data_1BTS # _entry.id 1BTS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BTS pdb_00001bts 10.2210/pdb1bts/pdb WWPDB D_1000172080 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-11-01 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BTS _pdbx_database_status.recvd_initial_deposition_date 1994-08-03 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1BTT _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gargaro, A.R.' 1 'Bloomberg, G.B.' 2 'Dempsey, C.E.' 3 'Murray, M.' 4 'Tanner, M.J.A.' 5 # _citation.id primary _citation.title 'The solution structures of the first and second transmembrane-spanning segments of band 3.' _citation.journal_abbrev Eur.J.Biochem. _citation.journal_volume 221 _citation.page_first 445 _citation.page_last 454 _citation.year 1994 _citation.journal_id_ASTM EJBCAI _citation.country IX _citation.journal_id_ISSN 0014-2956 _citation.journal_id_CSD 0262 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 8168533 _citation.pdbx_database_id_DOI 10.1111/j.1432-1033.1994.tb18757.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gargaro, A.R.' 1 ? primary 'Bloomberg, G.B.' 2 ? primary 'Dempsey, C.E.' 3 ? primary 'Murray, M.' 4 ? primary 'Tanner, M.J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BAND 3 ANION TRANSPORT PROTEIN' _entity.formula_weight 2096.491 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)GVSELLISTAVQGILFALLGA(NH2)' _entity_poly.pdbx_seq_one_letter_code_can XGVSELLISTAVQGILFALLGAX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 GLY n 1 3 VAL n 1 4 SER n 1 5 GLU n 1 6 LEU n 1 7 LEU n 1 8 ILE n 1 9 SER n 1 10 THR n 1 11 ALA n 1 12 VAL n 1 13 GLN n 1 14 GLY n 1 15 ILE n 1 16 LEU n 1 17 PHE n 1 18 ALA n 1 19 LEU n 1 20 LEU n 1 21 GLY n 1 22 ALA n 1 23 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 1 1 ACE ACE A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 NH2 23 23 23 NH2 NH2 A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1BTS _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BTS _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1BTS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1BTS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1BTS _struct.title 'THE SOLUTION STRUCTURES OF THE FIRST AND SECOND TRANSMEMBRANE-SPANNING SEGMENTS OF BAND 3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BTS _struct_keywords.pdbx_keywords 'TRANSMEMBRANE PROTEIN' _struct_keywords.text 'TRANSMEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B3AT_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02730 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAAR WVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLK HSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQP VLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLV LPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDA FSPQVLAAVIFIYFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCE TNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQKTYNYNVLMV PKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYTQKLSVPDGFKV SNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFG MPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLVGLSILMEPILSRIPLAVLFGIFLYMGVTSL SGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQIICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRN VELQCLDADDAKATFDEEEGRDEYDEVAMPV ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BTS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 22 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02730 _struct_ref_seq.db_align_beg 436 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 456 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id A _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 3 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 20 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 3 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 20 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A GLY 2 N ? ? A ACE 1 A GLY 2 1_555 ? ? ? ? ? ? ? 1.309 ? ? covale2 covale both ? A ALA 22 C ? ? ? 1_555 A NH2 23 N ? ? A ALA 22 A NH2 23 1_555 ? ? ? ? ? ? ? 1.304 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 ACE A 1 ? GLY A 2 ? ACE A 1 ? 1_555 GLY A 2 ? 1_555 . . GLY 12 ACE None 'Terminal acetylation' 2 NH2 A 23 ? ALA A 22 ? NH2 A 23 ? 1_555 ALA A 22 ? 1_555 . . ALA 1 NH2 None 'Terminal amidation' # _struct_site.id AC2 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 23 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 23' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC2 2 GLY A 21 ? GLY A 21 . ? 1_555 ? 2 AC2 2 ALA A 22 ? ALA A 22 . ? 1_555 ? # _pdbx_entry_details.entry_id 1BTS _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_nmr_ensemble.entry_id 1BTS _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 GLN N N N N 21 GLN CA C N S 22 GLN C C N N 23 GLN O O N N 24 GLN CB C N N 25 GLN CG C N N 26 GLN CD C N N 27 GLN OE1 O N N 28 GLN NE2 N N N 29 GLN OXT O N N 30 GLN H H N N 31 GLN H2 H N N 32 GLN HA H N N 33 GLN HB2 H N N 34 GLN HB3 H N N 35 GLN HG2 H N N 36 GLN HG3 H N N 37 GLN HE21 H N N 38 GLN HE22 H N N 39 GLN HXT H N N 40 GLU N N N N 41 GLU CA C N S 42 GLU C C N N 43 GLU O O N N 44 GLU CB C N N 45 GLU CG C N N 46 GLU CD C N N 47 GLU OE1 O N N 48 GLU OE2 O N N 49 GLU OXT O N N 50 GLU H H N N 51 GLU H2 H N N 52 GLU HA H N N 53 GLU HB2 H N N 54 GLU HB3 H N N 55 GLU HG2 H N N 56 GLU HG3 H N N 57 GLU HE2 H N N 58 GLU HXT H N N 59 GLY N N N N 60 GLY CA C N N 61 GLY C C N N 62 GLY O O N N 63 GLY OXT O N N 64 GLY H H N N 65 GLY H2 H N N 66 GLY HA2 H N N 67 GLY HA3 H N N 68 GLY HXT H N N 69 ILE N N N N 70 ILE CA C N S 71 ILE C C N N 72 ILE O O N N 73 ILE CB C N S 74 ILE CG1 C N N 75 ILE CG2 C N N 76 ILE CD1 C N N 77 ILE OXT O N N 78 ILE H H N N 79 ILE H2 H N N 80 ILE HA H N N 81 ILE HB H N N 82 ILE HG12 H N N 83 ILE HG13 H N N 84 ILE HG21 H N N 85 ILE HG22 H N N 86 ILE HG23 H N N 87 ILE HD11 H N N 88 ILE HD12 H N N 89 ILE HD13 H N N 90 ILE HXT H N N 91 LEU N N N N 92 LEU CA C N S 93 LEU C C N N 94 LEU O O N N 95 LEU CB C N N 96 LEU CG C N N 97 LEU CD1 C N N 98 LEU CD2 C N N 99 LEU OXT O N N 100 LEU H H N N 101 LEU H2 H N N 102 LEU HA H N N 103 LEU HB2 H N N 104 LEU HB3 H N N 105 LEU HG H N N 106 LEU HD11 H N N 107 LEU HD12 H N N 108 LEU HD13 H N N 109 LEU HD21 H N N 110 LEU HD22 H N N 111 LEU HD23 H N N 112 LEU HXT H N N 113 NH2 N N N N 114 NH2 HN1 H N N 115 NH2 HN2 H N N 116 PHE N N N N 117 PHE CA C N S 118 PHE C C N N 119 PHE O O N N 120 PHE CB C N N 121 PHE CG C Y N 122 PHE CD1 C Y N 123 PHE CD2 C Y N 124 PHE CE1 C Y N 125 PHE CE2 C Y N 126 PHE CZ C Y N 127 PHE OXT O N N 128 PHE H H N N 129 PHE H2 H N N 130 PHE HA H N N 131 PHE HB2 H N N 132 PHE HB3 H N N 133 PHE HD1 H N N 134 PHE HD2 H N N 135 PHE HE1 H N N 136 PHE HE2 H N N 137 PHE HZ H N N 138 PHE HXT H N N 139 SER N N N N 140 SER CA C N S 141 SER C C N N 142 SER O O N N 143 SER CB C N N 144 SER OG O N N 145 SER OXT O N N 146 SER H H N N 147 SER H2 H N N 148 SER HA H N N 149 SER HB2 H N N 150 SER HB3 H N N 151 SER HG H N N 152 SER HXT H N N 153 THR N N N N 154 THR CA C N S 155 THR C C N N 156 THR O O N N 157 THR CB C N R 158 THR OG1 O N N 159 THR CG2 C N N 160 THR OXT O N N 161 THR H H N N 162 THR H2 H N N 163 THR HA H N N 164 THR HB H N N 165 THR HG1 H N N 166 THR HG21 H N N 167 THR HG22 H N N 168 THR HG23 H N N 169 THR HXT H N N 170 VAL N N N N 171 VAL CA C N S 172 VAL C C N N 173 VAL O O N N 174 VAL CB C N N 175 VAL CG1 C N N 176 VAL CG2 C N N 177 VAL OXT O N N 178 VAL H H N N 179 VAL H2 H N N 180 VAL HA H N N 181 VAL HB H N N 182 VAL HG11 H N N 183 VAL HG12 H N N 184 VAL HG13 H N N 185 VAL HG21 H N N 186 VAL HG22 H N N 187 VAL HG23 H N N 188 VAL HXT H N N 189 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 GLN N CA sing N N 19 GLN N H sing N N 20 GLN N H2 sing N N 21 GLN CA C sing N N 22 GLN CA CB sing N N 23 GLN CA HA sing N N 24 GLN C O doub N N 25 GLN C OXT sing N N 26 GLN CB CG sing N N 27 GLN CB HB2 sing N N 28 GLN CB HB3 sing N N 29 GLN CG CD sing N N 30 GLN CG HG2 sing N N 31 GLN CG HG3 sing N N 32 GLN CD OE1 doub N N 33 GLN CD NE2 sing N N 34 GLN NE2 HE21 sing N N 35 GLN NE2 HE22 sing N N 36 GLN OXT HXT sing N N 37 GLU N CA sing N N 38 GLU N H sing N N 39 GLU N H2 sing N N 40 GLU CA C sing N N 41 GLU CA CB sing N N 42 GLU CA HA sing N N 43 GLU C O doub N N 44 GLU C OXT sing N N 45 GLU CB CG sing N N 46 GLU CB HB2 sing N N 47 GLU CB HB3 sing N N 48 GLU CG CD sing N N 49 GLU CG HG2 sing N N 50 GLU CG HG3 sing N N 51 GLU CD OE1 doub N N 52 GLU CD OE2 sing N N 53 GLU OE2 HE2 sing N N 54 GLU OXT HXT sing N N 55 GLY N CA sing N N 56 GLY N H sing N N 57 GLY N H2 sing N N 58 GLY CA C sing N N 59 GLY CA HA2 sing N N 60 GLY CA HA3 sing N N 61 GLY C O doub N N 62 GLY C OXT sing N N 63 GLY OXT HXT sing N N 64 ILE N CA sing N N 65 ILE N H sing N N 66 ILE N H2 sing N N 67 ILE CA C sing N N 68 ILE CA CB sing N N 69 ILE CA HA sing N N 70 ILE C O doub N N 71 ILE C OXT sing N N 72 ILE CB CG1 sing N N 73 ILE CB CG2 sing N N 74 ILE CB HB sing N N 75 ILE CG1 CD1 sing N N 76 ILE CG1 HG12 sing N N 77 ILE CG1 HG13 sing N N 78 ILE CG2 HG21 sing N N 79 ILE CG2 HG22 sing N N 80 ILE CG2 HG23 sing N N 81 ILE CD1 HD11 sing N N 82 ILE CD1 HD12 sing N N 83 ILE CD1 HD13 sing N N 84 ILE OXT HXT sing N N 85 LEU N CA sing N N 86 LEU N H sing N N 87 LEU N H2 sing N N 88 LEU CA C sing N N 89 LEU CA CB sing N N 90 LEU CA HA sing N N 91 LEU C O doub N N 92 LEU C OXT sing N N 93 LEU CB CG sing N N 94 LEU CB HB2 sing N N 95 LEU CB HB3 sing N N 96 LEU CG CD1 sing N N 97 LEU CG CD2 sing N N 98 LEU CG HG sing N N 99 LEU CD1 HD11 sing N N 100 LEU CD1 HD12 sing N N 101 LEU CD1 HD13 sing N N 102 LEU CD2 HD21 sing N N 103 LEU CD2 HD22 sing N N 104 LEU CD2 HD23 sing N N 105 LEU OXT HXT sing N N 106 NH2 N HN1 sing N N 107 NH2 N HN2 sing N N 108 PHE N CA sing N N 109 PHE N H sing N N 110 PHE N H2 sing N N 111 PHE CA C sing N N 112 PHE CA CB sing N N 113 PHE CA HA sing N N 114 PHE C O doub N N 115 PHE C OXT sing N N 116 PHE CB CG sing N N 117 PHE CB HB2 sing N N 118 PHE CB HB3 sing N N 119 PHE CG CD1 doub Y N 120 PHE CG CD2 sing Y N 121 PHE CD1 CE1 sing Y N 122 PHE CD1 HD1 sing N N 123 PHE CD2 CE2 doub Y N 124 PHE CD2 HD2 sing N N 125 PHE CE1 CZ doub Y N 126 PHE CE1 HE1 sing N N 127 PHE CE2 CZ sing Y N 128 PHE CE2 HE2 sing N N 129 PHE CZ HZ sing N N 130 PHE OXT HXT sing N N 131 SER N CA sing N N 132 SER N H sing N N 133 SER N H2 sing N N 134 SER CA C sing N N 135 SER CA CB sing N N 136 SER CA HA sing N N 137 SER C O doub N N 138 SER C OXT sing N N 139 SER CB OG sing N N 140 SER CB HB2 sing N N 141 SER CB HB3 sing N N 142 SER OG HG sing N N 143 SER OXT HXT sing N N 144 THR N CA sing N N 145 THR N H sing N N 146 THR N H2 sing N N 147 THR CA C sing N N 148 THR CA CB sing N N 149 THR CA HA sing N N 150 THR C O doub N N 151 THR C OXT sing N N 152 THR CB OG1 sing N N 153 THR CB CG2 sing N N 154 THR CB HB sing N N 155 THR OG1 HG1 sing N N 156 THR CG2 HG21 sing N N 157 THR CG2 HG22 sing N N 158 THR CG2 HG23 sing N N 159 THR OXT HXT sing N N 160 VAL N CA sing N N 161 VAL N H sing N N 162 VAL N H2 sing N N 163 VAL CA C sing N N 164 VAL CA CB sing N N 165 VAL CA HA sing N N 166 VAL C O doub N N 167 VAL C OXT sing N N 168 VAL CB CG1 sing N N 169 VAL CB CG2 sing N N 170 VAL CB HB sing N N 171 VAL CG1 HG11 sing N N 172 VAL CG1 HG12 sing N N 173 VAL CG1 HG13 sing N N 174 VAL CG2 HG21 sing N N 175 VAL CG2 HG22 sing N N 176 VAL CG2 HG23 sing N N 177 VAL OXT HXT sing N N 178 # _atom_sites.entry_id 1BTS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_