data_1BSK # _entry.id 1BSK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1BSK RCSB RCSB007103 WWPDB D_1000007103 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BSK _pdbx_database_status.recvd_initial_deposition_date 1998-08-28 _pdbx_database_status.deposit_site BNL _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hao, B.' 1 'Gong, W.' 2 'Rajagopalan, P.T.' 3 'Hu, Y.' 4 'Pei, D.' 5 'Chan, M.K.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural basis for the design of antibiotics targeting peptide deformylase.' Biochemistry 38 4712 4719 1999 BICHAW US 0006-2960 0033 ? 10200158 10.1021/bi982594c 1 'Crystal Structure of the Escherichia Coli Peptide Deformylase' Biochemistry 36 13904 13909 1997 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hao, B.' 1 primary 'Gong, W.' 2 primary 'Rajagopalan, P.T.' 3 primary 'Zhou, Y.' 4 primary 'Pei, D.' 5 primary 'Chan, M.K.' 6 1 'Chan, M.K.' 7 1 'Gong, W.' 8 1 'Rajagopalan, P.T.' 9 1 'Hao, B.' 10 1 'Tsai, C.' 11 1 'Pei, D.' 12 # _cell.entry_id 1BSK _cell.length_a 99.170 _cell.length_b 99.170 _cell.length_c 110.755 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BSK _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'PROTEIN (PEPTIDE DEFORMYLASE)' 19226.248 1 3.5.1.27 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 4 non-polymer syn '(S)-2-(PHOSPHONOXY)CAPROYL-L-LEUCYL-P-NITROANILIDE' 445.404 1 ? ? ? ? 5 water nat water 18.015 13 ? ? ? ? # _entity_name_sys.entity_id 1 _entity_name_sys.name 'EC 3.5.1.27' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEK SGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEK LDRLKARA ; _entity_poly.pdbx_seq_one_letter_code_can ;SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEK SGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEK LDRLKARA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 VAL n 1 3 LEU n 1 4 GLN n 1 5 VAL n 1 6 LEU n 1 7 HIS n 1 8 ILE n 1 9 PRO n 1 10 ASP n 1 11 GLU n 1 12 ARG n 1 13 LEU n 1 14 ARG n 1 15 LYS n 1 16 VAL n 1 17 ALA n 1 18 LYS n 1 19 PRO n 1 20 VAL n 1 21 GLU n 1 22 GLU n 1 23 VAL n 1 24 ASN n 1 25 ALA n 1 26 GLU n 1 27 ILE n 1 28 GLN n 1 29 ARG n 1 30 ILE n 1 31 VAL n 1 32 ASP n 1 33 ASP n 1 34 MET n 1 35 PHE n 1 36 GLU n 1 37 THR n 1 38 MET n 1 39 TYR n 1 40 ALA n 1 41 GLU n 1 42 GLU n 1 43 GLY n 1 44 ILE n 1 45 GLY n 1 46 LEU n 1 47 ALA n 1 48 ALA n 1 49 THR n 1 50 GLN n 1 51 VAL n 1 52 ASP n 1 53 ILE n 1 54 HIS n 1 55 GLN n 1 56 ARG n 1 57 ILE n 1 58 ILE n 1 59 VAL n 1 60 ILE n 1 61 ASP n 1 62 VAL n 1 63 SER n 1 64 GLU n 1 65 ASN n 1 66 ARG n 1 67 ASP n 1 68 GLU n 1 69 ARG n 1 70 LEU n 1 71 VAL n 1 72 LEU n 1 73 ILE n 1 74 ASN n 1 75 PRO n 1 76 GLU n 1 77 LEU n 1 78 LEU n 1 79 GLU n 1 80 LYS n 1 81 SER n 1 82 GLY n 1 83 GLU n 1 84 THR n 1 85 GLY n 1 86 ILE n 1 87 GLU n 1 88 GLU n 1 89 GLY n 1 90 CYS n 1 91 LEU n 1 92 SER n 1 93 ILE n 1 94 PRO n 1 95 GLU n 1 96 GLN n 1 97 ARG n 1 98 ALA n 1 99 LEU n 1 100 VAL n 1 101 PRO n 1 102 ARG n 1 103 ALA n 1 104 GLU n 1 105 LYS n 1 106 VAL n 1 107 LYS n 1 108 ILE n 1 109 ARG n 1 110 ALA n 1 111 LEU n 1 112 ASP n 1 113 ARG n 1 114 ASP n 1 115 GLY n 1 116 LYS n 1 117 PRO n 1 118 PHE n 1 119 GLU n 1 120 LEU n 1 121 GLU n 1 122 ALA n 1 123 ASP n 1 124 GLY n 1 125 LEU n 1 126 LEU n 1 127 ALA n 1 128 ILE n 1 129 CYS n 1 130 ILE n 1 131 GLN n 1 132 HIS n 1 133 GLU n 1 134 MET n 1 135 ASP n 1 136 HIS n 1 137 LEU n 1 138 VAL n 1 139 GLY n 1 140 LYS n 1 141 LEU n 1 142 PHE n 1 143 MET n 1 144 ASP n 1 145 TYR n 1 146 LEU n 1 147 SER n 1 148 PRO n 1 149 LEU n 1 150 LYS n 1 151 GLN n 1 152 GLN n 1 153 ARG n 1 154 ILE n 1 155 ARG n 1 156 GLN n 1 157 LYS n 1 158 VAL n 1 159 GLU n 1 160 LYS n 1 161 LEU n 1 162 ASP n 1 163 ARG n 1 164 LEU n 1 165 LYS n 1 166 ALA n 1 167 ARG n 1 168 ALA n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Escherichia coli' _entity_src_nat.pdbx_ncbi_taxonomy_id 562 _entity_src_nat.genus Escherichia _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line 'BL21(DE3)' _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEF_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0A6K3 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BSK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 168 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A6K3 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 168 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLN non-polymer . '(S)-2-(PHOSPHONOXY)CAPROYL-L-LEUCYL-P-NITROANILIDE' ? 'C18 H28 N3 O8 P' 445.404 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1BSK _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.1 _exptl_crystal.density_percent_sol 65 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details 'pH 7.5' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 283 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 1998-05-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1BSK _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 3.0 _reflns.number_obs 6118 _reflns.number_all ? _reflns.percent_possible_obs 88.7 _reflns.pdbx_Rmerge_I_obs 0.1000000 _reflns.pdbx_Rsym_value 10.0000000 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.1 _reflns_shell.percent_possible_all 76.4 _reflns_shell.Rmerge_I_obs 0.2810000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1BSK _refine.ls_number_reflns_obs 5879 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1000000 _refine.pdbx_data_cutoff_low_absF 0.0 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 3.0 _refine.ls_percent_reflns_obs 88.7 _refine.ls_R_factor_obs 0.1670000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1670000 _refine.ls_R_factor_R_free 0.2210000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 7.3 _refine.ls_number_reflns_R_free 450 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1DFF' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1329 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 35 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1377 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.015 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.739 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 3.0 _refine_ls_shell.d_res_low 3.14 _refine_ls_shell.number_reflns_R_work 533 _refine_ls_shell.R_factor_R_work 0.2330000 _refine_ls_shell.percent_reflns_obs 76.4 _refine_ls_shell.R_factor_R_free 0.2850000 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 6.3 _refine_ls_shell.number_reflns_R_free 41 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PARHCSDX.PRO ? 'X-RAY DIFFRACTION' 2 PARAM19.SOL ? 'X-RAY DIFFRACTION' # _struct.entry_id 1BSK _struct.title 'ZINC DEFORMYLASE INHIBITOR COMPLEX FROM E.COLI' _struct.pdbx_descriptor '(PEPTIDE DEFORMYLASE) (E.C. 3.5.1.27)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BSK _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'DEFORMYLASE, INHIBITOR, METALLOPROTEINASE, HYDROLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 11 ? ARG A 14 ? GLU A 11 ARG A 14 5 ? 4 HELX_P HELX_P2 2 ALA A 25 ? ALA A 40 ? ALA A 25 ALA A 40 1 ? 16 HELX_P HELX_P3 3 ALA A 48 ? VAL A 51 ? ALA A 48 VAL A 51 5 ? 4 HELX_P HELX_P4 4 GLY A 124 ? VAL A 138 ? GLY A 124 VAL A 138 1 ? 15 HELX_P HELX_P5 5 PHE A 142 ? TYR A 145 ? PHE A 142 TYR A 145 5 ? 4 HELX_P HELX_P6 6 PRO A 148 ? LEU A 164 ? PRO A 148 LEU A 164 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A CYS 90 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 90 A ZN 169 1_555 ? ? ? ? ? ? ? 2.289 ? metalc2 metalc ? ? A HIS 132 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 132 A ZN 169 1_555 ? ? ? ? ? ? ? 2.062 ? metalc3 metalc ? ? A HIS 136 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 136 A ZN 169 1_555 ? ? ? ? ? ? ? 2.077 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 D MLN . O3 ? ? A ZN 169 A MLN 171 1_555 ? ? ? ? ? ? ? 2.038 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 8 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 8 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 9 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 9 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.30 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 45 ? ALA A 47 ? GLY A 45 ALA A 47 A 2 ILE A 57 ? ILE A 60 ? ILE A 57 ILE A 60 A 3 LEU A 70 ? ILE A 73 ? LEU A 70 ILE A 73 B 1 THR A 84 ? GLU A 88 ? THR A 84 GLU A 88 B 2 ALA A 98 ? ARG A 102 ? ALA A 98 ARG A 102 C 1 PRO A 117 ? ALA A 122 ? PRO A 117 ALA A 122 C 2 LYS A 105 ? LEU A 111 ? LYS A 105 LEU A 111 C 3 GLU A 76 ? SER A 81 ? GLU A 76 SER A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 46 ? O LEU A 46 N VAL A 59 ? N VAL A 59 A 2 3 O ILE A 58 ? O ILE A 58 N LEU A 72 ? N LEU A 72 B 1 2 O THR A 84 ? O THR A 84 N ARG A 102 ? N ARG A 102 C 1 2 O PHE A 118 ? O PHE A 118 N ALA A 110 ? N ALA A 110 C 2 3 O LYS A 105 ? O LYS A 105 N SER A 81 ? N SER A 81 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 169' AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PO4 A 170' AC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE MLN A 171' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLN A 50 ? GLN A 50 . ? 1_555 ? 2 AC1 5 CYS A 90 ? CYS A 90 . ? 1_555 ? 3 AC1 5 HIS A 132 ? HIS A 132 . ? 1_555 ? 4 AC1 5 HIS A 136 ? HIS A 136 . ? 1_555 ? 5 AC1 5 MLN D . ? MLN A 171 . ? 1_555 ? 6 AC2 7 PRO A 9 ? PRO A 9 . ? 1_555 ? 7 AC2 7 ASP A 10 ? ASP A 10 . ? 1_555 ? 8 AC2 7 ARG A 14 ? ARG A 14 . ? 1_555 ? 9 AC2 7 GLN A 152 ? GLN A 152 . ? 10_666 ? 10 AC2 7 ARG A 155 ? ARG A 155 . ? 10_666 ? 11 AC2 7 GLN A 156 ? GLN A 156 . ? 10_666 ? 12 AC2 7 GLU A 159 ? GLU A 159 . ? 10_666 ? 13 AC3 17 GLU A 42 ? GLU A 42 . ? 1_555 ? 14 AC3 17 GLY A 43 ? GLY A 43 . ? 1_555 ? 15 AC3 17 ILE A 44 ? ILE A 44 . ? 1_555 ? 16 AC3 17 GLY A 45 ? GLY A 45 . ? 1_555 ? 17 AC3 17 GLN A 50 ? GLN A 50 . ? 1_555 ? 18 AC3 17 ILE A 86 ? ILE A 86 . ? 1_555 ? 19 AC3 17 ILE A 86 ? ILE A 86 . ? 11_656 ? 20 AC3 17 GLU A 88 ? GLU A 88 . ? 1_555 ? 21 AC3 17 GLY A 89 ? GLY A 89 . ? 1_555 ? 22 AC3 17 LEU A 91 ? LEU A 91 . ? 1_555 ? 23 AC3 17 GLY A 124 ? GLY A 124 . ? 11_656 ? 24 AC3 17 LEU A 125 ? LEU A 125 . ? 11_656 ? 25 AC3 17 ILE A 128 ? ILE A 128 . ? 11_656 ? 26 AC3 17 HIS A 132 ? HIS A 132 . ? 1_555 ? 27 AC3 17 GLU A 133 ? GLU A 133 . ? 1_555 ? 28 AC3 17 HIS A 136 ? HIS A 136 . ? 1_555 ? 29 AC3 17 ZN B . ? ZN A 169 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BSK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BSK _atom_sites.fract_transf_matrix[1][1] 0.010084 _atom_sites.fract_transf_matrix[1][2] 0.005822 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011644 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009029 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 CYS 129 129 129 CYS CYS A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 MET 134 134 134 MET MET A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ARG 167 167 ? ? ? A . n A 1 168 ALA 168 168 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 169 1 ZN ZN A . C 3 PO4 1 170 1 PO4 PO4 A . D 4 MLN 1 171 1 MLN MLN A . E 5 HOH 1 172 1 HOH HOH A . E 5 HOH 2 173 2 HOH HOH A . E 5 HOH 3 174 3 HOH HOH A . E 5 HOH 4 175 4 HOH HOH A . E 5 HOH 5 176 5 HOH HOH A . E 5 HOH 6 177 6 HOH HOH A . E 5 HOH 7 178 7 HOH HOH A . E 5 HOH 8 179 8 HOH HOH A . E 5 HOH 9 180 9 HOH HOH A . E 5 HOH 10 181 10 HOH HOH A . E 5 HOH 11 182 11 HOH HOH A . E 5 HOH 12 183 12 HOH HOH A . E 5 HOH 13 184 13 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 90 ? A CYS 90 ? 1_555 ZN ? B ZN . ? A ZN 169 ? 1_555 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 121.8 ? 2 SG ? A CYS 90 ? A CYS 90 ? 1_555 ZN ? B ZN . ? A ZN 169 ? 1_555 NE2 ? A HIS 136 ? A HIS 136 ? 1_555 98.7 ? 3 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 169 ? 1_555 NE2 ? A HIS 136 ? A HIS 136 ? 1_555 106.3 ? 4 SG ? A CYS 90 ? A CYS 90 ? 1_555 ZN ? B ZN . ? A ZN 169 ? 1_555 O3 ? D MLN . ? A MLN 171 ? 1_555 124.8 ? 5 NE2 ? A HIS 132 ? A HIS 132 ? 1_555 ZN ? B ZN . ? A ZN 169 ? 1_555 O3 ? D MLN . ? A MLN 171 ? 1_555 102.4 ? 6 NE2 ? A HIS 136 ? A HIS 136 ? 1_555 ZN ? B ZN . ? A ZN 169 ? 1_555 O3 ? D MLN . ? A MLN 171 ? 1_555 98.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-04-15 2 'Structure model' 1 1 2007-10-16 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement 3.851 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 X-PLOR phasing . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 24 ? ? -142.02 -158.19 2 1 ASP A 67 ? ? -140.43 20.44 3 1 LYS A 165 ? ? -87.16 41.12 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id MLN _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 171 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id D _pdbx_unobs_or_zero_occ_atoms.label_comp_id MLN _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 167 ? A ARG 167 2 1 Y 1 A ALA 168 ? A ALA 168 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'PHOSPHATE ION' PO4 4 '(S)-2-(PHOSPHONOXY)CAPROYL-L-LEUCYL-P-NITROANILIDE' MLN 5 water HOH #