data_1BSN # _entry.id 1BSN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.344 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1BSN RCSB RCSB008224 WWPDB D_1000008224 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1BSH _pdbx_database_related.details ensemble _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BSN _pdbx_database_status.recvd_initial_deposition_date 1998-08-28 _pdbx_database_status.deposit_site BNL _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wilkens, S.' 1 'Capaldi, R.A.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure of the epsilon subunit of the F1-ATPase from Escherichia coli and interactions of this subunit with beta subunits in the complex. ; J.Biol.Chem. 273 26645 26651 1998 JBCHA3 US 0021-9258 0071 ? 9756905 10.1074/jbc.273.41.26645 1 'Structural Features of the Epsilon Subunit of the Escherichia Coli ATP Synthase Determined by NMR Spectroscopy' Nat.Struct.Biol. 2 961 ? 1995 NSBIEW US 1072-8368 2024 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wilkens, S.' 1 ? primary 'Capaldi, R.A.' 2 ? 1 'Wilkens, S.' 3 ? 1 'Dahlquist, F.W.' 4 ? 1 'Mcintosh, L.P.' 5 ? 1 'Donaldson, L.W.' 6 ? 1 'Capaldi, R.A.' 7 ? # _cell.entry_id 1BSN _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BSN _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PROTEIN (EPSILON SUBUNIT)' _entity.formula_weight 14956.047 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.1.34 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_sys.entity_id 1 _entity_name_sys.name 'EC 3.6.1.34 HYDROLASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLA DTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM ; _entity_poly.pdbx_seq_one_letter_code_can ;AMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHEEFIYLSGGILEVQPGNVTVLA DTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASAELAKAIAQLRVIELTKKAM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 THR n 1 4 TYR n 1 5 HIS n 1 6 LEU n 1 7 ASP n 1 8 VAL n 1 9 VAL n 1 10 SER n 1 11 ALA n 1 12 GLU n 1 13 GLN n 1 14 GLN n 1 15 MET n 1 16 PHE n 1 17 SER n 1 18 GLY n 1 19 LEU n 1 20 VAL n 1 21 GLU n 1 22 LYS n 1 23 ILE n 1 24 GLN n 1 25 VAL n 1 26 THR n 1 27 GLY n 1 28 SER n 1 29 GLU n 1 30 GLY n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 ILE n 1 35 TYR n 1 36 PRO n 1 37 GLY n 1 38 HIS n 1 39 ALA n 1 40 PRO n 1 41 LEU n 1 42 LEU n 1 43 THR n 1 44 ALA n 1 45 ILE n 1 46 LYS n 1 47 PRO n 1 48 GLY n 1 49 MET n 1 50 ILE n 1 51 ARG n 1 52 ILE n 1 53 VAL n 1 54 LYS n 1 55 GLN n 1 56 HIS n 1 57 GLY n 1 58 HIS n 1 59 GLU n 1 60 GLU n 1 61 PHE n 1 62 ILE n 1 63 TYR n 1 64 LEU n 1 65 SER n 1 66 GLY n 1 67 GLY n 1 68 ILE n 1 69 LEU n 1 70 GLU n 1 71 VAL n 1 72 GLN n 1 73 PRO n 1 74 GLY n 1 75 ASN n 1 76 VAL n 1 77 THR n 1 78 VAL n 1 79 LEU n 1 80 ALA n 1 81 ASP n 1 82 THR n 1 83 ALA n 1 84 ILE n 1 85 ARG n 1 86 GLY n 1 87 GLN n 1 88 ASP n 1 89 LEU n 1 90 ASP n 1 91 GLU n 1 92 ALA n 1 93 ARG n 1 94 ALA n 1 95 MET n 1 96 GLU n 1 97 ALA n 1 98 LYS n 1 99 ARG n 1 100 LYS n 1 101 ALA n 1 102 GLU n 1 103 GLU n 1 104 HIS n 1 105 ILE n 1 106 SER n 1 107 SER n 1 108 SER n 1 109 HIS n 1 110 GLY n 1 111 ASP n 1 112 VAL n 1 113 ASP n 1 114 TYR n 1 115 ALA n 1 116 GLN n 1 117 ALA n 1 118 SER n 1 119 ALA n 1 120 GLU n 1 121 LEU n 1 122 ALA n 1 123 LYS n 1 124 ALA n 1 125 ILE n 1 126 ALA n 1 127 GLN n 1 128 LEU n 1 129 ARG n 1 130 VAL n 1 131 ILE n 1 132 GLU n 1 133 LEU n 1 134 THR n 1 135 LYS n 1 136 LYS n 1 137 ALA n 1 138 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene UNCC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene UNCC _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'K38, 594, DL39, 435' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PES2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATPE_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0A6E6 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BSN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 138 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A6E6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 138 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 138 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '3D NOESY-HSMQC' 1 2 1 '3D TOCSY-HSMQC' 1 3 1 '3D C(CO)NH' 1 4 1 '3D H(CCO)NH' 1 5 1 'SIMULTANEOUS 13C/ 15N RESOLVED NOESY' 1 6 1 'VARIOUS 2D EXPERIMENTS' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure 10000 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.03 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label 'conditions 1' _pdbx_nmr_exptl_sample_conditions.pH_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 GN GE 500 ? 2 UNITY Varian 500 ? # _pdbx_nmr_refine.entry_id 1BSN _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details 'simulated annealing and molecular dynamics' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1BSN _pdbx_nmr_details.text ;THE STRUCTURE OF THE E. COLI ATPASE EPSILON SUBUNIT WAS DETERMINED USING TRIPLE-RESONANCE NMR EXPERIMENTS WITH 15N AND 13C/15N LABELED PROTEIN. ; # _pdbx_nmr_ensemble.entry_id 1BSN _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 1BSN _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR 3.1 BRUNGER 2 # _exptl.entry_id 1BSN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BSN _struct.title ;SOLUTION STRUCTURE OF THE EPSILON SUBUNIT OF THE F1-ATPSYNTHASE FROM ESCHERICHIA COLI AND ORIENTATION OF THE SUBUNIT RELATIVE TO THE BETA SUBUNITS OF THE COMPLEX ; _struct.pdbx_descriptor 'PROTEIN (EPSILON SUBUNIT) (3.6.1.34)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BSN _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'ATPSYNTHASE, F1-ATPASE, EPSILON SUBUNIT, NMR SPECTROSCOPY, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 92 ? SER A 106 ? ALA A 92 SER A 106 5 ? 15 HELX_P HELX_P2 2 TYR A 114 ? LYS A 136 ? TYR A 114 LYS A 136 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 42 ? ILE A 45 ? LEU A 42 ILE A 45 A 2 GLY A 67 ? VAL A 71 ? GLY A 67 VAL A 71 A 3 ASN A 75 ? ALA A 80 ? ASN A 75 ALA A 80 A 4 TYR A 4 ? SER A 10 ? TYR A 4 SER A 10 A 5 GLN A 14 ? THR A 26 ? GLN A 14 THR A 26 A 6 GLY A 48 ? LYS A 54 ? GLY A 48 LYS A 54 A 7 GLU A 59 ? LEU A 64 ? GLU A 59 LEU A 64 A 8 ALA A 83 ? ARG A 85 ? ALA A 83 ARG A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 43 ? O THR A 43 N LEU A 69 ? N LEU A 69 A 2 3 O ILE A 68 ? O ILE A 68 N LEU A 79 ? N LEU A 79 A 3 4 O VAL A 76 ? O VAL A 76 N HIS A 5 ? N HIS A 5 A 4 5 O TYR A 4 ? O TYR A 4 N VAL A 20 ? N VAL A 20 A 5 6 O GLU A 21 ? O GLU A 21 N VAL A 53 ? N VAL A 53 A 6 7 O GLY A 48 ? O GLY A 48 N LEU A 64 ? N LEU A 64 A 7 8 O TYR A 63 ? O TYR A 63 N ILE A 84 ? N ILE A 84 # _database_PDB_matrix.entry_id 1BSN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BSN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 MET 95 95 95 MET MET A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 MET 138 138 138 MET MET A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-09-02 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-07-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Experimental preparation' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_related 2 4 'Structure model' pdbx_nmr_ensemble 3 4 'Structure model' pdbx_nmr_exptl_sample_conditions 4 4 'Structure model' pdbx_nmr_refine 5 4 'Structure model' pdbx_nmr_representative 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' pdbx_nmr_spectrometer 8 4 'Structure model' pdbx_struct_assembly 9 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_related.content_type' 2 4 'Structure model' '_pdbx_database_related.details' 3 4 'Structure model' '_pdbx_nmr_ensemble.conformers_calculated_total_number' 4 4 'Structure model' '_pdbx_nmr_exptl_sample_conditions.ionic_strength' 5 4 'Structure model' '_pdbx_nmr_exptl_sample_conditions.label' 6 4 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pH_units' 7 4 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pressure_units' 8 4 'Structure model' '_pdbx_nmr_refine.details' 9 4 'Structure model' '_pdbx_nmr_refine.method' 10 4 'Structure model' '_pdbx_nmr_software.authors' 11 4 'Structure model' '_pdbx_nmr_software.version' 12 4 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 13 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ1 A LYS 54 ? ? OE1 A GLN 55 ? ? 1.50 2 1 HZ1 A LYS 98 ? ? OE1 A GLU 102 ? ? 1.55 3 1 OE2 A GLU 120 ? ? HZ3 A LYS 123 ? ? 1.58 4 1 O A ILE 68 ? ? H A LEU 79 ? ? 1.58 5 1 H A ILE 45 ? ? O A GLY 67 ? ? 1.59 6 1 H A ILE 50 ? ? O A ILE 62 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 2 ? ? -149.18 18.06 2 1 ALA A 11 ? ? 52.01 -97.68 3 1 SER A 28 ? ? -157.35 -61.77 4 1 THR A 43 ? ? -137.24 -150.38 5 1 SER A 65 ? ? -92.43 36.71 6 1 ASP A 81 ? ? -114.29 -78.20 7 1 LEU A 89 ? ? -145.88 -70.55 8 1 GLU A 91 ? ? -91.34 -70.70 9 1 SER A 108 ? ? 150.89 176.97 10 1 ASP A 113 ? ? -87.87 -98.82 11 1 LYS A 136 ? ? -97.00 36.30 12 1 ALA A 137 ? ? -140.09 54.13 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 51 ? ? 0.242 'SIDE CHAIN' 2 1 ARG A 85 ? ? 0.304 'SIDE CHAIN' 3 1 ARG A 93 ? ? 0.235 'SIDE CHAIN' 4 1 ARG A 99 ? ? 0.314 'SIDE CHAIN' 5 1 ARG A 129 ? ? 0.315 'SIDE CHAIN' #