 11 64 5 Y 1 A PRO 169 ? A PRO 12 65 5 Y 1 A TYR 170 ? A TYR 13 66 6 Y 1 A ASN 158 ? A ASN 1 67 6 Y 1 A HIS 159 ? A HIS 2 68 6 Y 1 A GLN 160 ? A GLN 3 69 6 Y 1 A ASP 161 ? A ASP 4 70 6 Y 1 A HIS 162 ? A HIS 5 71 6 Y 1 A ASN 163 ? A ASN 6 72 6 Y 1 A ASN 164 ? A ASN 7 73 6 Y 1 A PHE 165 ? A PHE 8 74 6 Y 1 A GLN 166 ? A GLN 9 75 6 Y 1 A THR 167 ? A THR 10 76 6 Y 1 A LEU 168 ? A LEU 11 77 6 Y 1 A PRO 169 ? A PRO 12 78 6 Y 1 A TYR 170 ? A TYR 13 79 7 Y 1 A ASN 158 ? A ASN 1 80 7 Y 1 A HIS 159 ? A HIS 2 81 7 Y 1 A GLN 160 ? A GLN 3 82 7 Y 1 A ASP 161 ? A ASP 4 83 7 Y 1 A HIS 162 ? A HIS 5 84 7 Y 1 A ASN 163 ? A ASN 6 85 7 Y 1 A ASN 164 ? A ASN 7 86 7 Y 1 A PHE 165 ? A PHE 8 87 7 Y 1 A GLN 166 ? A GLN 9 88 7 Y 1 A THR 167 ? A THR 10 89 7 Y 1 A LEU 168 ? A LEU 11 90 7 Y 1 A PRO 169 ? A PRO 12 91 7 Y 1 A TYR 170 ? A TYR 13 92 8 Y 1 A ASN 158 ? A ASN 1 93 8 Y 1 A HIS 159 ? A HIS 2 94 8 Y 1 A GLN 160 ? A GLN 3 95 8 Y 1 A ASP 161 ? A ASP 4 96 8 Y 1 A HIS 162 ? A HIS 5 97 8 Y 1 A ASN 163 ? A ASN 6 98 8 Y 1 A ASN 164 ? A ASN 7 99 8 Y 1 A PHE 165 ? A PHE 8 100 8 Y 1 A GLN 166 ? A GLN 9 101 8 Y 1 A THR 167 ? A THR 10 102 8 Y 1 A LEU 168 ? A LEU 11 103 8 Y 1 A PRO 169 ? A PRO 12 104 8 Y 1 A TYR 170 ? A TYR 13 105 9 Y 1 A ASN 158 ? A ASN 1 106 9 Y 1 A HIS 159 ? A HIS 2 107 9 Y 1 A GLN 160 ? A GLN 3 108 9 Y 1 A ASP 161 ? A ASP 4 109 9 Y 1 A HIS 162 ? A HIS 5 110 9 Y 1 A ASN 163 ? A ASN 6 111 9 Y 1 A ASN 164 ? A ASN 7 112 9 Y 1 A PHE 165 ? A PHE 8 113 9 Y 1 A GLN 166 ? A GLN 9 114 9 Y 1 A THR 167 ? A THR 10 115 9 Y 1 A LEU 168 ? A LEU 11 116 9 Y 1 A PRO 169 ? A PRO 12 117 9 Y 1 A TYR 170 ? A TYR 13 118 10 Y 1 A ASN 158 ? A ASN 1 119 10 Y 1 A HIS 159 ? A HIS 2 120 10 Y 1 A GLN 160 ? A GLN 3 121 10 Y 1 A ASP 161 ? A ASP 4 122 10 Y 1 A HIS 162 ? A HIS 5 123 10 Y 1 A ASN 163 ? A ASN 6 124 10 Y 1 A ASN 164 ? A ASN 7 125 10 Y 1 A PHE 165 ? A PHE 8 126 10 Y 1 A GLN 166 ? A GLN 9 127 10 Y 1 A THR 167 ? A THR 10 128 10 Y 1 A LEU 168 ? A LEU 11 129 10 Y 1 A PRO 169 ? A PRO 12 130 10 Y 1 A TYR 170 ? A TYR 13 131 11 Y 1 A ASN 158 ? A ASN 1 132 11 Y 1 A HIS 159 ? A HIS 2 133 11 Y 1 A GLN 160 ? A GLN 3 134 11 Y 1 A ASP 161 ? A ASP 4 135 11 Y 1 A HIS 162 ? A HIS 5 136 11 Y 1 A ASN 163 ? A ASN 6 137 11 Y 1 A ASN 164 ? A ASN 7 138 11 Y 1 A PHE 165 ? A PHE 8 139 11 Y 1 A GLN 166 ? A GLN 9 140 11 Y 1 A THR 167 ? A THR 10 141 11 Y 1 A LEU 168 ? A LEU 11 142 11 Y 1 A PRO 169 ? A PRO 12 143 11 Y 1 A TYR 170 ? A TYR 13 144 12 Y 1 A ASN 158 ? A ASN 1 145 12 Y 1 A HIS 159 ? A HIS 2 146 12 Y 1 A GLN 160 ? A GLN 3 147 12 Y 1 A ASP 161 ? A ASP 4 148 12 Y 1 A HIS 162 ? A HIS 5 149 12 Y 1 A ASN 163 ? A ASN 6 150 12 Y 1 A ASN 164 ? A ASN 7 151 12 Y 1 A PHE 165 ? A PHE 8 152 12 Y 1 A GLN 166 ? A GLN 9 153 12 Y 1 A THR 167 ? A THR 10 154 12 Y 1 A LEU 168 ? A LEU 11 155 12 Y 1 A PRO 169 ? A PRO 12 156 12 Y 1 A TYR 170 ? A TYR 13 157 13 Y 1 A ASN 158 ? A ASN 1 158 13 Y 1 A HIS 159 ? A HIS 2 159 13 Y 1 A GLN 160 ? A GLN 3 160 13 Y 1 A ASP 161 ? A ASP 4 161 13 Y 1 A HIS 162 ? A HIS 5 162 13 Y 1 A ASN 163 ? A ASN 6 163 13 Y 1 A ASN 164 ? A ASN 7 164 13 Y 1 A PHE 165 ? A PHE 8 165 13 Y 1 A GLN 166 ? A GLN 9 166 13 Y 1 A THR 167 ? A THR 10 167 13 Y 1 A LEU 168 ? A LEU 11 168 13 Y 1 A PRO 169 ? A PRO 12 169 13 Y 1 A TYR 170 ? A TYR 13 170 14 Y 1 A ASN 158 ? A ASN 1 171 14 Y 1 A HIS 159 ? A HIS 2 172 14 Y 1 A GLN 160 ? A GLN 3 173 14 Y 1 A ASP 161 ? A ASP 4 174 14 Y 1 A HIS 162 ? A HIS 5 175 14 Y 1 A ASN 163 ? A ASN 6 176 14 Y 1 A ASN 164 ? A ASN 7 177 14 Y 1 A PHE 165 ? A PHE 8 178 14 Y 1 A GLN 166 ? A GLN 9 179 14 Y 1 A THR 167 ? A THR 10 180 14 Y 1 A LEU 168 ? A LEU 11 181 14 Y 1 A PRO 169 ? A PRO 12 182 14 Y 1 A TYR 170 ? A TYR 13 183 15 Y 1 A ASN 158 ? A ASN 1 184 15 Y 1 A HIS 159 ? A HIS 2 185 15 Y 1 A GLN 160 ? A GLN 3 186 15 Y 1 A ASP 161 ? A ASP 4 187 15 Y 1 A HIS 162 ? A HIS 5 188 15 Y 1 A ASN 163 ? A ASN 6 189 15 Y 1 A ASN 164 ? A ASN 7 190 15 Y 1 A PHE 165 ? A PHE 8 191 15 Y 1 A GLN 166 ? A GLN 9 192 15 Y 1 A THR 167 ? A THR 10 193 15 Y 1 A LEU 168 ? A LEU 11 194 15 Y 1 A PRO 169 ? A PRO 12 195 15 Y 1 A TYR 170 ? A TYR 13 196 16 Y 1 A ASN 158 ? A ASN 1 197 16 Y 1 A HIS 159 ? A HIS 2 198 16 Y 1 A GLN 160 ? A GLN 3 199 16 Y 1 A ASP 161 ? A ASP 4 200 16 Y 1 A HIS 162 ? A HIS 5 201 16 Y 1 A ASN 163 ? A ASN 6 202 16 Y 1 A ASN 164 ? A ASN 7 203 16 Y 1 A PHE 165 ? A PHE 8 204 16 Y 1 A GLN 166 ? A GLN 9 205 16 Y 1 A THR 167 ? A THR 10 206 16 Y 1 A LEU 168 ? A LEU 11 207 16 Y 1 A PRO 169 ? A PRO 12 208 16 Y 1 A TYR 170 ? A TYR 13 209 17 Y 1 A ASN 158 ? A ASN 1 210 17 Y 1 A HIS 159 ? A HIS 2 211 17 Y 1 A GLN 160 ? A GLN 3 212 17 Y 1 A ASP 161 ? A ASP 4 213 17 Y 1 A HIS 162 ? A HIS 5 214 17 Y 1 A ASN 163 ? A ASN 6 215 17 Y 1 A ASN 164 ? A ASN 7 216 17 Y 1 A PHE 165 ? A PHE 8 217 17 Y 1 A GLN 166 ? A GLN 9 218 17 Y 1 A THR 167 ? A THR 10 219 17 Y 1 A LEU 168 ? A LEU 11 220 17 Y 1 A PRO 169 ? A PRO 12 221 17 Y 1 A TYR 170 ? A TYR 13 222 18 Y 1 A ASN 158 ? A ASN 1 223 18 Y 1 A HIS 159 ? A HIS 2 224 18 Y 1 A GLN 160 ? A GLN 3 225 18 Y 1 A ASP 161 ? A ASP 4 226 18 Y 1 A HIS 162 ? A HIS 5 227 18 Y 1 A ASN 163 ? A ASN 6 228 18 Y 1 A ASN 164 ? A ASN 7 229 18 Y 1 A PHE 165 ? A PHE 8 230 18 Y 1 A GLN 166 ? A GLN 9 231 18 Y 1 A THR 167 ? A THR 10 232 18 Y 1 A LEU 168 ? A LEU 11 233 18 Y 1 A PRO 169 ? A PRO 12 234 18 Y 1 A TYR 170 ? A TYR 13 235 19 Y 1 A ASN 158 ? A ASN 1 236 19 Y 1 A HIS 159 ? A HIS 2 237 19 Y 1 A GLN 160 ? A GLN 3 238 19 Y 1 A ASP 161 ? A ASP 4 239 19 Y 1 A HIS 162 ? A HIS 5 240 19 Y 1 A ASN 163 ? A ASN 6 241 19 Y 1 A ASN 164 ? A ASN 7 242 19 Y 1 A PHE 165 ? A PHE 8 243 19 Y 1 A GLN 166 ? A GLN 9 244 19 Y 1 A THR 167 ? A THR 10 245 19 Y 1 A LEU 168 ? A LEU 11 246 19 Y 1 A PRO 169 ? A PRO 12 247 19 Y 1 A TYR 170 ? A TYR 13 248 20 Y 1 A ASN 158 ? A ASN 1 249 20 Y 1 A HIS 159 ? A HIS 2 250 20 Y 1 A GLN 160 ? A GLN 3 251 20 Y 1 A ASP 161 ? A ASP 4 252 20 Y 1 A HIS 162 ? A HIS 5 253 20 Y 1 A ASN 163 ? A ASN 6 254 20 Y 1 A ASN 164 ? A ASN 7 255 20 Y 1 A PHE 165 ? A PHE 8 256 20 Y 1 A GLN 166 ? A GLN 9 257 20 Y 1 A THR 167 ? A THR 10 258 20 Y 1 A LEU 168 ? A LEU 11 259 20 Y 1 A PRO 169 ? A PRO 12 260 20 Y 1 A TYR 170 ? A TYR 13 261 21 Y 1 A ASN 158 ? A ASN 1 262 21 Y 1 A HIS 159 ? A HIS 2 263 21 Y 1 A GLN 160 ? A GLN 3 264 21 Y 1 A ASP 161 ? A ASP 4 265 21 Y 1 A HIS 162 ? A HIS 5 266 21 Y 1 A ASN 163 ? A ASN 6 267 21 Y 1 A ASN 164 ? A ASN 7 268 21 Y 1 A PHE 165 ? A PHE 8 269 21 Y 1 A GLN 166 ? A GLN 9 270 21 Y 1 A THR 167 ? A THR 10 271 21 Y 1 A LEU 168 ? A LEU 11 272 21 Y 1 A PRO 169 ? A PRO 12 273 21 Y 1 A TYR 170 ? A TYR 13 274 22 Y 1 A ASN 158 ? A ASN 1 275 22 Y 1 A HIS 159 ? A HIS 2 276 22 Y 1 A GLN 160 ? A GLN 3 277 22 Y 1 A ASP 161 ? A ASP 4 278 22 Y 1 A HIS 162 ? A HIS 5 279 22 Y 1 A ASN 163 ? A ASN 6 280 22 Y 1 A ASN 164 ? A ASN 7 281 22 Y 1 A PHE 165 ? A PHE 8 282 22 Y 1 A GLN 166 ? A GLN 9 283 22 Y 1 A THR 167 ? A THR 10 284 22 Y 1 A LEU 168 ? A LEU 11 285 22 Y 1 A PRO 169 ? A PRO 12 286 22 Y 1 A TYR 170 ? A TYR 13 287 23 Y 1 A ASN 158 ? A ASN 1 288 23 Y 1 A HIS 159 ? A HIS 2 289 23 Y 1 A GLN 160 ? A GLN 3 290 23 Y 1 A ASP 161 ? A ASP 4 291 23 Y 1 A HIS 162 ? A HIS 5 292 23 Y 1 A ASN 163 ? A ASN 6 293 23 Y 1 A ASN 164 ? A ASN 7 294 23 Y 1 A PHE 165 ? A PHE 8 295 23 Y 1 A GLN 166 ? A GLN 9 296 23 Y 1 A THR 167 ? A THR 10 297 23 Y 1 A LEU 168 ? A LEU 11 298 23 Y 1 A PRO 169 ? A PRO 12 299 23 Y 1 A TYR 170 ? A TYR 13 300 24 Y 1 A ASN 158 ? A ASN 1 301 24 Y 1 A HIS 159 ? A HIS 2 302 24 Y 1 A GLN 160 ? A GLN 3 303 24 Y 1 A ASP 161 ? A ASP 4 304 24 Y 1 A HIS 162 ? A HIS 5 305 24 Y 1 A ASN 163 ? A ASN 6 306 24 Y 1 A ASN 164 ? A ASN 7 307 24 Y 1 A PHE 165 ? A PHE 8 308 24 Y 1 A GLN 166 ? A GLN 9 309 24 Y 1 A THR 167 ? A THR 10 310 24 Y 1 A LEU 168 ? A LEU 11 311 24 Y 1 A PRO 169 ? A PRO 12 312 24 Y 1 A TYR 170 ? A TYR 13 313 25 Y 1 A ASN 158 ? A ASN 1 314 25 Y 1 A HIS 159 ? A HIS 2 315 25 Y 1 A GLN 160 ? A GLN 3 316 25 Y 1 A ASP 161 ? A ASP 4 317 25 Y 1 A HIS 162 ? A HIS 5 318 25 Y 1 A ASN 163 ? A ASN 6 319 25 Y 1 A ASN 164 ? A ASN 7 320 25 Y 1 A PHE 165 ? A PHE 8 321 25 Y 1 A GLN 166 ? A GLN 9 322 25 Y 1 A THR 167 ? A THR 10 323 25 Y 1 A LEU 168 ? A LEU 11 324 25 Y 1 A PRO 169 ? A PRO 12 325 25 Y 1 A TYR 170 ? A TYR 13 326 26 Y 1 A ASN 158 ? A ASN 1 327 26 Y 1 A HIS 159 ? A HIS 2 328 26 Y 1 A GLN 160 ? A GLN 3 329 26 Y 1 A ASP 161 ? A ASP 4 330 26 Y 1 A HIS 162 ? A HIS 5 331 26 Y 1 A ASN 163 ? A ASN 6 332 26 Y 1 A ASN 164 ? A ASN 7 333 26 Y 1 A PHE 165 ? A PHE 8 334 26 Y 1 A GLN 166 ? A GLN 9 335 26 Y 1 A THR 167 ? A THR 10 336 26 Y 1 A LEU 168 ? A LEU 11 337 26 Y 1 A PRO 169 ? A PRO 12 338 26 Y 1 A TYR 170 ? A TYR 13 339 27 Y 1 A ASN 158 ? A ASN 1 340 27 Y 1 A HIS 159 ? A HIS 2 341 27 Y 1 A GLN 160 ? A GLN 3 342 27 Y 1 A ASP 161 ? A ASP 4 343 27 Y 1 A HIS 162 ? A HIS 5 344 27 Y 1 A ASN 163 ? A ASN 6 345 27 Y 1 A ASN 164 ? A ASN 7 346 27 Y 1 A PHE 165 ? A PHE 8 347 27 Y 1 A GLN 166 ? A GLN 9 348 27 Y 1 A THR 167 ? A THR 10 349 27 Y 1 A LEU 168 ? A LEU 11 350 27 Y 1 A PRO 169 ? A PRO 12 351 27 Y 1 A TYR 170 ? A TYR 13 352 28 Y 1 A ASN 158 ? A ASN 1 353 28 Y 1 A HIS 159 ? A HIS 2 354 28 Y 1 A GLN 160 ? A GLN 3 355 28 Y 1 A ASP 161 ? A ASP 4 356 28 Y 1 A HIS 162 ? A HIS 5 357 28 Y 1 A ASN 163 ? A ASN 6 358 28 Y 1 A ASN 164 ? A ASN 7 359 28 Y 1 A PHE 165 ? A PHE 8 360 28 Y 1 A GLN 166 ? A GLN 9 361 28 Y 1 A THR 167 ? A THR 10 362 28 Y 1 A LEU 168 ? A LEU 11 363 28 Y 1 A PRO 169 ? A PRO 12 364 28 Y 1 A TYR 170 ? A TYR 13 365 29 Y 1 A ASN 158 ? A ASN 1 366 29 Y 1 A HIS 159 ? A HIS 2 367 29 Y 1 A GLN 160 ? A GLN 3 368 29 Y 1 A ASP 161 ? A ASP 4 369 29 Y 1 A HIS 162 ? A HIS 5 370 29 Y 1 A ASN 163 ? A ASN 6 371 29 Y 1 A ASN 164 ? A ASN 7 372 29 Y 1 A PHE 165 ? A PHE 8 373 29 Y 1 A GLN 166 ? A GLN 9 374 29 Y 1 A THR 167 ? A THR 10 375 29 Y 1 A LEU 168 ? A LEU 11 376 29 Y 1 A PRO 169 ? A PRO 12 377 29 Y 1 A TYR 170 ? A TYR 13 378 30 Y 1 A ASN 158 ? A ASN 1 379 30 Y 1 A HIS 159 ? A HIS 2 380 30 Y 1 A GLN 160 ? A GLN 3 381 30 Y 1 A ASP 161 ? A ASP 4 382 30 Y 1 A HIS 162 ? A HIS 5 383 30 Y 1 A ASN 163 ? A ASN 6 384 30 Y 1 A ASN 164 ? A ASN 7 385 30 Y 1 A PHE 165 ? A PHE 8 386 30 Y 1 A GLN 166 ? A GLN 9 387 30 Y 1 A THR 167 ? A THR 10 388 30 Y 1 A LEU 168 ? A LEU 11 389 30 Y 1 A PRO 169 ? A PRO 12 390 30 Y 1 A TYR 170 ? A TYR 13 391 31 Y 1 A ASN 158 ? A ASN 1 392 31 Y 1 A HIS 159 ? A HIS 2 393 31 Y 1 A GLN 160 ? A GLN 3 394 31 Y 1 A ASP 161 ? A ASP 4 395 31 Y 1 A HIS 162 ? A HIS 5 396 31 Y 1 A ASN 163 ? A ASN 6 397 31 Y 1 A ASN 164 ? A ASN 7 398 31 Y 1 A PHE 165 ? A PHE 8 399 31 Y 1 A GLN 166 ? A GLN 9 400 31 Y 1 A THR 167 ? A THR 10 401 31 Y 1 A LEU 168 ? A LEU 11 402 31 Y 1 A PRO 169 ? A PRO 12 403 31 Y 1 A TYR 170 ? A TYR 13 404 32 Y 1 A ASN 158 ? A ASN 1 405 32 Y 1 A HIS 159 ? A HIS 2 406 32 Y 1 A GLN 160 ? A GLN 3 407 32 Y 1 A ASP 161 ? A ASP 4 408 32 Y 1 A HIS 162 ? A HIS 5 409 32 Y 1 A ASN 163 ? A ASN 6 410 32 Y 1 A ASN 164 ? A ASN 7 411 32 Y 1 A PHE 165 ? A PHE 8 412 32 Y 1 A GLN 166 ? A GLN 9 413 32 Y 1 A THR 167 ? A THR 10 414 32 Y 1 A LEU 168 ? A LEU 11 415 32 Y 1 A PRO 169 ? A PRO 12 416 32 Y 1 A TYR 170 ? A TYR 13 417 33 Y 1 A ASN 158 ? A ASN 1 418 33 Y 1 A HIS 159 ? A HIS 2 419 33 Y 1 A GLN 160 ? A GLN 3 420 33 Y 1 A ASP 161 ? A ASP 4 421 33 Y 1 A HIS 162 ? A HIS 5 422 33 Y 1 A ASN 163 ? A ASN 6 423 33 Y 1 A ASN 164 ? A ASN 7 424 33 Y 1 A PHE 165 ? A PHE 8 425 33 Y 1 A GLN 166 ? A GLN 9 426 33 Y 1 A THR 167 ? A THR 10 427 33 Y 1 A LEU 168 ? A LEU 11 428 33 Y 1 A PRO 169 ? A PRO 12 429 33 Y 1 A TYR 170 ? A TYR 13 430 34 Y 1 A ASN 158 ? A ASN 1 431 34 Y 1 A HIS 159 ? A HIS 2 432 34 Y 1 A GLN 160 ? A GLN 3 433 34 Y 1 A ASP 161 ? A ASP 4 434 34 Y 1 A HIS 162 ? A HIS 5 435 34 Y 1 A ASN 163 ? A ASN 6 436 34 Y 1 A ASN 164 ? A ASN 7 437 34 Y 1 A PHE 165 ? A PHE 8 438 34 Y 1 A GLN 166 ? A GLN 9 439 34 Y 1 A THR 167 ? A THR 10 440 34 Y 1 A LEU 168 ? A LEU 11 441 34 Y 1 A PRO 169 ? A PRO 12 442 34 Y 1 A TYR 170 ? A TYR 13 443 35 Y 1 A ASN 158 ? A ASN 1 444 35 Y 1 A HIS 159 ? A HIS 2 445 35 Y 1 A GLN 160 ? A GLN 3 446 35 Y 1 A ASP 161 ? A ASP 4 447 35 Y 1 A HIS 162 ? A HIS 5 448 35 Y 1 A ASN 163 ? A ASN 6 449 35 Y 1 A ASN 164 ? A ASN 7 450 35 Y 1 A PHE 165 ? A PHE 8 451 35 Y 1 A GLN 166 ? A GLN 9 452 35 Y 1 A THR 167 ? A THR 10 453 35 Y 1 A LEU 168 ? A LEU 11 454 35 Y 1 A PRO 169 ? A PRO 12 455 35 Y 1 A TYR 170 ? A TYR 13 456 36 Y 1 A ASN 158 ? A ASN 1 457 36 Y 1 A HIS 159 ? A HIS 2 458 36 Y 1 A GLN 160 ? A GLN 3 459 36 Y 1 A ASP 161 ? A ASP 4 460 36 Y 1 A HIS 162 ? A HIS 5 461 36 Y 1 A ASN 163 ? A ASN 6 462 36 Y 1 A ASN 164 ? A ASN 7 463 36 Y 1 A PHE 165 ? A PHE 8 464 36 Y 1 A GLN 166 ? A GLN 9 465 36 Y 1 A THR 167 ? A THR 10 466 36 Y 1 A LEU 168 ? A LEU 11 467 36 Y 1 A PRO 169 ? A PRO 12 468 36 Y 1 A TYR 170 ? A TYR 13 469 37 Y 1 A ASN 158 ? A ASN 1 470 37 Y 1 A HIS 159 ? A HIS 2 471 37 Y 1 A GLN 160 ? A GLN 3 472 37 Y 1 A ASP 161 ? A ASP 4 473 37 Y 1 A HIS 162 ? A HIS 5 474 37 Y 1 A ASN 163 ? A ASN 6 475 37 Y 1 A ASN 164 ? A ASN 7 476 37 Y 1 A PHE 165 ? A PHE 8 477 37 Y 1 A GLN 166 ? A GLN 9 478 37 Y 1 A THR 167 ? A THR 10 479 37 Y 1 A LEU 168 ? A LEU 11 480 37 Y 1 A PRO 169 ? A PRO 12 481 37 Y 1 A TYR 170 ? A TYR 13 482 38 Y 1 A ASN 158 ? A ASN 1 483 38 Y 1 A HIS 159 ? A HIS 2 484 38 Y 1 A GLN 160 ? A GLN 3 485 38 Y 1 A ASP 161 ? A ASP 4 486 38 Y 1 A HIS 162 ? A HIS 5 487 38 Y 1 A ASN 163 ? A ASN 6 488 38 Y 1 A ASN 164 ? A ASN 7 489 38 Y 1 A PHE 165 ? A PHE 8 490 38 Y 1 A GLN 166 ? A GLN 9 491 38 Y 1 A THR 167 ? A THR 10 492 38 Y 1 A LEU 168 ? A LEU 11 493 38 Y 1 A PRO 169 ? A PRO 12 494 38 Y 1 A TYR 170 ? A TYR 13 495 39 Y 1 A ASN 158 ? A ASN 1 496 39 Y 1 A HIS 159 ? A HIS 2 497 39 Y 1 A GLN 160 ? A GLN 3 498 39 Y 1 A ASP 161 ? A ASP 4 499 39 Y 1 A HIS 162 ? A HIS 5 500 39 Y 1 A ASN 163 ? A ASN 6 501 39 Y 1 A ASN 164 ? A ASN 7 502 39 Y 1 A PHE 165 ? A PHE 8 503 39 Y 1 A GLN 166 ? A GLN 9 504 39 Y 1 A THR 167 ? A THR 10 505 39 Y 1 A LEU 168 ? A LEU 11 506 39 Y 1 A PRO 169 ? A PRO 12 507 39 Y 1 A TYR 170 ? A TYR 13 508 40 Y 1 A ASN 158 ? A ASN 1 509 40 Y 1 A HIS 159 ? A HIS 2 510 40 Y 1 A GLN 160 ? A GLN 3 511 40 Y 1 A ASP 161 ? A ASP 4 512 40 Y 1 A HIS 162 ? A HIS 5 513 40 Y 1 A ASN 163 ? A ASN 6 514 40 Y 1 A ASN 164 ? A ASN 7 515 40 Y 1 A PHE 165 ? A PHE 8 516 40 Y 1 A GLN 166 ? A GLN 9 517 40 Y 1 A THR 167 ? A THR 10 518 40 Y 1 A LEU 168 ? A LEU 11 519 40 Y 1 A PRO 169 ? A PRO 12 520 40 Y 1 A TYR 170 ? A TYR 13 521 41 Y 1 A ASN 158 ? A ASN 1 522 41 Y 1 A HIS 159 ? A HIS 2 523 41 Y 1 A GLN 160 ? A GLN 3 524 41 Y 1 A ASP 161 ? A ASP 4 525 41 Y 1 A HIS 162 ? A HIS 5 526 41 Y 1 A ASN 163 ? A ASN 6 527 41 Y 1 A ASN 164 ? A ASN 7 528 41 Y 1 A PHE 165 ? A PHE 8 529 41 Y 1 A GLN 166 ? A GLN 9 530 41 Y 1 A THR 167 ? A THR 10 531 41 Y 1 A LEU 168 ? A LEU 11 532 41 Y 1 A PRO 169 ? A PRO 12 533 41 Y 1 A TYR 170 ? A TYR 13 534 42 Y 1 A ASN 158 ? A ASN 1 535 42 Y 1 A HIS 159 ? A HIS 2 536 42 Y 1 A GLN 160 ? A GLN 3 537 42 Y 1 A ASP 161 ? A ASP 4 538 42 Y 1 A HIS 162 ? A HIS 5 539 42 Y 1 A ASN 163 ? A ASN 6 540 42 Y 1 A ASN 164 ? A ASN 7 541 42 Y 1 A PHE 165 ? A PHE 8 542 42 Y 1 A GLN 166 ? A GLN 9 543 42 Y 1 A THR 167 ? A THR 10 544 42 Y 1 A LEU 168 ? A LEU 11 545 42 Y 1 A PRO 169 ? A PRO 12 546 42 Y 1 A TYR 170 ? A TYR 13 547 43 Y 1 A ASN 158 ? A ASN 1 548 43 Y 1 A HIS 159 ? A HIS 2 549 43 Y 1 A GLN 160 ? A GLN 3 550 43 Y 1 A ASP 161 ? A ASP 4 551 43 Y 1 A HIS 162 ? A HIS 5 552 43 Y 1 A ASN 163 ? A ASN 6 553 43 Y 1 A ASN 164 ? A ASN 7 554 43 Y 1 A PHE 165 ? A PHE 8 555 43 Y 1 A GLN 166 ? A GLN 9 556 43 Y 1 A THR 167 ? A THR 10 557 43 Y 1 A LEU 168 ? A LEU 11 558 43 Y 1 A PRO 169 ? A PRO 12 559 43 Y 1 A TYR 170 ? A TYR 13 560 44 Y 1 A ASN 158 ? A ASN 1 561 44 Y 1 A HIS 159 ? A HIS 2 562 44 Y 1 A GLN 160 ? A GLN 3 563 44 Y 1 A ASP 161 ? A ASP 4 564 44 Y 1 A HIS 162 ? A HIS 5 565 44 Y 1 A ASN 163 ? A ASN 6 566 44 Y 1 A ASN 164 ? A ASN 7 567 44 Y 1 A PHE 165 ? A PHE 8 568 44 Y 1 A GLN 166 ? A GLN 9 569 44 Y 1 A THR 167 ? A THR 10 570 44 Y 1 A LEU 168 ? A LEU 11 571 44 Y 1 A PRO 169 ? A PRO 12 572 44 Y 1 A TYR 170 ? A TYR 13 573 45 Y 1 A ASN 158 ? A ASN 1 574 45 Y 1 A HIS 159 ? A HIS 2 575 45 Y 1 A GLN 160 ? A GLN 3 576 45 Y 1 A ASP 161 ? A ASP 4 577 45 Y 1 A HIS 162 ? A HIS 5 578 45 Y 1 A ASN 163 ? A ASN 6 579 45 Y 1 A ASN 164 ? A ASN 7 580 45 Y 1 A PHE 165 ? A PHE 8 581 45 Y 1 A GLN 166 ? A GLN 9 582 45 Y 1 A THR 167 ? A THR 10 583 45 Y 1 A LEU 168 ? A LEU 11 584 45 Y 1 A PRO 169 ? A PRO 12 585 45 Y 1 A TYR 170 ? A TYR 13 586 46 Y 1 A ASN 158 ? A ASN 1 587 46 Y 1 A HIS 159 ? A HIS 2 588 46 Y 1 A GLN 160 ? A GLN 3 589 46 Y 1 A ASP 161 ? A ASP 4 590 46 Y 1 A HIS 162 ? A HIS 5 591 46 Y 1 A ASN 163 ? A ASN 6 592 46 Y 1 A ASN 164 ? A ASN 7 593 46 Y 1 A PHE 165 ? A PHE 8 594 46 Y 1 A GLN 166 ? A GLN 9 595 46 Y 1 A THR 167 ? A THR 10 596 46 Y 1 A LEU 168 ? A LEU 11 597 46 Y 1 A PRO 169 ? A PRO 12 598 46 Y 1 A TYR 170 ? A TYR 13 599 47 Y 1 A ASN 158 ? A ASN 1 600 47 Y 1 A HIS 159 ? A HIS 2 601 47 Y 1 A GLN 160 ? A GLN 3 602 47 Y 1 A ASP 161 ? A ASP 4 603 47 Y 1 A HIS 162 ? A HIS 5 604 47 Y 1 A ASN 163 ? A ASN 6 605 47 Y 1 A ASN 164 ? A ASN 7 606 47 Y 1 A PHE 165 ? A PHE 8 607 47 Y 1 A GLN 166 ? A GLN 9 608 47 Y 1 A THR 167 ? A THR 10 609 47 Y 1 A LEU 168 ? A LEU 11 610 47 Y 1 A PRO 169 ? A PRO 12 611 47 Y 1 A TYR 170 ? A TYR 13 612 48 Y 1 A ASN 158 ? A ASN 1 613 48 Y 1 A HIS 159 ? A HIS 2 614 48 Y 1 A GLN 160 ? A GLN 3 615 48 Y 1 A ASP 161 ? A ASP 4 616 48 Y 1 A HIS 162 ? A HIS 5 617 48 Y 1 A ASN 163 ? A ASN 6 618 48 Y 1 A ASN 164 ? A ASN 7 619 48 Y 1 A PHE 165 ? A PHE 8 620 48 Y 1 A GLN 166 ? A GLN 9 621 48 Y 1 A THR 167 ? A THR 10 622 48 Y 1 A LEU 168 ? A LEU 11 623 48 Y 1 A PRO 169 ? A PRO 12 624 48 Y 1 A TYR 170 ? A TYR 13 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 PHE N N N N 175 PHE CA C N S 176 PHE C C N N 177 PHE O O N N 178 PHE CB C N N 179 PHE CG C Y N 180 PHE CD1 C Y N 181 PHE CD2 C Y N 182 PHE CE1 C Y N 183 PHE CE2 C Y N 184 PHE CZ C Y N 185 PHE OXT O N N 186 PHE H H N N 187 PHE H2 H N N 188 PHE HA H N N 189 PHE HB2 H N N 190 PHE HB3 H N N 191 PHE HD1 H N N 192 PHE HD2 H N N 193 PHE HE1 H N N 194 PHE HE2 H N N 195 PHE HZ H N N 196 PHE HXT H N N 197 PRO N N N N 198 PRO CA C N S 199 PRO C C N N 200 PRO O O N N 201 PRO CB C N N 202 PRO CG C N N 203 PRO CD C N N 204 PRO OXT O N N 205 PRO H H N N 206 PRO HA H N N 207 PRO HB2 H N N 208 PRO HB3 H N N 209 PRO HG2 H N N 210 PRO HG3 H N N 211 PRO HD2 H N N 212 PRO HD3 H N N 213 PRO HXT H N N 214 SER N N N N 215 SER CA C N S 216 SER C C N N 217 SER O O N N 218 SER CB C N N 219 SER OG O N N 220 SER OXT O N N 221 SER H H N N 222 SER H2 H N N 223 SER HA H N N 224 SER HB2 H N N 225 SER HB3 H N N 226 SER HG H N N 227 SER HXT H N N 228 THR N N N N 229 THR CA C N S 230 THR C C N N 231 THR O O N N 232 THR CB C N R 233 THR OG1 O N N 234 THR CG2 C N N 235 THR OXT O N N 236 THR H H N N 237 THR H2 H N N 238 THR HA H N N 239 THR HB H N N 240 THR HG1 H N N 241 THR HG21 H N N 242 THR HG22 H N N 243 THR HG23 H N N 244 THR HXT H N N 245 TYR N N N N 246 TYR CA C N S 247 TYR C C N N 248 TYR O O N N 249 TYR CB C N N 250 TYR CG C Y N 251 TYR CD1 C Y N 252 TYR CD2 C Y N 253 TYR CE1 C Y N 254 TYR CE2 C Y N 255 TYR CZ C Y N 256 TYR OH O N N 257 TYR OXT O N N 258 TYR H H N N 259 TYR H2 H N N 260 TYR HA H N N 261 TYR HB2 H N N 262 TYR HB3 H N N 263 TYR HD1 H N N 264 TYR HD2 H N N 265 TYR HE1 H N N 266 TYR HE2 H N N 267 TYR HH H N N 268 TYR HXT H N N 269 VAL N N N N 270 VAL CA C N S 271 VAL C C N N 272 VAL O O N N 273 VAL CB C N N 274 VAL CG1 C N N 275 VAL CG2 C N N 276 VAL OXT O N N 277 VAL H H N N 278 VAL H2 H N N 279 VAL HA H N N 280 VAL HB H N N 281 VAL HG11 H N N 282 VAL HG12 H N N 283 VAL HG13 H N N 284 VAL HG21 H N N 285 VAL HG22 H N N 286 VAL HG23 H N N 287 VAL HXT H N N 288 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 PHE N CA sing N N 166 PHE N H sing N N 167 PHE N H2 sing N N 168 PHE CA C sing N N 169 PHE CA CB sing N N 170 PHE CA HA sing N N 171 PHE C O doub N N 172 PHE C OXT sing N N 173 PHE CB CG sing N N 174 PHE CB HB2 sing N N 175 PHE CB HB3 sing N N 176 PHE CG CD1 doub Y N 177 PHE CG CD2 sing Y N 178 PHE CD1 CE1 sing Y N 179 PHE CD1 HD1 sing N N 180 PHE CD2 CE2 doub Y N 181 PHE CD2 HD2 sing N N 182 PHE CE1 CZ doub Y N 183 PHE CE1 HE1 sing N N 184 PHE CE2 CZ sing Y N 185 PHE CE2 HE2 sing N N 186 PHE CZ HZ sing N N 187 PHE OXT HXT sing N N 188 PRO N CA sing N N 189 PRO N CD sing N N 190 PRO N H sing N N 191 PRO CA C sing N N 192 PRO CA CB sing N N 193 PRO CA HA sing N N 194 PRO C O doub N N 195 PRO C OXT sing N N 196 PRO CB CG sing N N 197 PRO CB HB2 sing N N 198 PRO CB HB3 sing N N 199 PRO CG CD sing N N 200 PRO CG HG2 sing N N 201 PRO CG HG3 sing N N 202 PRO CD HD2 sing N N 203 PRO CD HD3 sing N N 204 PRO OXT HXT sing N N 205 SER N CA sing N N 206 SER N H sing N N 207 SER N H2 sing N N 208 SER CA C sing N N 209 SER CA CB sing N N 210 SER CA HA sing N N 211 SER C O doub N N 212 SER C OXT sing N N 213 SER CB OG sing N N 214 SER CB HB2 sing N N 215 SER CB HB3 sing N N 216 SER OG HG sing N N 217 SER OXT HXT sing N N 218 THR N CA sing N N 219 THR N H sing N N 220 THR N H2 sing N N 221 THR CA C sing N N 222 THR CA CB sing N N 223 THR CA HA sing N N 224 THR C O doub N N 225 THR C OXT sing N N 226 THR CB OG1 sing N N 227 THR CB CG2 sing N N 228 THR CB HB sing N N 229 THR OG1 HG1 sing N N 230 THR CG2 HG21 sing N N 231 THR CG2 HG22 sing N N 232 THR CG2 HG23 sing N N 233 THR OXT HXT sing N N 234 TYR N CA sing N N 235 TYR N H sing N N 236 TYR N H2 sing N N 237 TYR CA C sing N N 238 TYR CA CB sing N N 239 TYR CA HA sing N N 240 TYR C O doub N N 241 TYR C OXT sing N N 242 TYR CB CG sing N N 243 TYR CB HB2 sing N N 244 TYR CB HB3 sing N N 245 TYR CG CD1 doub Y N 246 TYR CG CD2 sing Y N 247 TYR CD1 CE1 sing Y N 248 TYR CD1 HD1 sing N N 249 TYR CD2 CE2 doub Y N 250 TYR CD2 HD2 sing N N 251 TYR CE1 CZ doub Y N 252 TYR CE1 HE1 sing N N 253 TYR CE2 CZ sing Y N 254 TYR CE2 HE2 sing N N 255 TYR CZ OH sing N N 256 TYR OH HH sing N N 257 TYR OXT HXT sing N N 258 VAL N CA sing N N 259 VAL N H sing N N 260 VAL N H2 sing N N 261 VAL CA C sing N N 262 VAL CA CB sing N N 263 VAL CA HA sing N N 264 VAL C O doub N N 265 VAL C OXT sing N N 266 VAL CB CG1 sing N N 267 VAL CB CG2 sing N N 268 VAL CB HB sing N N 269 VAL CG1 HG11 sing N N 270 VAL CG1 HG12 sing N N 271 VAL CG1 HG13 sing N N 272 VAL CG2 HG21 sing N N 273 VAL CG2 HG22 sing N N 274 VAL CG2 HG23 sing N N 275 VAL OXT HXT sing N N 276 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 ? Varian 750 2 ? Bruker 500 # _atom_sites.entry_id 1BRV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_