data_1BRZ # _entry.id 1BRZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1BRZ WWPDB D_1000172044 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BRZ _pdbx_database_status.recvd_initial_deposition_date 1998-03-12 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Caldwell, J.E.' 1 'Abildgaard, F.' 2 'Dzakula, Z.' 3 'Ming, D.' 4 'Hellekant, G.' 5 'Markley, J.L.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of the thermostable sweet-tasting protein brazzein.' Nat.Struct.Biol. 5 427 431 1998 NSBIEW US 1072-8368 2024 ? 9628478 10.1038/nsb0698-427 1 'Complete 1H and Partial 13C Resonance Assignments at 37 and 22 Degrees C for Brazzein, an Intensely Sweet Protein' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 2 'Brazzein, a New High-Potency Thermostable Sweet Protein from Pentadiplandra Brazzeana B' 'FEBS Lett.' 355 106 ? 1994 FEBLAL NE 0014-5793 0165 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Caldwell, J.E.' 1 ? primary 'Abildgaard, F.' 2 ? primary 'Dzakula, Z.' 3 ? primary 'Ming, D.' 4 ? primary 'Hellekant, G.' 5 ? primary 'Markley, J.L.' 6 ? 1 'Caldwell, J.E.' 7 ? 1 'Abildgaard, F.' 8 ? 1 'Ming, D.' 9 ? 1 'Hellekant, G.' 10 ? 1 'Markley, J.L.' 11 ? 2 'Ming, D.' 12 ? 2 'Hellekant, G.' 13 ? # _cell.entry_id 1BRZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BRZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description BRAZZEIN _entity.formula_weight 6491.328 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(PCA)DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY' _entity_poly.pdbx_seq_one_letter_code_can QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 ASP n 1 3 LYS n 1 4 CYS n 1 5 LYS n 1 6 LYS n 1 7 VAL n 1 8 TYR n 1 9 GLU n 1 10 ASN n 1 11 TYR n 1 12 PRO n 1 13 VAL n 1 14 SER n 1 15 LYS n 1 16 CYS n 1 17 GLN n 1 18 LEU n 1 19 ALA n 1 20 ASN n 1 21 GLN n 1 22 CYS n 1 23 ASN n 1 24 TYR n 1 25 ASP n 1 26 CYS n 1 27 LYS n 1 28 LEU n 1 29 ASP n 1 30 LYS n 1 31 HIS n 1 32 ALA n 1 33 ARG n 1 34 SER n 1 35 GLY n 1 36 GLU n 1 37 CYS n 1 38 PHE n 1 39 TYR n 1 40 ASP n 1 41 GLU n 1 42 LYS n 1 43 ARG n 1 44 ASN n 1 45 LEU n 1 46 GLN n 1 47 CYS n 1 48 ILE n 1 49 CYS n 1 50 ASP n 1 51 TYR n 1 52 CYS n 1 53 GLU n 1 54 TYR n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Pentadiplandra brazzeana' _entity_src_nat.pdbx_ncbi_taxonomy_id 43545 _entity_src_nat.genus Pentadiplandra _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue 'PULP SURROUNDING SEEDS' _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ FRUIT _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details 'EXTRACTED FROM FRUIT GROWN IN THE WILD' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRAZ_PENBA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P56552 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BRZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56552 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 54 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 54 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 E.COSY 1 3 1 DQ 1 4 1 'DQF COSY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AM600 Bruker 600 2 DMX750 Bruker 750 # _pdbx_nmr_refine.entry_id 1BRZ _pdbx_nmr_refine.method 'DYNAMICAL SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE. REFINED USING FOUR CYCLES OF SIMULATED ANNEALING REFINEMENT IN X-PLOR.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1BRZ _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 43 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.843 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 1BRZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BRZ _struct.title 'SOLUTION STRUCTURE OF THE SWEET PROTEIN BRAZZEIN, NMR, 43 STRUCTURES' _struct.pdbx_descriptor BRAZZEIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BRZ _struct_keywords.pdbx_keywords 'SWEET PROTEIN' _struct_keywords.text 'SWEET PROTEIN, CYSTEINE-STABILIZED ALPHA-BETA' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 21 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 21 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 29 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 4 A CYS 52 1_555 ? ? ? ? ? ? ? 2.030 ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 16 A CYS 37 1_555 ? ? ? ? ? ? ? 2.033 ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 22 A CYS 47 1_555 ? ? ? ? ? ? ? 2.031 ? disulf4 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 26 A CYS 49 1_555 ? ? ? ? ? ? ? 2.033 ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A ASP 2 N ? ? A PCA 1 A ASP 2 1_555 ? ? ? ? ? ? ? 1.329 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 LYS A 5 ? VAL A 7 ? LYS A 5 VAL A 7 S1 2 ASN A 44 ? ASP A 50 ? ASN A 44 ASP A 50 S1 3 SER A 34 ? TYR A 39 ? SER A 34 TYR A 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O LYS A 6 ? O LYS A 6 N CYS A 49 ? N CYS A 49 S1 2 3 O ASP A 50 ? O ASP A 50 N SER A 34 ? N SER A 34 # _database_PDB_matrix.entry_id 1BRZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BRZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 TYR 54 54 54 TYR TYR A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'PYROGLUTAMIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-01 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2019-12-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 4 'Structure model' 'Polymer sequence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_poly 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_mod_residue 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 2 4 'Structure model' '_pdbx_database_status.process_site' 3 4 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.843 ? 1 X-PLOR refinement 3.843 ? 2 X-PLOR phasing 3.843 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 25 ? ? H A ASP 29 ? ? 1.45 2 1 O A ASP 40 ? ? H A LYS 42 ? ? 1.45 3 2 O A ASP 25 ? ? H A ASP 29 ? ? 1.48 4 3 O A ASP 25 ? ? H A ASP 29 ? ? 1.38 5 3 O A PRO 12 ? ? H A SER 14 ? ? 1.40 6 4 O A ASP 25 ? ? H A ASP 29 ? ? 1.38 7 4 O A LEU 18 ? ? H A ASN 20 ? ? 1.41 8 4 O A ASP 40 ? ? H A LYS 42 ? ? 1.48 9 5 O A LEU 28 ? ? H A HIS 31 ? ? 1.39 10 6 O A ASP 25 ? ? H A ASP 29 ? ? 1.33 11 6 O A LEU 18 ? ? H A ASN 20 ? ? 1.43 12 7 O A ASP 25 ? ? H A ASP 29 ? ? 1.41 13 7 O A ASP 40 ? ? H A LYS 42 ? ? 1.53 14 8 OD1 A ASP 50 ? ? H A GLU 53 ? ? 1.51 15 8 O A LEU 28 ? ? H A HIS 31 ? ? 1.60 16 9 O A ASP 25 ? ? H A ASP 29 ? ? 1.35 17 10 O A TYR 11 ? ? H A VAL 13 ? ? 1.39 18 10 O A LEU 28 ? ? H A HIS 31 ? ? 1.49 19 10 HE A ARG 33 ? ? O A TYR 51 ? ? 1.57 20 10 O A LEU 28 ? ? N A LYS 30 ? ? 2.15 21 11 O A ASP 25 ? ? H A ASP 29 ? ? 1.39 22 12 O A ASP 25 ? ? H A ASP 29 ? ? 1.38 23 12 H A LYS 42 ? ? OD1 A ASN 44 ? ? 1.58 24 13 HZ2 A LYS 6 ? ? HH A TYR 51 ? ? 1.29 25 13 O A ASP 25 ? ? H A ASP 29 ? ? 1.35 26 13 O A ASN 20 ? ? H A CYS 22 ? ? 1.42 27 14 O A ASP 25 ? ? H A ASP 29 ? ? 1.34 28 14 O A GLU 9 ? ? H A TYR 11 ? ? 1.37 29 14 OD2 A ASP 40 ? ? HD21 A ASN 44 ? ? 1.55 30 15 HG A SER 14 ? ? H A LYS 15 ? ? 1.26 31 15 O A ASP 25 ? ? H A ASP 29 ? ? 1.37 32 15 O A TYR 11 ? ? H A VAL 13 ? ? 1.39 33 15 OG A SER 14 ? ? H A LYS 15 ? ? 1.59 34 16 O A LEU 28 ? ? H A HIS 31 ? ? 1.38 35 16 O A TYR 11 ? ? H A VAL 13 ? ? 1.56 36 16 O A GLN 21 ? ? H A ASP 25 ? ? 1.60 37 17 O A ASP 25 ? ? H A ASP 29 ? ? 1.37 38 18 O A LEU 18 ? ? H A ASN 20 ? ? 1.43 39 18 O A LEU 28 ? ? H A HIS 31 ? ? 1.44 40 19 O A ASP 25 ? ? H A ASP 29 ? ? 1.44 41 20 O A ASP 25 ? ? H A ASP 29 ? ? 1.34 42 20 O A ASN 20 ? ? H A CYS 22 ? ? 1.35 43 21 O A ASP 25 ? ? H A ASP 29 ? ? 1.56 44 21 O A GLN 21 ? ? H A ASP 25 ? ? 1.59 45 21 O A CYS 52 ? ? H A TYR 54 ? ? 1.60 46 22 O A ASP 25 ? ? H A ASP 29 ? ? 1.51 47 23 O A ASP 25 ? ? H A ASP 29 ? ? 1.40 48 24 O A ASP 25 ? ? H A ASP 29 ? ? 1.37 49 24 O A PRO 12 ? ? H A SER 14 ? ? 1.39 50 25 O A ASP 25 ? ? H A ASP 29 ? ? 1.38 51 25 HZ3 A LYS 42 ? ? OD1 A ASN 44 ? ? 1.57 52 26 O A LEU 28 ? ? H A LYS 30 ? ? 1.27 53 27 O A ASP 25 ? ? H A ASP 29 ? ? 1.36 54 28 O A TYR 8 ? ? H A ASN 10 ? ? 1.42 55 28 O A ASP 25 ? ? H A ASP 29 ? ? 1.58 56 29 O A ASP 25 ? ? H A ASP 29 ? ? 1.44 57 29 O A GLU 9 ? ? H A TYR 11 ? ? 1.47 58 29 OD1 A ASP 40 ? ? HE22 A GLN 46 ? ? 1.59 59 29 O A PCA 1 ? ? H A LYS 3 ? ? 1.60 60 30 O A ASP 25 ? ? H A ASP 29 ? ? 1.34 61 30 OG A SER 14 ? ? H A LYS 15 ? ? 1.54 62 31 O A ASP 25 ? ? H A ASP 29 ? ? 1.38 63 31 O A VAL 7 ? ? H A GLU 9 ? ? 1.51 64 32 O A LEU 28 ? ? H A HIS 31 ? ? 1.42 65 33 O A ASP 25 ? ? H A ASP 29 ? ? 1.37 66 33 O A GLU 9 ? ? H A TYR 11 ? ? 1.46 67 33 O A ASP 40 ? ? H A LYS 42 ? ? 1.58 68 33 OD1 A ASN 20 ? ? H A GLN 21 ? ? 1.58 69 34 O A ASP 25 ? ? H A ASP 29 ? ? 1.39 70 34 O A GLU 9 ? ? H A TYR 11 ? ? 1.42 71 35 O A ASP 25 ? ? H A ASP 29 ? ? 1.40 72 36 O A ASP 25 ? ? H A ASP 29 ? ? 1.39 73 37 O A CYS 16 ? ? H A LEU 18 ? ? 1.29 74 37 O A ASN 20 ? ? H A CYS 22 ? ? 1.36 75 37 O A ASP 25 ? ? H A ASP 29 ? ? 1.38 76 37 O A VAL 13 ? ? H A LYS 15 ? ? 1.59 77 37 HH A TYR 11 ? ? O A GLN 21 ? ? 1.60 78 38 HZ2 A LYS 27 ? ? O A ARG 33 ? ? 1.36 79 38 O A GLU 9 ? ? H A TYR 11 ? ? 1.45 80 38 O A LYS 3 ? ? HZ2 A LYS 6 ? ? 1.46 81 38 O A ASP 25 ? ? H A ASP 29 ? ? 1.53 82 39 O A ASP 25 ? ? H A ASP 29 ? ? 1.37 83 39 O A VAL 7 ? ? H A GLU 9 ? ? 1.57 84 40 O A ASP 25 ? ? H A ASP 29 ? ? 1.42 85 40 OD1 A ASP 40 ? ? H A GLU 41 ? ? 1.60 86 41 O A ASP 25 ? ? H A ASP 29 ? ? 1.37 87 41 O A PRO 12 ? ? H A SER 14 ? ? 1.38 88 42 O A ASP 25 ? ? H A ASP 29 ? ? 1.45 89 43 O A LEU 18 ? ? H A ASN 20 ? ? 1.43 90 43 OE1 A GLU 9 ? ? H A ASN 10 ? ? 1.46 91 43 O A ASP 40 ? ? H A LYS 42 ? ? 1.52 92 43 O A ASP 25 ? ? H A ASP 29 ? ? 1.56 93 43 HH22 A ARG 33 ? ? O A GLU 53 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 4 ? ? -151.51 21.70 2 1 TYR A 8 ? ? -61.25 73.85 3 1 GLU A 9 ? ? 16.36 -125.86 4 1 ASN A 10 ? ? -57.21 -122.20 5 1 TYR A 11 ? ? 97.64 95.67 6 1 SER A 14 ? ? 19.12 -79.00 7 1 LYS A 15 ? ? -65.44 -87.75 8 1 CYS A 16 ? ? 28.10 81.30 9 1 GLN A 17 ? ? -142.26 -23.73 10 1 ALA A 19 ? ? -54.73 -157.08 11 1 ASN A 20 ? ? 76.38 -87.70 12 1 GLN A 21 ? ? -30.29 -90.37 13 1 ASN A 23 ? ? -51.83 -71.74 14 1 LYS A 27 ? ? -62.14 10.97 15 1 LEU A 28 ? ? -165.49 -45.52 16 1 LYS A 30 ? ? -141.37 30.07 17 1 HIS A 31 ? ? 32.42 39.13 18 1 SER A 34 ? ? -163.61 -157.08 19 1 GLU A 41 ? ? -63.32 42.97 20 1 ARG A 43 ? ? 89.63 61.36 21 1 GLU A 53 ? ? -167.71 59.61 22 2 LYS A 3 ? ? 51.64 94.92 23 2 CYS A 4 ? ? 175.20 18.57 24 2 GLU A 9 ? ? 32.11 -149.70 25 2 TYR A 11 ? ? 99.40 128.72 26 2 VAL A 13 ? ? 110.44 18.66 27 2 LYS A 15 ? ? -173.94 141.04 28 2 CYS A 16 ? ? -176.65 58.67 29 2 ASN A 20 ? ? -178.77 -95.90 30 2 LYS A 27 ? ? -60.43 5.24 31 2 LEU A 28 ? ? -163.22 -47.12 32 2 HIS A 31 ? ? 35.20 43.11 33 2 SER A 34 ? ? -174.06 -154.29 34 2 LYS A 42 ? ? -96.32 -80.40 35 2 ARG A 43 ? ? 173.08 32.68 36 2 CYS A 52 ? ? -114.91 -105.40 37 2 GLU A 53 ? ? -165.67 -146.75 38 3 ASP A 2 ? ? 83.00 -160.55 39 3 LYS A 3 ? ? 55.40 151.76 40 3 CYS A 4 ? ? -160.42 -25.42 41 3 GLU A 9 ? ? 21.12 110.15 42 3 ASN A 10 ? ? 15.67 56.94 43 3 VAL A 13 ? ? -60.20 41.52 44 3 LYS A 15 ? ? -172.56 141.52 45 3 CYS A 16 ? ? -173.09 0.07 46 3 GLN A 17 ? ? -87.49 46.73 47 3 LEU A 18 ? ? -167.48 -95.85 48 3 ALA A 19 ? ? 170.81 -165.50 49 3 ASN A 20 ? ? 60.60 -74.55 50 3 GLN A 21 ? ? -35.62 -73.17 51 3 ASN A 23 ? ? -56.81 -76.20 52 3 LYS A 27 ? ? -61.18 12.22 53 3 LEU A 28 ? ? -166.60 -37.88 54 3 SER A 34 ? ? -172.37 -159.59 55 3 ASP A 40 ? ? -42.34 167.05 56 3 ARG A 43 ? ? 60.62 61.45 57 3 CYS A 52 ? ? -98.98 34.26 58 4 ASN A 10 ? ? -178.45 -98.58 59 4 VAL A 13 ? ? 102.06 2.69 60 4 SER A 14 ? ? -60.73 -75.08 61 4 CYS A 16 ? ? -172.37 28.09 62 4 LEU A 18 ? ? -169.37 119.16 63 4 ALA A 19 ? ? -61.23 52.05 64 4 ASN A 20 ? ? -140.87 -82.37 65 4 LYS A 27 ? ? -59.62 7.21 66 4 LEU A 28 ? ? -166.35 -37.02 67 4 SER A 34 ? ? 178.07 146.12 68 4 GLU A 41 ? ? -63.29 39.82 69 4 LYS A 42 ? ? -143.96 21.11 70 4 CYS A 52 ? ? -108.70 -112.78 71 4 GLU A 53 ? ? 38.80 -85.02 72 5 CYS A 4 ? ? -164.36 -86.48 73 5 GLU A 9 ? ? 32.54 -154.39 74 5 ASN A 10 ? ? 11.89 104.35 75 5 TYR A 11 ? ? -176.81 133.23 76 5 PRO A 12 ? ? -71.00 47.28 77 5 VAL A 13 ? ? 12.02 54.05 78 5 SER A 14 ? ? -63.58 -125.06 79 5 CYS A 16 ? ? -173.42 93.89 80 5 GLN A 17 ? ? 156.46 -48.02 81 5 ALA A 19 ? ? -52.86 92.26 82 5 ASN A 20 ? ? -173.43 -121.66 83 5 GLN A 21 ? ? -5.17 -79.45 84 5 LYS A 27 ? ? -61.24 11.00 85 5 LEU A 28 ? ? -161.14 -137.50 86 5 ASP A 29 ? ? 52.25 -78.99 87 5 HIS A 31 ? ? 70.19 65.97 88 5 SER A 34 ? ? -176.51 -169.74 89 5 GLU A 36 ? ? -176.86 143.51 90 5 GLU A 41 ? ? -65.67 25.40 91 5 LYS A 42 ? ? -145.26 -77.78 92 5 ARG A 43 ? ? -179.12 12.57 93 5 TYR A 51 ? ? -97.31 -94.43 94 5 GLU A 53 ? ? -41.25 101.88 95 6 ASP A 2 ? ? -166.10 86.19 96 6 LYS A 3 ? ? 64.84 164.99 97 6 CYS A 4 ? ? -162.04 37.36 98 6 GLU A 9 ? ? 88.23 143.34 99 6 ASN A 10 ? ? 15.33 46.61 100 6 PRO A 12 ? ? -41.43 86.87 101 6 VAL A 13 ? ? -53.17 97.39 102 6 SER A 14 ? ? -177.59 -82.09 103 6 LYS A 15 ? ? -68.71 99.33 104 6 CYS A 16 ? ? -172.59 105.12 105 6 GLN A 17 ? ? 169.37 36.11 106 6 ALA A 19 ? ? -60.63 55.32 107 6 ASN A 20 ? ? -148.75 -115.06 108 6 GLN A 21 ? ? 3.41 -79.76 109 6 LYS A 27 ? ? -59.48 8.71 110 6 LEU A 28 ? ? -164.28 -36.68 111 6 SER A 34 ? ? -175.06 -165.32 112 6 GLU A 36 ? ? -175.96 146.44 113 6 GLU A 41 ? ? 16.45 -74.53 114 6 LYS A 42 ? ? -99.09 45.43 115 6 ARG A 43 ? ? 23.50 66.00 116 6 LEU A 45 ? ? 36.74 93.83 117 6 CYS A 52 ? ? -140.25 -76.22 118 6 GLU A 53 ? ? 50.85 16.10 119 7 LYS A 3 ? ? 42.50 104.44 120 7 GLU A 9 ? ? 90.46 -123.41 121 7 ASN A 10 ? ? -53.47 -122.43 122 7 TYR A 11 ? ? 102.29 137.94 123 7 VAL A 13 ? ? -52.61 106.28 124 7 SER A 14 ? ? -173.51 -80.17 125 7 CYS A 16 ? ? -65.15 84.07 126 7 ASN A 20 ? ? 150.45 -97.03 127 7 LYS A 27 ? ? -60.17 7.93 128 7 LEU A 28 ? ? -164.42 -20.82 129 7 SER A 34 ? ? -177.64 -140.33 130 7 GLU A 41 ? ? -64.19 36.49 131 7 ASN A 44 ? ? -143.82 -138.18 132 7 CYS A 52 ? ? -94.57 -82.25 133 7 GLU A 53 ? ? 86.28 -67.27 134 8 ASP A 2 ? ? -138.99 -117.79 135 8 LYS A 3 ? ? 23.12 83.28 136 8 CYS A 4 ? ? -64.29 5.74 137 8 GLU A 9 ? ? -61.94 71.30 138 8 ASN A 10 ? ? 177.94 -79.16 139 8 TYR A 11 ? ? -0.42 114.40 140 8 PRO A 12 ? ? -44.11 98.54 141 8 VAL A 13 ? ? -54.29 87.71 142 8 SER A 14 ? ? -176.20 139.44 143 8 LYS A 15 ? ? 84.20 8.54 144 8 CYS A 16 ? ? -67.95 21.41 145 8 ALA A 19 ? ? -56.52 -178.92 146 8 ASN A 20 ? ? 80.22 -72.42 147 8 GLN A 21 ? ? -54.91 77.07 148 8 CYS A 22 ? ? 125.98 -54.29 149 8 LYS A 27 ? ? -58.08 4.16 150 8 LEU A 28 ? ? -164.80 -124.99 151 8 ASP A 29 ? ? 36.88 -81.54 152 8 SER A 34 ? ? -165.99 -168.11 153 8 GLU A 53 ? ? 35.36 34.87 154 9 LYS A 3 ? ? -65.17 -139.71 155 9 GLU A 9 ? ? -62.29 74.03 156 9 ASN A 10 ? ? 125.15 118.65 157 9 TYR A 11 ? ? 178.56 140.22 158 9 PRO A 12 ? ? -66.70 73.66 159 9 VAL A 13 ? ? -55.38 99.75 160 9 SER A 14 ? ? -175.89 -66.03 161 9 CYS A 16 ? ? -67.42 83.84 162 9 GLN A 17 ? ? -145.87 22.78 163 9 ALA A 19 ? ? -56.27 74.20 164 9 ASN A 20 ? ? -162.39 -113.09 165 9 GLN A 21 ? ? -3.18 -78.60 166 9 ASP A 25 ? ? -54.39 -71.72 167 9 LYS A 27 ? ? -59.57 0.20 168 9 LEU A 28 ? ? -164.93 -26.72 169 9 SER A 34 ? ? -179.13 -169.94 170 9 TYR A 39 ? ? -57.08 -173.91 171 9 ASP A 40 ? ? -170.75 85.07 172 9 GLU A 41 ? ? 30.56 27.80 173 9 ARG A 43 ? ? 66.55 -2.82 174 9 CYS A 52 ? ? -143.62 -84.79 175 9 GLU A 53 ? ? 146.70 -14.29 176 10 TYR A 8 ? ? -51.06 -5.59 177 10 GLU A 9 ? ? 91.15 6.79 178 10 ASN A 10 ? ? 113.47 74.36 179 10 PRO A 12 ? ? -60.13 40.06 180 10 VAL A 13 ? ? 8.15 81.95 181 10 SER A 14 ? ? -175.77 20.80 182 10 LYS A 15 ? ? -172.05 101.74 183 10 CYS A 16 ? ? -170.95 1.77 184 10 LEU A 18 ? ? -165.22 -114.86 185 10 ALA A 19 ? ? 165.67 46.14 186 10 ASN A 20 ? ? -137.90 -63.62 187 10 GLN A 21 ? ? -39.83 -72.23 188 10 LYS A 27 ? ? -57.05 0.48 189 10 LEU A 28 ? ? -165.54 -131.87 190 10 ASP A 29 ? ? 35.30 -68.69 191 10 HIS A 31 ? ? 79.17 36.30 192 10 SER A 34 ? ? -175.95 -159.67 193 10 GLU A 41 ? ? 19.02 44.94 194 10 LYS A 42 ? ? -142.30 -65.83 195 10 ARG A 43 ? ? 167.79 -21.82 196 10 CYS A 52 ? ? -142.64 -102.38 197 10 GLU A 53 ? ? 48.62 -91.81 198 11 ASP A 2 ? ? -142.18 42.36 199 11 TYR A 8 ? ? -44.52 -85.68 200 11 GLU A 9 ? ? -178.07 -155.30 201 11 ASN A 10 ? ? -39.17 -25.64 202 11 TYR A 11 ? ? 1.67 91.68 203 11 VAL A 13 ? ? 6.83 -119.98 204 11 SER A 14 ? ? 84.83 -2.78 205 11 LYS A 15 ? ? -164.41 108.70 206 11 CYS A 16 ? ? -172.67 97.70 207 11 GLN A 17 ? ? -172.71 23.78 208 11 ALA A 19 ? ? -56.26 95.19 209 11 ASN A 20 ? ? -173.80 -132.12 210 11 GLN A 21 ? ? 8.32 -87.43 211 11 LYS A 27 ? ? -59.48 3.75 212 11 LEU A 28 ? ? -163.27 -36.64 213 11 GLU A 36 ? ? -178.20 -162.64 214 11 TYR A 39 ? ? -98.17 -117.59 215 11 ASP A 40 ? ? 51.40 149.55 216 11 GLU A 41 ? ? 89.41 -56.00 217 11 LYS A 42 ? ? -149.63 30.61 218 11 ARG A 43 ? ? 54.72 18.10 219 11 GLU A 53 ? ? 74.71 -83.93 220 12 ASP A 2 ? ? 50.74 -172.47 221 12 CYS A 4 ? ? 165.86 23.23 222 12 TYR A 8 ? ? -55.52 76.45 223 12 GLU A 9 ? ? 8.81 117.00 224 12 ASN A 10 ? ? 14.47 52.53 225 12 PRO A 12 ? ? -40.43 84.89 226 12 VAL A 13 ? ? -56.61 106.86 227 12 SER A 14 ? ? -175.75 -86.55 228 12 CYS A 16 ? ? -170.58 -79.50 229 12 LEU A 18 ? ? 28.38 57.90 230 12 ALA A 19 ? ? 173.86 35.53 231 12 ASN A 20 ? ? -174.50 -118.35 232 12 GLN A 21 ? ? -1.01 -83.62 233 12 LYS A 27 ? ? -58.91 5.91 234 12 LEU A 28 ? ? -163.46 -40.92 235 12 GLU A 36 ? ? -174.66 139.98 236 12 ASP A 40 ? ? 163.35 -172.20 237 12 GLU A 41 ? ? 24.95 -82.23 238 12 ARG A 43 ? ? 46.65 28.38 239 12 CYS A 52 ? ? -140.04 -118.25 240 12 GLU A 53 ? ? 179.03 19.57 241 13 ASP A 2 ? ? -72.21 -101.86 242 13 LYS A 3 ? ? 161.46 83.87 243 13 CYS A 4 ? ? 160.05 37.81 244 13 GLU A 9 ? ? 22.48 110.97 245 13 ASN A 10 ? ? 170.27 -71.02 246 13 TYR A 11 ? ? -46.72 173.54 247 13 VAL A 13 ? ? 103.94 -20.63 248 13 CYS A 16 ? ? -175.55 -75.74 249 13 GLN A 17 ? ? 49.56 29.91 250 13 LEU A 18 ? ? 44.69 -133.45 251 13 ALA A 19 ? ? -57.23 80.18 252 13 ASN A 20 ? ? -176.83 -117.14 253 13 GLN A 21 ? ? -57.73 54.01 254 13 CYS A 22 ? ? 177.80 -58.79 255 13 LYS A 27 ? ? -61.40 13.02 256 13 LEU A 28 ? ? -165.27 -36.37 257 13 HIS A 31 ? ? 75.78 35.70 258 13 SER A 34 ? ? 174.39 -169.26 259 13 GLU A 36 ? ? -176.44 -164.55 260 13 GLU A 41 ? ? 21.74 35.17 261 13 LYS A 42 ? ? -147.10 -6.24 262 13 ARG A 43 ? ? 57.56 10.08 263 13 ASN A 44 ? ? -94.73 -130.91 264 13 GLU A 53 ? ? -86.15 31.98 265 14 LYS A 3 ? ? -38.66 106.42 266 14 CYS A 4 ? ? -179.65 21.59 267 14 GLU A 9 ? ? 32.94 -159.63 268 14 ASN A 10 ? ? -58.73 44.34 269 14 PRO A 12 ? ? -39.32 85.54 270 14 VAL A 13 ? ? -57.48 1.30 271 14 SER A 14 ? ? -62.94 -95.85 272 14 CYS A 16 ? ? -175.06 108.86 273 14 GLN A 17 ? ? -143.24 -23.45 274 14 ASN A 20 ? ? -175.55 -105.66 275 14 LYS A 27 ? ? -61.87 14.93 276 14 LEU A 28 ? ? -163.73 -41.01 277 14 SER A 34 ? ? -176.35 -164.11 278 14 GLU A 41 ? ? -65.14 27.99 279 14 LYS A 42 ? ? -143.96 -74.15 280 14 ARG A 43 ? ? 169.71 70.08 281 14 ASN A 44 ? ? -141.61 -155.42 282 14 CYS A 52 ? ? -95.06 -111.15 283 14 GLU A 53 ? ? 49.66 107.57 284 15 ASP A 2 ? ? -165.51 -39.14 285 15 LYS A 3 ? ? -37.00 133.19 286 15 GLU A 9 ? ? -61.58 82.54 287 15 ASN A 10 ? ? 153.73 -2.82 288 15 PRO A 12 ? ? -59.77 45.64 289 15 VAL A 13 ? ? 2.97 93.19 290 15 SER A 14 ? ? -171.22 -97.41 291 15 CYS A 16 ? ? -172.00 -12.00 292 15 GLN A 17 ? ? -80.39 33.18 293 15 LEU A 18 ? ? -166.96 116.97 294 15 ALA A 19 ? ? -56.77 99.64 295 15 ASN A 20 ? ? -168.82 -86.78 296 15 LYS A 27 ? ? -59.99 7.67 297 15 LEU A 28 ? ? -162.36 -40.06 298 15 HIS A 31 ? ? 33.09 39.55 299 15 SER A 34 ? ? -175.17 -159.14 300 15 GLU A 36 ? ? -177.07 -144.80 301 15 ASP A 40 ? ? -176.41 -173.07 302 15 ARG A 43 ? ? 59.47 -2.42 303 15 CYS A 52 ? ? -97.54 -113.39 304 15 GLU A 53 ? ? -131.31 -118.62 305 16 ASP A 2 ? ? 75.49 -1.22 306 16 CYS A 4 ? ? -157.77 50.28 307 16 LYS A 6 ? ? -147.84 -156.10 308 16 GLU A 9 ? ? -65.42 4.91 309 16 ASN A 10 ? ? 178.23 136.96 310 16 TYR A 11 ? ? -179.42 100.92 311 16 PRO A 12 ? ? -45.39 65.40 312 16 VAL A 13 ? ? 8.98 51.92 313 16 LYS A 15 ? ? 26.66 32.37 314 16 GLN A 17 ? ? -161.53 -42.08 315 16 LEU A 18 ? ? -73.06 -103.27 316 16 ALA A 19 ? ? -178.52 22.79 317 16 ASN A 20 ? ? -114.59 -112.16 318 16 GLN A 21 ? ? 0.89 -68.63 319 16 LYS A 27 ? ? -61.43 11.52 320 16 LEU A 28 ? ? -160.89 -134.25 321 16 ASP A 29 ? ? 40.41 -76.87 322 16 HIS A 31 ? ? 79.91 49.22 323 16 ALA A 32 ? ? -89.92 -136.57 324 16 ARG A 33 ? ? -141.45 -53.63 325 16 GLU A 36 ? ? -172.14 131.54 326 16 GLU A 41 ? ? 22.23 42.83 327 16 LYS A 42 ? ? 68.96 83.05 328 16 ASN A 44 ? ? -93.34 -60.31 329 16 LEU A 45 ? ? 76.92 67.19 330 16 CYS A 52 ? ? -139.98 -116.89 331 16 GLU A 53 ? ? 157.60 -107.52 332 17 TYR A 8 ? ? -92.11 42.02 333 17 GLU A 9 ? ? 17.83 76.96 334 17 ASN A 10 ? ? 103.74 145.41 335 17 TYR A 11 ? ? -179.32 123.70 336 17 PRO A 12 ? ? -41.75 82.77 337 17 VAL A 13 ? ? -55.21 95.94 338 17 SER A 14 ? ? -175.26 -69.59 339 17 CYS A 16 ? ? -68.09 90.49 340 17 GLN A 17 ? ? -158.29 21.40 341 17 LEU A 18 ? ? -165.69 -79.55 342 17 ALA A 19 ? ? -178.01 -159.83 343 17 ASN A 20 ? ? 60.83 -72.42 344 17 GLN A 21 ? ? -39.49 -76.11 345 17 ASN A 23 ? ? -54.25 -76.15 346 17 LYS A 27 ? ? -59.69 7.79 347 17 LEU A 28 ? ? -163.35 -26.07 348 17 SER A 34 ? ? 174.67 -169.74 349 17 TYR A 39 ? ? -69.65 -168.64 350 17 GLU A 41 ? ? 11.73 -69.08 351 17 ARG A 43 ? ? 164.25 31.44 352 17 CYS A 52 ? ? -135.23 -43.76 353 17 GLU A 53 ? ? 82.56 -64.10 354 18 CYS A 4 ? ? -146.02 -3.65 355 18 GLU A 9 ? ? 30.23 104.82 356 18 ASN A 10 ? ? 170.50 -44.52 357 18 PRO A 12 ? ? -39.59 95.93 358 18 VAL A 13 ? ? -53.02 -7.17 359 18 SER A 14 ? ? -65.25 -88.78 360 18 CYS A 16 ? ? -173.75 22.30 361 18 GLN A 17 ? ? -113.77 57.10 362 18 ALA A 19 ? ? -60.96 54.86 363 18 ASN A 20 ? ? -159.82 -73.81 364 18 GLN A 21 ? ? -53.05 90.23 365 18 CYS A 22 ? ? 120.61 -57.95 366 18 LYS A 27 ? ? -60.76 12.27 367 18 LEU A 28 ? ? -162.16 -129.72 368 18 ASP A 29 ? ? 40.05 -81.84 369 18 HIS A 31 ? ? 71.94 56.47 370 18 SER A 34 ? ? 158.59 137.86 371 18 GLU A 41 ? ? -65.04 18.39 372 18 ARG A 43 ? ? 51.11 13.07 373 18 GLU A 53 ? ? -164.07 72.67 374 19 ASP A 2 ? ? 61.14 155.00 375 19 CYS A 4 ? ? -157.96 13.72 376 19 TYR A 8 ? ? -62.97 -79.55 377 19 GLU A 9 ? ? 176.13 -173.43 378 19 ASN A 10 ? ? -19.51 -42.13 379 19 TYR A 11 ? ? 20.15 131.11 380 19 VAL A 13 ? ? -59.83 10.83 381 19 CYS A 16 ? ? -166.42 11.25 382 19 ASN A 20 ? ? -175.83 -123.49 383 19 GLN A 21 ? ? -16.34 -74.37 384 19 LYS A 27 ? ? -58.57 3.51 385 19 LEU A 28 ? ? -163.24 -41.17 386 19 LYS A 30 ? ? -143.33 22.69 387 19 GLU A 41 ? ? 15.42 -90.95 388 19 CYS A 52 ? ? -146.73 -59.44 389 19 GLU A 53 ? ? 90.25 -78.95 390 20 ASP A 2 ? ? 44.28 85.94 391 20 LYS A 3 ? ? 60.49 -168.27 392 20 CYS A 4 ? ? -156.24 -40.91 393 20 GLU A 9 ? ? -64.49 4.88 394 20 ASN A 10 ? ? 172.96 123.34 395 20 TYR A 11 ? ? 178.66 156.79 396 20 PRO A 12 ? ? -30.11 84.11 397 20 LYS A 15 ? ? -64.48 99.13 398 20 CYS A 16 ? ? -172.08 110.64 399 20 LEU A 18 ? ? 32.87 97.04 400 20 ALA A 19 ? ? 99.99 146.48 401 20 ASN A 20 ? ? 63.66 -79.30 402 20 GLN A 21 ? ? -58.53 39.99 403 20 CYS A 22 ? ? -179.58 -52.82 404 20 LYS A 27 ? ? -62.28 12.26 405 20 LEU A 28 ? ? -162.86 -44.20 406 20 SER A 34 ? ? -157.69 -155.35 407 20 GLU A 41 ? ? -65.49 19.43 408 20 LYS A 42 ? ? -140.93 -73.41 409 20 ARG A 43 ? ? 153.45 57.67 410 20 LEU A 45 ? ? 57.30 136.77 411 20 CYS A 52 ? ? -142.49 -110.83 412 20 GLU A 53 ? ? 20.75 107.06 413 21 ASP A 2 ? ? -76.26 -134.93 414 21 LYS A 3 ? ? 66.21 126.03 415 21 ASN A 10 ? ? 117.17 -34.25 416 21 PRO A 12 ? ? -48.22 -146.74 417 21 VAL A 13 ? ? -169.99 74.71 418 21 SER A 14 ? ? -174.17 -64.93 419 21 LYS A 15 ? ? -67.72 97.28 420 21 CYS A 16 ? ? -170.97 113.00 421 21 GLN A 17 ? ? 156.72 -48.85 422 21 ALA A 19 ? ? 3.78 84.97 423 21 ASN A 20 ? ? -164.18 -96.96 424 21 GLN A 21 ? ? -28.88 -76.80 425 21 ASN A 23 ? ? -47.63 -70.03 426 21 LYS A 27 ? ? -59.14 1.88 427 21 LEU A 28 ? ? -167.81 -44.80 428 21 SER A 34 ? ? -176.72 -160.90 429 21 GLU A 41 ? ? -65.69 28.06 430 21 LYS A 42 ? ? -145.60 -81.76 431 21 ARG A 43 ? ? 177.08 39.44 432 21 GLU A 53 ? ? -69.91 47.85 433 22 ASP A 2 ? ? -79.70 -167.65 434 22 LYS A 3 ? ? -20.68 137.29 435 22 CYS A 4 ? ? -175.26 -22.02 436 22 GLU A 9 ? ? 26.57 78.80 437 22 ASN A 10 ? ? 165.10 -41.23 438 22 TYR A 11 ? ? -52.16 108.86 439 22 VAL A 13 ? ? 18.85 44.77 440 22 LYS A 15 ? ? -172.35 -88.25 441 22 CYS A 16 ? ? 26.37 97.64 442 22 LEU A 18 ? ? -164.24 -82.85 443 22 ALA A 19 ? ? 176.58 109.98 444 22 ASN A 20 ? ? -179.13 -82.06 445 22 GLN A 21 ? ? -46.45 -72.76 446 22 LYS A 27 ? ? -64.08 17.61 447 22 LEU A 28 ? ? -165.47 -54.40 448 22 HIS A 31 ? ? 34.71 38.50 449 22 SER A 34 ? ? 177.96 -165.08 450 22 ASP A 40 ? ? 50.43 161.04 451 22 GLU A 41 ? ? -63.98 8.32 452 22 LEU A 45 ? ? 64.79 122.36 453 22 CYS A 52 ? ? -139.13 -64.64 454 22 GLU A 53 ? ? 88.17 -9.97 455 23 TYR A 8 ? ? -51.01 -103.44 456 23 GLU A 9 ? ? 178.13 -14.49 457 23 ASN A 10 ? ? -178.01 21.05 458 23 PRO A 12 ? ? -45.02 99.23 459 23 VAL A 13 ? ? -53.70 92.02 460 23 SER A 14 ? ? -175.46 128.50 461 23 LYS A 15 ? ? 92.62 -13.35 462 23 CYS A 16 ? ? -66.56 70.61 463 23 ALA A 19 ? ? -56.70 -149.16 464 23 ASN A 20 ? ? 61.55 -79.36 465 23 GLN A 21 ? ? -41.18 -77.48 466 23 ASN A 23 ? ? -53.21 -74.16 467 23 LYS A 27 ? ? -59.86 2.39 468 23 LEU A 28 ? ? -165.14 -36.78 469 23 LYS A 30 ? ? -141.38 16.90 470 23 GLU A 36 ? ? -177.20 146.68 471 23 ASP A 40 ? ? -161.50 58.62 472 23 GLU A 41 ? ? 93.34 -16.86 473 23 LEU A 45 ? ? 71.65 152.67 474 23 CYS A 47 ? ? -61.47 98.83 475 23 CYS A 52 ? ? -101.03 -107.81 476 23 GLU A 53 ? ? -168.30 -137.37 477 24 ASP A 2 ? ? -166.64 -61.03 478 24 LYS A 3 ? ? -37.13 122.46 479 24 CYS A 4 ? ? 158.66 -3.38 480 24 TYR A 8 ? ? -105.86 76.65 481 24 GLU A 9 ? ? -47.63 -94.00 482 24 ASN A 10 ? ? -47.18 92.76 483 24 TYR A 11 ? ? -177.80 107.29 484 24 VAL A 13 ? ? -60.57 45.09 485 24 SER A 14 ? ? -63.30 -125.86 486 24 CYS A 16 ? ? -173.27 -32.44 487 24 GLN A 17 ? ? -74.19 38.93 488 24 LEU A 18 ? ? -161.91 -102.58 489 24 ALA A 19 ? ? -179.62 -153.69 490 24 ASN A 20 ? ? 59.74 -82.49 491 24 GLN A 21 ? ? -33.82 -76.46 492 24 ASN A 23 ? ? -53.65 -78.25 493 24 LYS A 27 ? ? -60.84 1.54 494 24 LEU A 28 ? ? -162.44 -31.73 495 24 LYS A 30 ? ? -141.93 -1.98 496 24 GLU A 36 ? ? -176.14 -145.77 497 24 ASP A 40 ? ? -162.90 -158.94 498 24 ARG A 43 ? ? 52.33 2.49 499 24 ASN A 44 ? ? -100.88 -136.04 500 24 TYR A 51 ? ? -103.43 57.00 501 25 ASP A 2 ? ? -177.86 -159.66 502 25 LYS A 3 ? ? 71.15 150.98 503 25 TYR A 8 ? ? -63.13 -75.52 504 25 GLU A 9 ? ? 104.26 89.93 505 25 ASN A 10 ? ? 107.89 -12.76 506 25 VAL A 13 ? ? -52.70 -70.23 507 25 SER A 14 ? ? 21.28 -95.04 508 25 CYS A 16 ? ? -173.27 57.06 509 25 GLN A 17 ? ? -141.54 22.46 510 25 ALA A 19 ? ? -57.24 99.80 511 25 ASN A 20 ? ? -175.98 -68.95 512 25 GLN A 21 ? ? -47.99 -74.56 513 25 LYS A 27 ? ? -61.89 3.37 514 25 LEU A 28 ? ? -164.35 -27.26 515 25 LYS A 30 ? ? -141.66 40.88 516 25 HIS A 31 ? ? 31.73 44.76 517 25 SER A 34 ? ? 177.84 -176.24 518 25 ASP A 40 ? ? -167.94 95.24 519 25 GLU A 41 ? ? 27.02 32.35 520 25 CYS A 52 ? ? -140.27 -34.58 521 25 GLU A 53 ? ? 34.44 -94.00 522 26 ASP A 2 ? ? -132.74 -122.31 523 26 LYS A 3 ? ? 60.34 80.39 524 26 CYS A 4 ? ? 67.01 -34.62 525 26 GLU A 9 ? ? -58.10 171.60 526 26 ASN A 10 ? ? 16.02 101.09 527 26 TYR A 11 ? ? 175.91 141.13 528 26 PRO A 12 ? ? -34.03 80.83 529 26 LYS A 15 ? ? -65.42 82.90 530 26 CYS A 16 ? ? -173.64 95.08 531 26 ALA A 19 ? ? -53.82 177.10 532 26 ASN A 20 ? ? 96.93 -85.28 533 26 GLN A 21 ? ? -50.82 -70.04 534 26 LYS A 27 ? ? -57.46 -0.45 535 26 LEU A 28 ? ? -162.96 -139.39 536 26 ASP A 29 ? ? 65.24 -50.39 537 26 LYS A 30 ? ? -126.06 -85.97 538 26 HIS A 31 ? ? 169.13 54.16 539 26 SER A 34 ? ? -166.42 -162.57 540 26 GLU A 36 ? ? -177.06 -158.54 541 26 ARG A 43 ? ? 29.55 55.20 542 26 ASN A 44 ? ? -141.80 -125.27 543 26 CYS A 52 ? ? -97.40 -78.65 544 26 GLU A 53 ? ? 59.00 -77.35 545 27 LYS A 3 ? ? -51.71 -107.67 546 27 CYS A 4 ? ? -172.85 -1.40 547 27 GLU A 9 ? ? 34.31 -158.04 548 27 ASN A 10 ? ? 2.42 102.01 549 27 TYR A 11 ? ? 179.97 141.13 550 27 PRO A 12 ? ? -40.03 90.67 551 27 VAL A 13 ? ? -52.87 -90.59 552 27 SER A 14 ? ? 9.96 -70.21 553 27 LYS A 15 ? ? -60.28 89.36 554 27 CYS A 16 ? ? -175.31 116.92 555 27 LEU A 18 ? ? -174.20 -20.01 556 27 ALA A 19 ? ? 178.70 104.24 557 27 ASN A 20 ? ? -175.64 -97.86 558 27 LYS A 27 ? ? -61.00 10.88 559 27 LEU A 28 ? ? -163.14 -30.10 560 27 SER A 34 ? ? -154.85 -156.44 561 27 TYR A 39 ? ? -70.87 -93.31 562 27 ASP A 40 ? ? 53.94 147.65 563 27 GLU A 41 ? ? 89.62 -79.22 564 27 ARG A 43 ? ? 38.58 38.78 565 28 CYS A 4 ? ? 173.40 -75.53 566 28 GLU A 9 ? ? -63.06 43.16 567 28 ASN A 10 ? ? 172.42 -97.75 568 28 TYR A 11 ? ? 8.52 76.37 569 28 VAL A 13 ? ? 8.75 -108.13 570 28 SER A 14 ? ? 91.33 -45.15 571 28 LYS A 15 ? ? -172.56 74.94 572 28 LEU A 18 ? ? 30.79 30.95 573 28 ALA A 19 ? ? 175.99 35.80 574 28 ASN A 20 ? ? -166.47 -141.29 575 28 GLN A 21 ? ? 2.62 -69.37 576 28 LYS A 27 ? ? -59.72 10.55 577 28 LEU A 28 ? ? -165.82 -52.15 578 28 LYS A 30 ? ? -141.81 24.84 579 28 HIS A 31 ? ? 38.46 38.91 580 28 GLU A 36 ? ? -174.92 138.31 581 28 GLU A 41 ? ? 16.92 -82.27 582 28 ARG A 43 ? ? 29.04 60.44 583 28 ASN A 44 ? ? -95.39 -154.53 584 28 TYR A 51 ? ? -99.21 -89.65 585 29 ASP A 2 ? ? -69.41 50.08 586 29 GLU A 9 ? ? 26.20 -153.61 587 29 ASN A 10 ? ? -60.16 56.94 588 29 PRO A 12 ? ? -57.29 92.48 589 29 VAL A 13 ? ? -53.88 105.88 590 29 SER A 14 ? ? -176.33 -87.97 591 29 CYS A 16 ? ? -170.11 -64.01 592 29 GLN A 17 ? ? -28.14 -38.80 593 29 LEU A 18 ? ? -70.65 -120.80 594 29 ALA A 19 ? ? -179.65 -20.47 595 29 ASN A 20 ? ? -47.62 -106.38 596 29 GLN A 21 ? ? -25.26 -60.22 597 29 CYS A 22 ? ? -54.04 -75.68 598 29 LYS A 27 ? ? -61.44 11.84 599 29 LEU A 28 ? ? -165.02 -47.33 600 29 SER A 34 ? ? -177.64 -168.44 601 29 GLU A 36 ? ? -179.31 -179.97 602 29 GLU A 41 ? ? -61.52 2.06 603 29 LYS A 42 ? ? -95.61 -63.89 604 29 ARG A 43 ? ? 139.78 5.08 605 29 ASN A 44 ? ? -90.96 -140.63 606 29 CYS A 47 ? ? -66.18 87.19 607 29 CYS A 52 ? ? -106.70 50.13 608 30 CYS A 4 ? ? -152.65 45.87 609 30 GLU A 9 ? ? -57.29 -70.38 610 30 ASN A 10 ? ? -51.92 86.15 611 30 TYR A 11 ? ? -177.80 97.34 612 30 PRO A 12 ? ? -45.94 75.65 613 30 VAL A 13 ? ? -7.86 -62.54 614 30 SER A 14 ? ? 27.23 -92.26 615 30 CYS A 16 ? ? -172.59 -37.34 616 30 LEU A 18 ? ? -161.95 96.24 617 30 ALA A 19 ? ? -54.18 78.74 618 30 ASN A 20 ? ? -162.01 -79.14 619 30 GLN A 21 ? ? -22.75 -86.16 620 30 ASN A 23 ? ? -53.84 -75.18 621 30 LYS A 27 ? ? -61.99 17.67 622 30 LEU A 28 ? ? -163.68 -40.82 623 30 ALA A 32 ? ? -86.61 -154.87 624 30 ARG A 33 ? ? -142.52 -2.99 625 30 SER A 34 ? ? -175.32 -179.83 626 30 GLU A 41 ? ? -61.40 0.62 627 30 ARG A 43 ? ? 83.16 -5.28 628 30 CYS A 52 ? ? -144.00 -11.49 629 30 GLU A 53 ? ? 60.44 -71.45 630 31 CYS A 4 ? ? -154.24 11.41 631 31 TYR A 8 ? ? -64.28 61.60 632 31 GLU A 9 ? ? 16.76 -140.65 633 31 ASN A 10 ? ? -57.78 12.52 634 31 PRO A 12 ? ? -48.16 -88.26 635 31 VAL A 13 ? ? 117.47 -8.12 636 31 SER A 14 ? ? -66.28 25.37 637 31 LYS A 15 ? ? -172.02 99.57 638 31 CYS A 16 ? ? -171.25 27.14 639 31 LEU A 18 ? ? -163.42 -90.29 640 31 ALA A 19 ? ? -178.92 -150.97 641 31 ASN A 20 ? ? 67.00 -75.47 642 31 GLN A 21 ? ? -38.13 -83.08 643 31 ASN A 23 ? ? -56.66 -76.93 644 31 LYS A 27 ? ? -60.77 6.46 645 31 LEU A 28 ? ? -163.38 -36.77 646 31 LYS A 42 ? ? -97.59 -80.06 647 31 ARG A 43 ? ? 171.05 21.59 648 31 CYS A 52 ? ? -93.55 -110.08 649 31 GLU A 53 ? ? -173.89 84.57 650 32 CYS A 4 ? ? -155.24 33.63 651 32 GLU A 9 ? ? -55.10 -174.79 652 32 ASN A 10 ? ? 17.57 104.60 653 32 TYR A 11 ? ? -179.86 81.57 654 32 PRO A 12 ? ? -56.79 5.93 655 32 VAL A 13 ? ? 101.87 -72.58 656 32 SER A 14 ? ? 27.72 89.54 657 32 LYS A 15 ? ? 92.86 -123.63 658 32 CYS A 16 ? ? 78.94 -49.18 659 32 ALA A 19 ? ? 101.98 3.86 660 32 ASN A 20 ? ? -97.03 -118.24 661 32 GLN A 21 ? ? -1.14 -65.31 662 32 LYS A 27 ? ? -59.86 8.83 663 32 LEU A 28 ? ? -162.79 -132.35 664 32 ASP A 29 ? ? 39.85 -77.20 665 32 HIS A 31 ? ? 82.99 44.67 666 32 SER A 34 ? ? -174.54 -164.67 667 32 TYR A 39 ? ? -39.04 163.51 668 32 ARG A 43 ? ? 59.74 5.80 669 32 GLU A 53 ? ? 50.51 -95.23 670 33 ASP A 2 ? ? -149.23 -81.25 671 33 LYS A 3 ? ? 50.37 101.73 672 33 CYS A 4 ? ? 172.39 24.86 673 33 GLU A 9 ? ? 25.22 -145.59 674 33 ASN A 10 ? ? -57.62 58.05 675 33 PRO A 12 ? ? -41.02 90.12 676 33 VAL A 13 ? ? -51.45 95.18 677 33 SER A 14 ? ? -175.25 130.66 678 33 LYS A 15 ? ? 87.96 -88.01 679 33 CYS A 16 ? ? 25.20 98.01 680 33 LEU A 18 ? ? 36.50 89.83 681 33 ALA A 19 ? ? 103.28 149.77 682 33 ASN A 20 ? ? 84.46 -68.57 683 33 GLN A 21 ? ? -49.43 -79.06 684 33 ASN A 23 ? ? -55.65 -81.95 685 33 LYS A 27 ? ? -60.48 6.14 686 33 LEU A 28 ? ? -159.64 -34.16 687 33 HIS A 31 ? ? 35.43 45.17 688 33 ALA A 32 ? ? -86.09 -132.79 689 33 ARG A 33 ? ? -139.32 -31.12 690 33 SER A 34 ? ? -167.33 -164.82 691 33 ASP A 40 ? ? 48.00 171.96 692 33 GLU A 41 ? ? -65.74 39.58 693 33 LYS A 42 ? ? -144.64 -1.76 694 33 CYS A 52 ? ? -93.39 -103.39 695 33 GLU A 53 ? ? -32.41 112.36 696 34 ASP A 2 ? ? 69.47 -79.32 697 34 LYS A 3 ? ? 33.29 -156.69 698 34 CYS A 4 ? ? -149.48 46.18 699 34 GLU A 9 ? ? 29.26 -156.38 700 34 ASN A 10 ? ? -59.44 47.64 701 34 PRO A 12 ? ? -49.58 -139.21 702 34 VAL A 13 ? ? -179.26 -19.61 703 34 SER A 14 ? ? -64.24 19.30 704 34 LYS A 15 ? ? -173.89 104.76 705 34 CYS A 16 ? ? 179.84 110.89 706 34 GLN A 17 ? ? -127.46 -54.02 707 34 LEU A 18 ? ? -179.31 89.44 708 34 ALA A 19 ? ? 96.71 174.85 709 34 ASN A 20 ? ? 71.89 -78.31 710 34 GLN A 21 ? ? -39.04 -85.03 711 34 ASN A 23 ? ? -52.98 -70.32 712 34 LYS A 27 ? ? -59.24 0.32 713 34 LEU A 28 ? ? -165.05 -37.12 714 34 SER A 34 ? ? 171.31 -163.64 715 34 GLU A 41 ? ? 21.25 41.22 716 34 LYS A 42 ? ? -147.13 -76.47 717 34 ARG A 43 ? ? 162.71 58.70 718 34 LEU A 45 ? ? -152.64 82.77 719 34 CYS A 52 ? ? -143.09 -108.87 720 34 GLU A 53 ? ? 89.97 -76.14 721 35 LYS A 3 ? ? 57.57 134.72 722 35 CYS A 4 ? ? 175.66 -20.81 723 35 GLU A 9 ? ? 26.81 101.87 724 35 ASN A 10 ? ? 104.91 79.76 725 35 TYR A 11 ? ? 170.42 96.47 726 35 VAL A 13 ? ? -55.59 73.38 727 35 CYS A 16 ? ? -173.42 10.37 728 35 ALA A 19 ? ? 105.35 59.71 729 35 ASN A 20 ? ? -155.35 -51.86 730 35 GLN A 21 ? ? -47.93 -76.74 731 35 ASN A 23 ? ? -54.70 -76.97 732 35 LYS A 27 ? ? -57.93 3.27 733 35 LEU A 28 ? ? -165.01 -43.64 734 35 LYS A 30 ? ? -140.29 13.32 735 35 GLU A 41 ? ? -60.05 3.02 736 35 ARG A 43 ? ? 46.33 10.40 737 35 CYS A 52 ? ? -144.10 -19.16 738 35 GLU A 53 ? ? 59.28 71.14 739 36 ASP A 2 ? ? 61.39 156.73 740 36 CYS A 4 ? ? 47.21 22.52 741 36 ASN A 10 ? ? 11.42 108.21 742 36 TYR A 11 ? ? -177.97 143.48 743 36 PRO A 12 ? ? -28.98 83.04 744 36 LYS A 15 ? ? -65.48 91.29 745 36 CYS A 16 ? ? -172.86 111.89 746 36 GLN A 17 ? ? -149.13 -22.40 747 36 ALA A 19 ? ? -58.71 103.45 748 36 ASN A 20 ? ? 176.24 -88.66 749 36 GLN A 21 ? ? -27.57 -85.63 750 36 ASN A 23 ? ? -49.05 -74.83 751 36 LYS A 27 ? ? -57.16 2.95 752 36 LEU A 28 ? ? -163.78 -37.56 753 36 ALA A 32 ? ? -86.55 -127.23 754 36 ARG A 33 ? ? -140.25 -42.89 755 36 ARG A 43 ? ? 35.76 34.34 756 36 CYS A 52 ? ? -148.62 -93.26 757 36 GLU A 53 ? ? 179.28 -34.26 758 37 ASP A 2 ? ? -66.81 -103.17 759 37 CYS A 4 ? ? 159.53 45.99 760 37 GLU A 9 ? ? -47.96 -179.21 761 37 ASN A 10 ? ? 16.34 109.10 762 37 TYR A 11 ? ? -173.07 144.52 763 37 PRO A 12 ? ? -43.56 -134.86 764 37 VAL A 13 ? ? -177.46 -56.52 765 37 SER A 14 ? ? -60.08 66.07 766 37 LYS A 15 ? ? -174.47 -68.19 767 37 CYS A 16 ? ? 13.04 -66.50 768 37 GLN A 17 ? ? -54.65 51.52 769 37 LEU A 18 ? ? -165.45 98.79 770 37 ALA A 19 ? ? -49.51 86.93 771 37 ASN A 20 ? ? -173.51 -78.12 772 37 GLN A 21 ? ? -60.46 41.40 773 37 CYS A 22 ? ? -170.23 -59.01 774 37 LYS A 27 ? ? -59.83 6.34 775 37 LEU A 28 ? ? -164.68 -41.99 776 37 SER A 34 ? ? -171.93 -175.16 777 37 GLU A 36 ? ? -74.76 -159.42 778 37 TYR A 39 ? ? -169.75 -153.71 779 37 ASP A 40 ? ? 175.12 95.58 780 37 GLU A 41 ? ? 87.11 -70.36 781 37 LYS A 42 ? ? -150.38 29.23 782 37 ARG A 43 ? ? -65.11 16.19 783 37 ASN A 44 ? ? 63.15 -15.82 784 37 LEU A 45 ? ? 59.50 133.43 785 37 CYS A 52 ? ? -141.83 56.08 786 37 GLU A 53 ? ? 28.85 -92.75 787 38 ASP A 2 ? ? -147.79 -82.86 788 38 GLU A 9 ? ? 30.57 -158.61 789 38 ASN A 10 ? ? -58.48 34.91 790 38 PRO A 12 ? ? -30.95 84.98 791 38 SER A 14 ? ? -62.16 -93.71 792 38 CYS A 16 ? ? -174.52 -67.99 793 38 LEU A 18 ? ? 35.59 75.90 794 38 ALA A 19 ? ? -178.56 -147.94 795 38 ASN A 20 ? ? -21.14 -107.96 796 38 GLN A 21 ? ? -5.81 -73.88 797 38 LYS A 27 ? ? -60.79 14.27 798 38 LEU A 28 ? ? -165.02 -52.19 799 38 TYR A 39 ? ? -73.79 -102.79 800 38 ASP A 40 ? ? 48.97 -167.26 801 38 GLU A 41 ? ? 27.64 63.17 802 38 LYS A 42 ? ? 69.68 65.95 803 38 ARG A 43 ? ? 32.76 33.51 804 39 ASP A 2 ? ? -56.11 -151.62 805 39 CYS A 4 ? ? -124.15 -52.56 806 39 TYR A 8 ? ? -64.51 66.53 807 39 GLU A 9 ? ? 17.21 -115.02 808 39 ASN A 10 ? ? -50.34 -72.22 809 39 TYR A 11 ? ? 10.89 79.24 810 39 VAL A 13 ? ? 173.58 -50.04 811 39 SER A 14 ? ? 23.05 55.23 812 39 LYS A 15 ? ? 92.86 141.00 813 39 CYS A 16 ? ? -174.35 21.11 814 39 GLN A 17 ? ? -101.03 44.65 815 39 LEU A 18 ? ? -158.84 -129.99 816 39 ALA A 19 ? ? -178.43 46.66 817 39 ASN A 20 ? ? -141.33 -47.47 818 39 GLN A 21 ? ? -47.96 -80.22 819 39 LYS A 27 ? ? -59.37 3.22 820 39 LEU A 28 ? ? -165.93 -33.20 821 39 SER A 34 ? ? -175.85 -147.33 822 39 LYS A 42 ? ? -94.92 -77.28 823 39 ARG A 43 ? ? 175.45 1.77 824 39 CYS A 52 ? ? -91.38 -84.65 825 39 GLU A 53 ? ? 14.27 -77.46 826 40 ASP A 2 ? ? 37.88 -103.25 827 40 LYS A 3 ? ? 59.73 172.32 828 40 CYS A 4 ? ? 62.93 -24.87 829 40 TYR A 8 ? ? -81.81 36.30 830 40 GLU A 9 ? ? 10.86 -100.16 831 40 ASN A 10 ? ? -43.22 -72.45 832 40 TYR A 11 ? ? 16.57 102.12 833 40 PRO A 12 ? ? -42.60 93.49 834 40 VAL A 13 ? ? -56.20 96.07 835 40 SER A 14 ? ? -178.57 23.80 836 40 LYS A 15 ? ? -174.45 107.71 837 40 CYS A 16 ? ? -170.25 -10.58 838 40 GLN A 17 ? ? -62.57 19.69 839 40 ALA A 19 ? ? -56.16 -176.25 840 40 ASN A 20 ? ? 81.90 -78.34 841 40 GLN A 21 ? ? -29.15 -83.75 842 40 ASN A 23 ? ? -52.82 -75.48 843 40 ASP A 25 ? ? -52.12 -73.64 844 40 LYS A 27 ? ? -63.15 7.18 845 40 LEU A 28 ? ? -161.96 -22.29 846 40 HIS A 31 ? ? 70.66 45.29 847 40 ALA A 32 ? ? -87.49 -143.95 848 40 ARG A 33 ? ? -142.54 -31.68 849 40 ASP A 40 ? ? -96.62 -82.51 850 40 GLU A 41 ? ? -165.48 8.26 851 40 ARG A 43 ? ? 80.69 21.13 852 40 CYS A 52 ? ? -137.81 -82.99 853 40 GLU A 53 ? ? 119.63 27.20 854 41 GLU A 9 ? ? -61.61 72.13 855 41 ASN A 10 ? ? 127.04 101.26 856 41 TYR A 11 ? ? -179.30 134.15 857 41 VAL A 13 ? ? -61.16 43.40 858 41 SER A 14 ? ? -62.60 -110.36 859 41 LYS A 15 ? ? -67.59 23.32 860 41 GLN A 17 ? ? -67.38 12.67 861 41 ALA A 19 ? ? -56.04 107.37 862 41 ASN A 20 ? ? -174.56 -88.44 863 41 ASN A 23 ? ? -51.68 -72.59 864 41 ASP A 25 ? ? -55.51 -74.70 865 41 LYS A 27 ? ? -59.21 1.32 866 41 LEU A 28 ? ? -162.92 -29.82 867 41 SER A 34 ? ? -178.64 120.18 868 41 GLU A 36 ? ? -178.71 145.71 869 41 ASP A 40 ? ? -142.07 -83.23 870 41 GLU A 41 ? ? -59.72 70.47 871 41 LYS A 42 ? ? 53.81 85.07 872 41 ARG A 43 ? ? 57.92 18.49 873 41 CYS A 52 ? ? -113.49 -116.42 874 41 GLU A 53 ? ? 169.26 -58.43 875 42 ASP A 2 ? ? -84.46 -101.89 876 42 LYS A 3 ? ? -48.05 160.65 877 42 GLU A 9 ? ? -60.65 5.86 878 42 ASN A 10 ? ? 172.20 122.56 879 42 TYR A 11 ? ? -179.72 123.54 880 42 PRO A 12 ? ? -44.14 76.18 881 42 VAL A 13 ? ? -58.68 97.15 882 42 SER A 14 ? ? -178.00 -57.78 883 42 LYS A 15 ? ? -67.21 10.25 884 42 CYS A 16 ? ? -67.61 19.24 885 42 LEU A 18 ? ? -161.92 -122.31 886 42 ALA A 19 ? ? 174.01 28.60 887 42 ASN A 20 ? ? -131.19 -52.85 888 42 GLN A 21 ? ? -37.19 -86.87 889 42 ASN A 23 ? ? -56.28 -75.79 890 42 LYS A 27 ? ? -62.51 7.51 891 42 LEU A 28 ? ? -167.87 -37.65 892 42 LYS A 30 ? ? -144.63 10.91 893 42 ASP A 40 ? ? -57.11 77.12 894 42 GLU A 41 ? ? 27.87 40.57 895 42 LYS A 42 ? ? -142.23 -81.83 896 42 ARG A 43 ? ? 160.74 23.73 897 42 LEU A 45 ? ? 57.68 122.19 898 42 TYR A 51 ? ? -115.18 50.20 899 43 ASP A 2 ? ? 73.76 -14.44 900 43 LYS A 3 ? ? 84.08 86.78 901 43 GLU A 9 ? ? -57.94 -79.62 902 43 ASN A 10 ? ? -38.96 -38.88 903 43 VAL A 13 ? ? -60.59 7.52 904 43 SER A 14 ? ? -60.66 -108.98 905 43 CYS A 16 ? ? -171.94 3.92 906 43 ALA A 19 ? ? -62.19 39.06 907 43 ASN A 20 ? ? -136.71 -108.04 908 43 GLN A 21 ? ? 0.90 -80.59 909 43 LYS A 27 ? ? -61.25 14.75 910 43 LEU A 28 ? ? -167.20 -53.63 911 43 HIS A 31 ? ? 34.00 38.24 912 43 SER A 34 ? ? 178.37 -168.09 913 43 GLU A 36 ? ? -178.45 -154.42 914 43 GLU A 41 ? ? -64.22 36.21 915 43 LYS A 42 ? ? -146.86 -81.25 916 43 ARG A 43 ? ? -176.82 20.70 917 43 CYS A 52 ? ? -143.48 -113.65 918 43 GLU A 53 ? ? 67.80 127.69 #