data_1BYN # _entry.id 1BYN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BYN pdb_00001byn 10.2210/pdb1byn/pdb RCSB RCSB008150 ? ? WWPDB D_1000008150 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-10-21 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_ref_seq_dif.details' 31 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BYN _pdbx_database_status.recvd_initial_deposition_date 1998-10-18 _pdbx_database_status.deposit_site BNL _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shao, X.' 1 'Fernandez, I.' 2 'Sudhof, T.C.' 3 'Rizo, J.' 4 # _citation.id primary _citation.title 'Solution structures of the Ca2+-free and Ca2+-bound C2A domain of synaptotagmin I: does Ca2+ induce a conformational change?' _citation.journal_abbrev Biochemistry _citation.journal_volume 37 _citation.page_first 16106 _citation.page_last 16115 _citation.year 1998 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9819203 _citation.pdbx_database_id_DOI 10.1021/bi981789h # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shao, X.' 1 ? primary 'Fernandez, I.' 2 ? primary 'Sudhof, T.C.' 3 ? primary 'Rizo, J.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (SYNAPTOTAGMIN I)' 14783.882 1 ? ? C2A-DOMAIN ? 2 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSEL GGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK ; _entity_poly.pdbx_seq_one_letter_code_can ;EKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSEL GGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 LYS n 1 3 LEU n 1 4 GLY n 1 5 LYS n 1 6 LEU n 1 7 GLN n 1 8 TYR n 1 9 SER n 1 10 LEU n 1 11 ASP n 1 12 TYR n 1 13 ASP n 1 14 PHE n 1 15 GLN n 1 16 ASN n 1 17 ASN n 1 18 GLN n 1 19 LEU n 1 20 LEU n 1 21 VAL n 1 22 GLY n 1 23 ILE n 1 24 ILE n 1 25 GLN n 1 26 ALA n 1 27 ALA n 1 28 GLU n 1 29 LEU n 1 30 PRO n 1 31 ALA n 1 32 LEU n 1 33 ASP n 1 34 MET n 1 35 GLY n 1 36 GLY n 1 37 THR n 1 38 SER n 1 39 ASP n 1 40 PRO n 1 41 TYR n 1 42 VAL n 1 43 LYS n 1 44 VAL n 1 45 PHE n 1 46 LEU n 1 47 LEU n 1 48 PRO n 1 49 ASP n 1 50 LYS n 1 51 LYS n 1 52 LYS n 1 53 LYS n 1 54 PHE n 1 55 GLU n 1 56 THR n 1 57 LYS n 1 58 VAL n 1 59 HIS n 1 60 ARG n 1 61 LYS n 1 62 THR n 1 63 LEU n 1 64 ASN n 1 65 PRO n 1 66 VAL n 1 67 PHE n 1 68 ASN n 1 69 GLU n 1 70 GLN n 1 71 PHE n 1 72 THR n 1 73 PHE n 1 74 LYS n 1 75 VAL n 1 76 PRO n 1 77 TYR n 1 78 SER n 1 79 GLU n 1 80 LEU n 1 81 GLY n 1 82 GLY n 1 83 LYS n 1 84 THR n 1 85 LEU n 1 86 VAL n 1 87 MET n 1 88 ALA n 1 89 VAL n 1 90 TYR n 1 91 ASP n 1 92 PHE n 1 93 ASP n 1 94 ARG n 1 95 PHE n 1 96 SER n 1 97 LYS n 1 98 HIS n 1 99 ASP n 1 100 ILE n 1 101 ILE n 1 102 GLY n 1 103 GLU n 1 104 PHE n 1 105 LYS n 1 106 VAL n 1 107 PRO n 1 108 MET n 1 109 ASN n 1 110 THR n 1 111 VAL n 1 112 ASP n 1 113 PHE n 1 114 GLY n 1 115 HIS n 1 116 VAL n 1 117 THR n 1 118 GLU n 1 119 GLU n 1 120 TRP n 1 121 ARG n 1 122 ASP n 1 123 LEU n 1 124 GLN n 1 125 SER n 1 126 ALA n 1 127 GLU n 1 128 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21-DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 140 140 GLU GLU A . n A 1 2 LYS 2 141 141 LYS LYS A . n A 1 3 LEU 3 142 142 LEU LEU A . n A 1 4 GLY 4 143 143 GLY GLY A . n A 1 5 LYS 5 144 144 LYS LYS A . n A 1 6 LEU 6 145 145 LEU LEU A . n A 1 7 GLN 7 146 146 GLN GLN A . n A 1 8 TYR 8 147 147 TYR TYR A . n A 1 9 SER 9 148 148 SER SER A . n A 1 10 LEU 10 149 149 LEU LEU A . n A 1 11 ASP 11 150 150 ASP ASP A . n A 1 12 TYR 12 151 151 TYR TYR A . n A 1 13 ASP 13 152 152 ASP ASP A . n A 1 14 PHE 14 153 153 PHE PHE A . n A 1 15 GLN 15 154 154 GLN GLN A . n A 1 16 ASN 16 155 155 ASN ASN A . n A 1 17 ASN 17 156 156 ASN ASN A . n A 1 18 GLN 18 157 157 GLN GLN A . n A 1 19 LEU 19 158 158 LEU LEU A . n A 1 20 LEU 20 159 159 LEU LEU A . n A 1 21 VAL 21 160 160 VAL VAL A . n A 1 22 GLY 22 161 161 GLY GLY A . n A 1 23 ILE 23 162 162 ILE ILE A . n A 1 24 ILE 24 163 163 ILE ILE A . n A 1 25 GLN 25 164 164 GLN GLN A . n A 1 26 ALA 26 165 165 ALA ALA A . n A 1 27 ALA 27 166 166 ALA ALA A . n A 1 28 GLU 28 167 167 GLU GLU A . n A 1 29 LEU 29 168 168 LEU LEU A . n A 1 30 PRO 30 169 169 PRO PRO A . n A 1 31 ALA 31 170 170 ALA ALA A . n A 1 32 LEU 32 171 171 LEU LEU A . n A 1 33 ASP 33 172 172 ASP ASP A . n A 1 34 MET 34 173 173 MET MET A . n A 1 35 GLY 35 174 174 GLY GLY A . n A 1 36 GLY 36 175 175 GLY GLY A . n A 1 37 THR 37 176 176 THR THR A . n A 1 38 SER 38 177 177 SER SER A . n A 1 39 ASP 39 178 178 ASP ASP A . n A 1 40 PRO 40 179 179 PRO PRO A . n A 1 41 TYR 41 180 180 TYR TYR A . n A 1 42 VAL 42 181 181 VAL VAL A . n A 1 43 LYS 43 182 182 LYS LYS A . n A 1 44 VAL 44 183 183 VAL VAL A . n A 1 45 PHE 45 184 184 PHE PHE A . n A 1 46 LEU 46 185 185 LEU LEU A . n A 1 47 LEU 47 186 186 LEU LEU A . n A 1 48 PRO 48 187 187 PRO PRO A . n A 1 49 ASP 49 188 188 ASP ASP A . n A 1 50 LYS 50 189 189 LYS LYS A . n A 1 51 LYS 51 190 190 LYS LYS A . n A 1 52 LYS 52 191 191 LYS LYS A . n A 1 53 LYS 53 192 192 LYS LYS A . n A 1 54 PHE 54 193 193 PHE PHE A . n A 1 55 GLU 55 194 194 GLU GLU A . n A 1 56 THR 56 195 195 THR THR A . n A 1 57 LYS 57 196 196 LYS LYS A . n A 1 58 VAL 58 197 197 VAL VAL A . n A 1 59 HIS 59 198 198 HIS HIS A . n A 1 60 ARG 60 199 199 ARG ARG A . n A 1 61 LYS 61 200 200 LYS LYS A . n A 1 62 THR 62 201 201 THR THR A . n A 1 63 LEU 63 202 202 LEU LEU A . n A 1 64 ASN 64 203 203 ASN ASN A . n A 1 65 PRO 65 204 204 PRO PRO A . n A 1 66 VAL 66 205 205 VAL VAL A . n A 1 67 PHE 67 206 206 PHE PHE A . n A 1 68 ASN 68 207 207 ASN ASN A . n A 1 69 GLU 69 208 208 GLU GLU A . n A 1 70 GLN 70 209 209 GLN GLN A . n A 1 71 PHE 71 210 210 PHE PHE A . n A 1 72 THR 72 211 211 THR THR A . n A 1 73 PHE 73 212 212 PHE PHE A . n A 1 74 LYS 74 213 213 LYS LYS A . n A 1 75 VAL 75 214 214 VAL VAL A . n A 1 76 PRO 76 215 215 PRO PRO A . n A 1 77 TYR 77 216 216 TYR TYR A . n A 1 78 SER 78 217 217 SER SER A . n A 1 79 GLU 79 218 218 GLU GLU A . n A 1 80 LEU 80 219 219 LEU LEU A . n A 1 81 GLY 81 220 220 GLY GLY A . n A 1 82 GLY 82 221 221 GLY GLY A . n A 1 83 LYS 83 222 222 LYS LYS A . n A 1 84 THR 84 223 223 THR THR A . n A 1 85 LEU 85 224 224 LEU LEU A . n A 1 86 VAL 86 225 225 VAL VAL A . n A 1 87 MET 87 226 226 MET MET A . n A 1 88 ALA 88 227 227 ALA ALA A . n A 1 89 VAL 89 228 228 VAL VAL A . n A 1 90 TYR 90 229 229 TYR TYR A . n A 1 91 ASP 91 230 230 ASP ASP A . n A 1 92 PHE 92 231 231 PHE PHE A . n A 1 93 ASP 93 232 232 ASP ASP A . n A 1 94 ARG 94 233 233 ARG ARG A . n A 1 95 PHE 95 234 234 PHE PHE A . n A 1 96 SER 96 235 235 SER SER A . n A 1 97 LYS 97 236 236 LYS LYS A . n A 1 98 HIS 98 237 237 HIS HIS A . n A 1 99 ASP 99 238 238 ASP ASP A . n A 1 100 ILE 100 239 239 ILE ILE A . n A 1 101 ILE 101 240 240 ILE ILE A . n A 1 102 GLY 102 241 241 GLY GLY A . n A 1 103 GLU 103 242 242 GLU GLU A . n A 1 104 PHE 104 243 243 PHE PHE A . n A 1 105 LYS 105 244 244 LYS LYS A . n A 1 106 VAL 106 245 245 VAL VAL A . n A 1 107 PRO 107 246 246 PRO PRO A . n A 1 108 MET 108 247 247 MET MET A . n A 1 109 ASN 109 248 248 ASN ASN A . n A 1 110 THR 110 249 249 THR THR A . n A 1 111 VAL 111 250 250 VAL VAL A . n A 1 112 ASP 112 251 251 ASP ASP A . n A 1 113 PHE 113 252 252 PHE PHE A . n A 1 114 GLY 114 253 253 GLY GLY A . n A 1 115 HIS 115 254 254 HIS HIS A . n A 1 116 VAL 116 255 255 VAL VAL A . n A 1 117 THR 117 256 256 THR THR A . n A 1 118 GLU 118 257 257 GLU GLU A . n A 1 119 GLU 119 258 258 GLU GLU A . n A 1 120 TRP 120 259 259 TRP TRP A . n A 1 121 ARG 121 260 260 ARG ARG A . n A 1 122 ASP 122 261 261 ASP ASP A . n A 1 123 LEU 123 262 262 LEU LEU A . n A 1 124 GLN 124 263 263 GLN GLN A . n A 1 125 SER 125 264 264 SER SER A . n A 1 126 ALA 126 265 265 ALA ALA A . n A 1 127 GLU 127 266 266 GLU GLU A . n A 1 128 LYS 128 267 267 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 272 272 CA KAL A . C 2 CA 1 273 273 CA KAL A . D 2 CA 1 274 274 CA KAL A . # _cell.entry_id 1BYN _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BYN _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1BYN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1BYN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1BYN _struct.title 'SOLUTION STRUCTURE OF THE CALCIUM-BOUND FIRST C2-DOMAIN OF SYNAPTOTAGMIN I' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BYN _struct_keywords.pdbx_keywords ENDOCYTOSIS/EXOCYTOSIS _struct_keywords.text 'SYNAPTOTAGMIN, C2-DOMAIN, EXOCYTOSIS, NEUROTRANSMITTER RELEASE, ENDOCYTOSIS-EXOCYTOSIS COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SYT1_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P21707 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BYN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21707 _struct_ref_seq.db_align_beg 140 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 267 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 140 _struct_ref_seq.pdbx_auth_seq_align_end 267 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1BYN _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 49 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P21707 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 188 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 188 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 77 ? LEU A 80 ? TYR A 216 LEU A 219 1 ? 4 HELX_P HELX_P2 2 MET A 108 ? THR A 110 ? MET A 247 THR A 249 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A LEU 32 O ? ? ? 1_555 C CA . CA ? ? A LEU 171 A CA 273 1_555 ? ? ? ? ? ? ? 2.790 ? ? metalc2 metalc ? ? A ASP 33 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 172 A CA 272 1_555 ? ? ? ? ? ? ? 2.812 ? ? metalc3 metalc ? ? A ASP 33 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 172 A CA 272 1_555 ? ? ? ? ? ? ? 2.819 ? ? metalc4 metalc ? ? A ASP 33 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 172 A CA 273 1_555 ? ? ? ? ? ? ? 2.830 ? ? metalc5 metalc ? ? A ASP 39 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 178 A CA 272 1_555 ? ? ? ? ? ? ? 2.813 ? ? metalc6 metalc ? ? A ASP 91 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 230 A CA 272 1_555 ? ? ? ? ? ? ? 2.813 ? ? metalc7 metalc ? ? A ASP 91 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 230 A CA 273 1_555 ? ? ? ? ? ? ? 3.308 ? ? metalc8 metalc ? ? A ASP 91 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 230 A CA 273 1_555 ? ? ? ? ? ? ? 2.839 ? ? metalc9 metalc ? ? A PHE 92 O ? ? ? 1_555 B CA . CA ? ? A PHE 231 A CA 272 1_555 ? ? ? ? ? ? ? 2.807 ? ? metalc10 metalc ? ? A ASP 93 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 232 A CA 272 1_555 ? ? ? ? ? ? ? 2.817 ? ? metalc11 metalc ? ? A ASP 93 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 232 A CA 273 1_555 ? ? ? ? ? ? ? 2.831 ? ? metalc12 metalc ? ? A ASP 93 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 232 A CA 273 1_555 ? ? ? ? ? ? ? 2.803 ? ? metalc13 metalc ? ? A ASP 93 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 232 A CA 274 1_555 ? ? ? ? ? ? ? 2.838 ? ? metalc14 metalc ? ? A SER 96 OG ? ? ? 1_555 D CA . CA ? ? A SER 235 A CA 274 1_555 ? ? ? ? ? ? ? 2.841 ? ? metalc15 metalc ? ? A LYS 97 O ? ? ? 1_555 D CA . CA ? ? A LYS 236 A CA 274 1_555 ? ? ? ? ? ? ? 2.805 ? ? metalc16 metalc ? ? A ASP 99 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 238 A CA 273 1_555 ? ? ? ? ? ? ? 2.821 ? ? metalc17 metalc ? ? A ASP 99 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 238 A CA 274 1_555 ? ? ? ? ? ? ? 2.838 ? ? metalc18 metalc ? ? A ASP 99 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 238 A CA 274 1_555 ? ? ? ? ? ? ? 2.832 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A LEU 32 ? A LEU 171 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 68.9 ? 2 O ? A LEU 32 ? A LEU 171 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 129.2 ? 3 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 66.2 ? 4 O ? A LEU 32 ? A LEU 171 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 91 ? A ASP 230 ? 1_555 97.2 ? 5 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 91 ? A ASP 230 ? 1_555 62.7 ? 6 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 91 ? A ASP 230 ? 1_555 40.7 ? 7 O ? A LEU 32 ? A LEU 171 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 136.7 ? 8 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 124.6 ? 9 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 89.3 ? 10 OD2 ? A ASP 91 ? A ASP 230 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 125.9 ? 11 O ? A LEU 32 ? A LEU 171 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 108.9 ? 12 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 82.9 ? 13 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 87.9 ? 14 OD2 ? A ASP 91 ? A ASP 230 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 125.2 ? 15 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 45.7 ? 16 O ? A LEU 32 ? A LEU 171 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 80.7 ? 17 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 140.5 ? 18 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 149.9 ? 19 OD2 ? A ASP 91 ? A ASP 230 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 149.0 ? 20 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 64.4 ? 21 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 CA ? C CA . ? A CA 273 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 83.8 ? 22 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD2 ? A ASP 33 ? A ASP 172 ? 1_555 45.7 ? 23 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD2 ? A ASP 39 ? A ASP 178 ? 1_555 110.1 ? 24 OD2 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD2 ? A ASP 39 ? A ASP 178 ? 1_555 112.3 ? 25 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 73.7 ? 26 OD2 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 119.4 ? 27 OD2 ? A ASP 39 ? A ASP 178 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 87.6 ? 28 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 O ? A PHE 92 ? A PHE 231 ? 1_555 148.3 ? 29 OD2 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 O ? A PHE 92 ? A PHE 231 ? 1_555 165.9 ? 30 OD2 ? A ASP 39 ? A ASP 178 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 O ? A PHE 92 ? A PHE 231 ? 1_555 66.4 ? 31 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 O ? A PHE 92 ? A PHE 231 ? 1_555 74.7 ? 32 OD1 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 83.0 ? 33 OD2 ? A ASP 33 ? A ASP 172 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 75.1 ? 34 OD2 ? A ASP 39 ? A ASP 178 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 166.8 ? 35 OD1 ? A ASP 91 ? A ASP 230 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 98.2 ? 36 O ? A PHE 92 ? A PHE 231 ? 1_555 CA ? B CA . ? A CA 272 ? 1_555 OD1 ? A ASP 93 ? A ASP 232 ? 1_555 103.6 ? 37 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 OG ? A SER 96 ? A SER 235 ? 1_555 107.2 ? 38 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 O ? A LYS 97 ? A LYS 236 ? 1_555 87.9 ? 39 OG ? A SER 96 ? A SER 235 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 O ? A LYS 97 ? A LYS 236 ? 1_555 85.9 ? 40 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 OD1 ? A ASP 99 ? A ASP 238 ? 1_555 87.6 ? 41 OG ? A SER 96 ? A SER 235 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 OD1 ? A ASP 99 ? A ASP 238 ? 1_555 152.8 ? 42 O ? A LYS 97 ? A LYS 236 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 OD1 ? A ASP 99 ? A ASP 238 ? 1_555 71.6 ? 43 OD2 ? A ASP 93 ? A ASP 232 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 64.2 ? 44 OG ? A SER 96 ? A SER 235 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 161.9 ? 45 O ? A LYS 97 ? A LYS 236 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 108.8 ? 46 OD1 ? A ASP 99 ? A ASP 238 ? 1_555 CA ? D CA . ? A CA 274 ? 1_555 OD2 ? A ASP 99 ? A ASP 238 ? 1_555 45.3 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 1 -10.16 2 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 2 -0.48 3 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 3 -4.03 4 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 4 1.54 5 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 5 4.56 6 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 6 -10.44 7 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 7 -0.25 8 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 8 -1.97 9 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 9 1.22 10 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 10 5.45 11 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 11 0.68 12 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 12 -4.71 13 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 13 -4.61 14 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 14 -0.09 15 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 15 10.05 16 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 16 -0.11 17 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 17 -5.69 18 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 18 -7.31 19 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 19 1.43 20 LEU 47 A . ? LEU 186 A PRO 48 A ? PRO 187 A 20 -7.93 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 116 ? ASP A 122 ? VAL A 255 ASP A 261 A 2 LYS A 5 ? ASP A 13 ? LYS A 144 ASP A 152 A 3 GLN A 18 ? ALA A 27 ? GLN A 157 ALA A 166 A 4 GLU A 69 ? PHE A 73 ? GLU A 208 PHE A 212 B 1 PRO A 40 ? LEU A 47 ? PRO A 179 LEU A 186 B 2 THR A 84 ? ASP A 91 ? THR A 223 ASP A 230 B 3 ILE A 100 ? PRO A 107 ? ILE A 239 PRO A 246 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 117 ? O THR A 256 N LEU A 10 ? N LEU A 149 A 2 3 O LYS A 5 ? O LYS A 144 N ALA A 27 ? N ALA A 166 A 3 4 O LEU A 19 ? O LEU A 158 N PHE A 73 ? N PHE A 212 B 1 2 O TYR A 41 ? O TYR A 180 N TYR A 90 ? N TYR A 229 B 2 3 O LEU A 85 ? O LEU A 224 N VAL A 106 ? N VAL A 245 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 272 ? 5 'BINDING SITE FOR RESIDUE CA A 272' AC2 Software A CA 273 ? 5 'BINDING SITE FOR RESIDUE CA A 273' AC3 Software A CA 274 ? 4 'BINDING SITE FOR RESIDUE CA A 274' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 33 ? ASP A 172 . ? 1_555 ? 2 AC1 5 ASP A 39 ? ASP A 178 . ? 1_555 ? 3 AC1 5 ASP A 91 ? ASP A 230 . ? 1_555 ? 4 AC1 5 PHE A 92 ? PHE A 231 . ? 1_555 ? 5 AC1 5 ASP A 93 ? ASP A 232 . ? 1_555 ? 6 AC2 5 LEU A 32 ? LEU A 171 . ? 1_555 ? 7 AC2 5 ASP A 33 ? ASP A 172 . ? 1_555 ? 8 AC2 5 ASP A 91 ? ASP A 230 . ? 1_555 ? 9 AC2 5 ASP A 93 ? ASP A 232 . ? 1_555 ? 10 AC2 5 ASP A 99 ? ASP A 238 . ? 1_555 ? 11 AC3 4 ASP A 93 ? ASP A 232 . ? 1_555 ? 12 AC3 4 SER A 96 ? SER A 235 . ? 1_555 ? 13 AC3 4 LYS A 97 ? LYS A 236 . ? 1_555 ? 14 AC3 4 ASP A 99 ? ASP A 238 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.411 1.354 0.057 0.009 N 2 1 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.425 1.354 0.071 0.009 N 3 1 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.414 1.354 0.060 0.009 N 4 2 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.416 1.354 0.062 0.009 N 5 2 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.422 1.354 0.068 0.009 N 6 2 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.413 1.354 0.059 0.009 N 7 3 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.425 1.354 0.071 0.009 N 8 3 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.413 1.354 0.059 0.009 N 9 4 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.412 1.354 0.058 0.009 N 10 4 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.424 1.354 0.070 0.009 N 11 4 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.414 1.354 0.060 0.009 N 12 5 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.417 1.354 0.063 0.009 N 13 5 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.422 1.354 0.068 0.009 N 14 5 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.413 1.354 0.059 0.009 N 15 6 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.410 1.354 0.056 0.009 N 16 6 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.421 1.354 0.067 0.009 N 17 6 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.414 1.354 0.060 0.009 N 18 7 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.414 1.354 0.060 0.009 N 19 7 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.425 1.354 0.071 0.009 N 20 7 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.415 1.354 0.061 0.009 N 21 8 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.411 1.354 0.057 0.009 N 22 8 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.423 1.354 0.069 0.009 N 23 8 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.414 1.354 0.060 0.009 N 24 9 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.412 1.354 0.058 0.009 N 25 9 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.420 1.354 0.066 0.009 N 26 9 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.413 1.354 0.059 0.009 N 27 10 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.411 1.354 0.057 0.009 N 28 10 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.423 1.354 0.069 0.009 N 29 10 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.415 1.354 0.061 0.009 N 30 11 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.413 1.354 0.059 0.009 N 31 11 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.422 1.354 0.068 0.009 N 32 11 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.413 1.354 0.059 0.009 N 33 12 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.414 1.354 0.060 0.009 N 34 12 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.423 1.354 0.069 0.009 N 35 12 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.414 1.354 0.060 0.009 N 36 13 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.413 1.354 0.059 0.009 N 37 13 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.423 1.354 0.069 0.009 N 38 13 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.412 1.354 0.058 0.009 N 39 14 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.423 1.354 0.069 0.009 N 40 14 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.414 1.354 0.060 0.009 N 41 15 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.410 1.354 0.056 0.009 N 42 15 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.422 1.354 0.068 0.009 N 43 15 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.414 1.354 0.060 0.009 N 44 16 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.409 1.354 0.055 0.009 N 45 16 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.425 1.354 0.071 0.009 N 46 16 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.413 1.354 0.059 0.009 N 47 17 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.408 1.354 0.054 0.009 N 48 17 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.422 1.354 0.068 0.009 N 49 17 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.422 1.354 0.068 0.009 N 50 18 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.423 1.354 0.069 0.009 N 51 18 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.413 1.354 0.059 0.009 N 52 19 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.420 1.354 0.066 0.009 N 53 19 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.412 1.354 0.058 0.009 N 54 20 CG A HIS 198 ? ? CD2 A HIS 198 ? ? 1.409 1.354 0.055 0.009 N 55 20 CG A HIS 237 ? ? CD2 A HIS 237 ? ? 1.423 1.354 0.069 0.009 N 56 20 CG A HIS 254 ? ? CD2 A HIS 254 ? ? 1.412 1.354 0.058 0.009 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.22 111.50 8.72 1.30 N 2 1 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.14 120.30 3.84 0.50 N 3 1 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.16 120.30 3.86 0.50 N 4 1 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.32 111.50 8.82 1.30 N 5 1 N A PHE 252 ? ? CA A PHE 252 ? ? CB A PHE 252 ? ? 99.46 110.60 -11.14 1.80 N 6 1 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.13 111.50 8.63 1.30 N 7 1 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.12 120.30 3.82 0.50 N 8 2 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.25 111.50 8.75 1.30 N 9 2 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.16 120.30 3.86 0.50 N 10 2 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.14 120.30 3.84 0.50 N 11 2 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.26 111.50 8.76 1.30 N 12 2 CA A VAL 245 ? ? CB A VAL 245 ? ? CG1 A VAL 245 ? ? 120.36 110.90 9.46 1.50 N 13 2 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.11 111.50 8.61 1.30 N 14 2 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.21 120.30 3.91 0.50 N 15 3 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.26 111.50 8.76 1.30 N 16 3 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.14 120.30 3.84 0.50 N 17 3 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.11 120.30 3.81 0.50 N 18 3 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.12 111.50 8.62 1.30 N 19 3 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.12 111.50 8.62 1.30 N 20 3 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.46 120.30 4.16 0.50 N 21 4 N A ASP 178 ? ? CA A ASP 178 ? ? CB A ASP 178 ? ? 98.61 110.60 -11.99 1.80 N 22 4 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.24 111.50 8.74 1.30 N 23 4 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.21 120.30 3.91 0.50 N 24 4 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.21 120.30 3.91 0.50 N 25 4 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.22 111.50 8.72 1.30 N 26 4 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.16 111.50 8.66 1.30 N 27 4 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.10 120.30 3.80 0.50 N 28 5 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.24 111.50 8.74 1.30 N 29 5 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.13 120.30 3.83 0.50 N 30 5 CA A THR 201 ? ? CB A THR 201 ? ? CG2 A THR 201 ? ? 120.86 112.40 8.46 1.40 N 31 5 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.19 120.30 3.89 0.50 N 32 5 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.23 111.50 8.73 1.30 N 33 5 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.11 111.50 8.61 1.30 N 34 5 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.11 120.30 3.81 0.50 N 35 6 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.24 111.50 8.74 1.30 N 36 6 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.21 120.30 3.91 0.50 N 37 6 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.21 120.30 3.91 0.50 N 38 6 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.08 111.50 8.58 1.30 N 39 6 CA A VAL 245 ? ? CB A VAL 245 ? ? CG2 A VAL 245 ? ? 120.32 110.90 9.42 1.50 N 40 6 CB A HIS 254 ? ? CA A HIS 254 ? ? C A HIS 254 ? ? 122.47 110.40 12.07 2.00 N 41 6 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.20 111.50 8.70 1.30 N 42 6 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.17 120.30 3.87 0.50 N 43 6 CB A ALA 265 ? ? CA A ALA 265 ? ? C A ALA 265 ? ? 121.26 110.10 11.16 1.50 N 44 7 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.22 111.50 8.72 1.30 N 45 7 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.17 120.30 3.87 0.50 N 46 7 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.04 120.30 3.74 0.50 N 47 7 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.19 111.50 8.69 1.30 N 48 7 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.16 111.50 8.66 1.30 N 49 7 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.21 120.30 3.91 0.50 N 50 8 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.36 111.50 8.86 1.30 N 51 8 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.06 120.30 3.76 0.50 N 52 8 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.07 120.30 3.77 0.50 N 53 8 N A LYS 236 ? ? CA A LYS 236 ? ? CB A LYS 236 ? ? 99.48 110.60 -11.12 1.80 N 54 8 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.17 111.50 8.67 1.30 N 55 8 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.19 111.50 8.69 1.30 N 56 8 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.11 120.30 3.81 0.50 N 57 9 N A ASP 178 ? ? CA A ASP 178 ? ? CB A ASP 178 ? ? 98.76 110.60 -11.84 1.80 N 58 9 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.25 111.50 8.75 1.30 N 59 9 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.08 120.30 3.78 0.50 N 60 9 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.17 120.30 3.87 0.50 N 61 9 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.17 111.50 8.67 1.30 N 62 9 N A PHE 252 ? ? CA A PHE 252 ? ? CB A PHE 252 ? ? 99.40 110.60 -11.20 1.80 N 63 9 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.13 111.50 8.63 1.30 N 64 9 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.11 120.30 3.81 0.50 N 65 10 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.24 111.50 8.74 1.30 N 66 10 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.12 120.30 3.82 0.50 N 67 10 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.06 120.30 3.76 0.50 N 68 10 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.14 111.50 8.64 1.30 N 69 10 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.11 111.50 8.61 1.30 N 70 10 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.14 120.30 3.84 0.50 N 71 11 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.27 111.50 8.77 1.30 N 72 11 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.13 120.30 3.83 0.50 N 73 11 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.22 120.30 3.92 0.50 N 74 11 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.15 111.50 8.65 1.30 N 75 11 N A PHE 252 ? ? CA A PHE 252 ? ? CB A PHE 252 ? ? 98.90 110.60 -11.70 1.80 N 76 11 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.16 111.50 8.66 1.30 N 77 11 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.08 120.30 3.78 0.50 N 78 12 CB A LEU 142 ? ? CG A LEU 142 ? ? CD2 A LEU 142 ? ? 121.69 111.00 10.69 1.70 N 79 12 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.19 111.50 8.69 1.30 N 80 12 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.14 120.30 3.84 0.50 N 81 12 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.14 120.30 3.84 0.50 N 82 12 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.12 111.50 8.62 1.30 N 83 12 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.14 111.50 8.64 1.30 N 84 12 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.20 120.30 3.90 0.50 N 85 13 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.26 111.50 8.76 1.30 N 86 13 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.20 120.30 3.90 0.50 N 87 13 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.12 120.30 3.82 0.50 N 88 13 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.19 111.50 8.69 1.30 N 89 13 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.15 111.50 8.65 1.30 N 90 13 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.25 120.30 3.95 0.50 N 91 14 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.22 111.50 8.72 1.30 N 92 14 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.23 120.30 3.93 0.50 N 93 14 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.12 120.30 3.82 0.50 N 94 14 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.23 111.50 8.73 1.30 N 95 14 N A PHE 252 ? ? CA A PHE 252 ? ? CB A PHE 252 ? ? 98.81 110.60 -11.79 1.80 N 96 14 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.16 111.50 8.66 1.30 N 97 14 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.23 120.30 3.93 0.50 N 98 15 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.42 111.50 8.92 1.30 N 99 15 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.23 120.30 3.93 0.50 N 100 15 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.11 120.30 3.81 0.50 N 101 15 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.18 111.50 8.68 1.30 N 102 15 N A PHE 252 ? ? CA A PHE 252 ? ? CB A PHE 252 ? ? 99.03 110.60 -11.57 1.80 N 103 15 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.16 111.50 8.66 1.30 N 104 15 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.23 120.30 3.93 0.50 N 105 16 CA A VAL 160 ? ? CB A VAL 160 ? ? CG1 A VAL 160 ? ? 120.80 110.90 9.90 1.50 N 106 16 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.28 111.50 8.78 1.30 N 107 16 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.09 120.30 3.79 0.50 N 108 16 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.06 120.30 3.76 0.50 N 109 16 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.21 111.50 8.71 1.30 N 110 16 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.17 111.50 8.67 1.30 N 111 16 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.17 120.30 3.87 0.50 N 112 17 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.28 111.50 8.78 1.30 N 113 17 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.16 120.30 3.86 0.50 N 114 17 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.11 120.30 3.81 0.50 N 115 17 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.09 111.50 8.59 1.30 N 116 17 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.22 111.50 8.72 1.30 N 117 17 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.11 120.30 3.81 0.50 N 118 18 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.22 111.50 8.72 1.30 N 119 18 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.19 120.30 3.89 0.50 N 120 18 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.20 120.30 3.90 0.50 N 121 18 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.06 111.50 8.56 1.30 N 122 18 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.10 111.50 8.60 1.30 N 123 18 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.13 120.30 3.83 0.50 N 124 19 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.32 111.50 8.82 1.30 N 125 19 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.13 120.30 3.83 0.50 N 126 19 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.17 120.30 3.87 0.50 N 127 19 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.24 111.50 8.74 1.30 N 128 19 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.13 111.50 8.63 1.30 N 129 19 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.29 120.30 3.99 0.50 N 130 20 ND1 A HIS 198 ? ? CE1 A HIS 198 ? ? NE2 A HIS 198 ? ? 120.24 111.50 8.74 1.30 N 131 20 NE A ARG 199 ? ? CZ A ARG 199 ? ? NH1 A ARG 199 ? ? 124.12 120.30 3.82 0.50 N 132 20 NE A ARG 233 ? ? CZ A ARG 233 ? ? NH1 A ARG 233 ? ? 124.36 120.30 4.06 0.50 N 133 20 ND1 A HIS 237 ? ? CE1 A HIS 237 ? ? NE2 A HIS 237 ? ? 120.20 111.50 8.70 1.30 N 134 20 ND1 A HIS 254 ? ? CE1 A HIS 254 ? ? NE2 A HIS 254 ? ? 120.15 111.50 8.65 1.30 N 135 20 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 124.29 120.30 3.99 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 156 ? ? 62.29 62.26 2 1 ILE A 163 ? ? -92.81 -70.41 3 1 ASP A 178 ? ? -111.91 76.70 4 1 LYS A 189 ? ? 73.51 71.65 5 1 ARG A 233 ? ? 58.72 -17.68 6 1 PHE A 234 ? ? -150.63 -57.00 7 1 HIS A 254 ? ? -115.86 -122.04 8 2 ASN A 156 ? ? 66.84 74.87 9 2 ILE A 163 ? ? -95.07 -73.07 10 2 MET A 173 ? ? 69.66 68.21 11 2 ASP A 178 ? ? -112.35 77.24 12 2 LYS A 189 ? ? 71.34 66.03 13 2 LYS A 200 ? ? 66.29 61.33 14 3 ASN A 156 ? ? 67.99 73.77 15 3 ASP A 178 ? ? -113.83 79.06 16 3 LYS A 189 ? ? 70.07 68.26 17 3 PHE A 252 ? ? -107.66 75.53 18 3 VAL A 255 ? ? 38.28 111.52 19 4 ASN A 156 ? ? 66.83 74.28 20 4 ILE A 163 ? ? -91.76 -66.62 21 4 ASP A 172 ? ? -122.31 -152.73 22 4 LYS A 189 ? ? 73.53 70.79 23 4 ASN A 207 ? ? 37.14 64.06 24 4 ILE A 240 ? ? -93.87 -76.09 25 4 PHE A 252 ? ? -105.13 73.07 26 4 HIS A 254 ? ? -120.05 -127.50 27 5 ASN A 156 ? ? 68.10 72.45 28 5 LYS A 189 ? ? 73.58 69.12 29 5 ARG A 233 ? ? 51.02 -96.81 30 5 ILE A 240 ? ? -81.02 -70.50 31 6 ASN A 156 ? ? 67.11 72.18 32 6 ILE A 163 ? ? -94.03 -69.94 33 6 LYS A 189 ? ? 71.40 72.76 34 6 HIS A 254 ? ? -112.20 -125.12 35 6 ALA A 265 ? ? -98.80 -132.87 36 6 GLU A 266 ? ? 61.00 85.00 37 7 ASN A 156 ? ? 64.84 72.65 38 7 ILE A 163 ? ? -102.95 -72.23 39 7 ASP A 172 ? ? -95.62 -149.94 40 7 LYS A 190 ? ? -97.08 -66.46 41 7 HIS A 198 ? ? -101.40 79.54 42 7 HIS A 254 ? ? -116.98 -124.49 43 8 ASN A 156 ? ? 67.94 71.54 44 8 ASP A 178 ? ? -108.87 79.03 45 8 LYS A 189 ? ? 76.03 76.43 46 8 ASN A 207 ? ? 34.22 63.57 47 8 ILE A 240 ? ? -92.02 -75.07 48 8 HIS A 254 ? ? -116.72 -122.30 49 8 GLU A 266 ? ? -106.30 75.45 50 9 ASN A 156 ? ? 68.68 68.70 51 9 ILE A 163 ? ? -91.22 -69.55 52 9 LYS A 190 ? ? -94.82 -68.18 53 9 HIS A 198 ? ? -108.95 79.44 54 9 ILE A 240 ? ? -94.00 -73.49 55 9 GLU A 266 ? ? -103.97 77.72 56 10 ASN A 156 ? ? 65.56 73.13 57 10 ILE A 163 ? ? -94.65 -70.62 58 10 ASP A 178 ? ? -113.24 75.82 59 10 LYS A 189 ? ? 69.54 72.49 60 10 HIS A 254 ? ? -109.10 -123.10 61 10 GLU A 266 ? ? 39.83 85.88 62 11 ASN A 156 ? ? 65.05 71.35 63 11 ILE A 163 ? ? -101.92 -71.19 64 11 LYS A 189 ? ? 75.23 72.60 65 11 PHE A 252 ? ? -104.71 63.91 66 11 HIS A 254 ? ? -120.40 -126.22 67 12 ASN A 156 ? ? 68.17 75.82 68 12 ILE A 163 ? ? -90.04 -69.57 69 12 LYS A 189 ? ? 68.57 67.08 70 12 LYS A 190 ? ? -95.81 -64.97 71 12 ASN A 207 ? ? 36.61 61.83 72 12 PHE A 252 ? ? -98.32 57.04 73 12 VAL A 255 ? ? -33.66 125.46 74 12 GLU A 266 ? ? -110.76 79.12 75 13 ASN A 156 ? ? 84.44 75.55 76 13 ILE A 163 ? ? -100.25 -69.75 77 13 ASP A 172 ? ? -129.34 -152.80 78 13 ASP A 178 ? ? -108.71 78.64 79 13 LYS A 189 ? ? 76.98 76.24 80 13 ASN A 207 ? ? 38.41 58.95 81 13 GLU A 266 ? ? -100.06 75.82 82 14 ASN A 156 ? ? 63.64 69.77 83 14 ILE A 163 ? ? -92.85 -69.23 84 14 LYS A 189 ? ? 76.27 68.55 85 14 ILE A 240 ? ? -92.53 -77.13 86 14 PHE A 252 ? ? -101.81 60.84 87 14 HIS A 254 ? ? -110.39 -122.50 88 15 LEU A 142 ? ? -162.31 95.06 89 15 ASN A 156 ? ? 67.06 71.37 90 15 ILE A 163 ? ? -89.84 -70.27 91 15 ASP A 178 ? ? -112.87 78.08 92 15 LYS A 189 ? ? 72.85 67.21 93 15 ILE A 240 ? ? -84.91 -71.92 94 15 PHE A 252 ? ? -101.47 62.88 95 15 HIS A 254 ? ? -119.95 -126.07 96 16 ASN A 156 ? ? 68.86 73.72 97 16 ILE A 163 ? ? -90.16 -69.17 98 16 ASP A 172 ? ? -118.95 -153.42 99 16 ASP A 178 ? ? -113.13 76.49 100 16 ASP A 188 ? ? -82.33 -105.30 101 16 LYS A 189 ? ? 158.96 42.13 102 16 VAL A 255 ? ? -28.98 128.02 103 17 ASN A 156 ? ? 70.40 77.94 104 17 ILE A 163 ? ? -98.93 -68.20 105 17 ASP A 172 ? ? -132.19 -152.99 106 17 ASP A 178 ? ? -113.21 77.72 107 17 LYS A 189 ? ? 70.98 69.30 108 17 PHE A 252 ? ? -103.75 75.37 109 17 HIS A 254 ? ? -160.48 119.90 110 17 VAL A 255 ? ? 46.71 111.60 111 18 ASN A 156 ? ? 69.44 74.05 112 18 ILE A 163 ? ? -116.00 -72.74 113 18 LEU A 171 ? ? -115.84 51.73 114 18 ASP A 178 ? ? -111.10 78.60 115 18 LYS A 189 ? ? 69.43 69.12 116 18 LYS A 190 ? ? -90.77 -64.01 117 18 VAL A 255 ? ? -30.39 125.60 118 18 GLU A 266 ? ? -102.14 74.13 119 19 ASN A 156 ? ? 66.95 73.16 120 19 ILE A 163 ? ? -95.58 -76.02 121 19 ASP A 172 ? ? -125.54 -153.65 122 19 ASP A 178 ? ? -114.54 76.56 123 19 LYS A 190 ? ? -95.63 -73.22 124 19 VAL A 255 ? ? 55.84 107.03 125 20 ASN A 156 ? ? 79.60 77.09 126 20 ILE A 163 ? ? -92.31 -72.57 127 20 LYS A 189 ? ? 73.73 69.43 128 20 HIS A 198 ? ? -103.15 70.12 129 20 VAL A 255 ? ? -34.87 133.83 130 20 GLU A 266 ? ? 52.26 77.32 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 TYR A 147 ? ? 0.100 'SIDE CHAIN' 2 12 TYR A 147 ? ? 0.063 'SIDE CHAIN' 3 18 TYR A 147 ? ? 0.069 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1BYN _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'FEWEST RESTRAINTS VIOLATIONS' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 307 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NACL' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 2D 1 2 1 '3D AND 4D HOMONUCLEAR' 1 3 1 HETERONUCLEAR 1 4 1 'TRIPLE RESONANCE EXPERIMENTS' 1 # _pdbx_nmr_refine.entry_id 1BYN _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Discover ? BIOSYM 1 'structure solution' Discover ? ? 2 'structure solution' NMRCHITECT ? ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TRP N N N N 305 TRP CA C N S 306 TRP C C N N 307 TRP O O N N 308 TRP CB C N N 309 TRP CG C Y N 310 TRP CD1 C Y N 311 TRP CD2 C Y N 312 TRP NE1 N Y N 313 TRP CE2 C Y N 314 TRP CE3 C Y N 315 TRP CZ2 C Y N 316 TRP CZ3 C Y N 317 TRP CH2 C Y N 318 TRP OXT O N N 319 TRP H H N N 320 TRP H2 H N N 321 TRP HA H N N 322 TRP HB2 H N N 323 TRP HB3 H N N 324 TRP HD1 H N N 325 TRP HE1 H N N 326 TRP HE3 H N N 327 TRP HZ2 H N N 328 TRP HZ3 H N N 329 TRP HH2 H N N 330 TRP HXT H N N 331 TYR N N N N 332 TYR CA C N S 333 TYR C C N N 334 TYR O O N N 335 TYR CB C N N 336 TYR CG C Y N 337 TYR CD1 C Y N 338 TYR CD2 C Y N 339 TYR CE1 C Y N 340 TYR CE2 C Y N 341 TYR CZ C Y N 342 TYR OH O N N 343 TYR OXT O N N 344 TYR H H N N 345 TYR H2 H N N 346 TYR HA H N N 347 TYR HB2 H N N 348 TYR HB3 H N N 349 TYR HD1 H N N 350 TYR HD2 H N N 351 TYR HE1 H N N 352 TYR HE2 H N N 353 TYR HH H N N 354 TYR HXT H N N 355 VAL N N N N 356 VAL CA C N S 357 VAL C C N N 358 VAL O O N N 359 VAL CB C N N 360 VAL CG1 C N N 361 VAL CG2 C N N 362 VAL OXT O N N 363 VAL H H N N 364 VAL H2 H N N 365 VAL HA H N N 366 VAL HB H N N 367 VAL HG11 H N N 368 VAL HG12 H N N 369 VAL HG13 H N N 370 VAL HG21 H N N 371 VAL HG22 H N N 372 VAL HG23 H N N 373 VAL HXT H N N 374 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'UNITY 500' _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1BYN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ #