data_1C05 # _entry.id 1C05 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1C05 RCSB RCSB009341 WWPDB D_1000009341 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1C06 _pdbx_database_related.details '16 CONFORMERS' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1C05 _pdbx_database_status.recvd_initial_deposition_date 1999-07-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Markus, M.A.' 1 'Gerstner, R.B.' 2 'Draper, D.E.' 3 'Torchia, D.A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Refining the overall structure and subdomain orientation of ribosomal protein S4 delta41 with dipolar couplings measured by NMR in uniaxial liquid crystalline phases. ; J.Mol.Biol. 292 375 387 1999 JMOBAK UK 0022-2836 0070 ? 10493882 10.1006/jmbi.1999.3061 1 ;The solution structure of ribosomal protein S4 delta 41 reveals two subdomains and a positively charged surface that may interact with RNA ; 'Embo J.' 17 4559 4571 1998 EMJODG UK 0261-4189 0897 ? ? 10.1093/emboj/17.16.4559 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Markus, M.A.' 1 primary 'Gerstner, R.B.' 2 primary 'Draper, D.E.' 3 primary 'Torchia, D.A.' 4 1 'Markus, M.A.' 5 1 'Gerstner, R.B.' 6 1 'Draper, D.E.' 7 1 'Torchia, D.A.' 8 # _cell.entry_id 1C05 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1C05 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RIBOSOMAL PROTEIN S4 DELTA 41' _entity.formula_weight 18624.359 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'S4 DELTA 41 (S4 RESIDUES 42-200)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKLSEYGLQLQEKQKLRHMYGVNERQFRKTFEEAGKMPGKHGENFMILLESRLDNLVYRLGLARTRRQARQLVTHGHILV DGSRVNIPSYRVKPGQTIAVREKSRNLQVIKEALEANNYIPDYLSFDPEKMEGTYTRLPERSELPAEINEALIVEFYSR ; _entity_poly.pdbx_seq_one_letter_code_can ;MKLSEYGLQLQEKQKLRHMYGVNERQFRKTFEEAGKMPGKHGENFMILLESRLDNLVYRLGLARTRRQARQLVTHGHILV DGSRVNIPSYRVKPGQTIAVREKSRNLQVIKEALEANNYIPDYLSFDPEKMEGTYTRLPERSELPAEINEALIVEFYSR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LEU n 1 4 SER n 1 5 GLU n 1 6 TYR n 1 7 GLY n 1 8 LEU n 1 9 GLN n 1 10 LEU n 1 11 GLN n 1 12 GLU n 1 13 LYS n 1 14 GLN n 1 15 LYS n 1 16 LEU n 1 17 ARG n 1 18 HIS n 1 19 MET n 1 20 TYR n 1 21 GLY n 1 22 VAL n 1 23 ASN n 1 24 GLU n 1 25 ARG n 1 26 GLN n 1 27 PHE n 1 28 ARG n 1 29 LYS n 1 30 THR n 1 31 PHE n 1 32 GLU n 1 33 GLU n 1 34 ALA n 1 35 GLY n 1 36 LYS n 1 37 MET n 1 38 PRO n 1 39 GLY n 1 40 LYS n 1 41 HIS n 1 42 GLY n 1 43 GLU n 1 44 ASN n 1 45 PHE n 1 46 MET n 1 47 ILE n 1 48 LEU n 1 49 LEU n 1 50 GLU n 1 51 SER n 1 52 ARG n 1 53 LEU n 1 54 ASP n 1 55 ASN n 1 56 LEU n 1 57 VAL n 1 58 TYR n 1 59 ARG n 1 60 LEU n 1 61 GLY n 1 62 LEU n 1 63 ALA n 1 64 ARG n 1 65 THR n 1 66 ARG n 1 67 ARG n 1 68 GLN n 1 69 ALA n 1 70 ARG n 1 71 GLN n 1 72 LEU n 1 73 VAL n 1 74 THR n 1 75 HIS n 1 76 GLY n 1 77 HIS n 1 78 ILE n 1 79 LEU n 1 80 VAL n 1 81 ASP n 1 82 GLY n 1 83 SER n 1 84 ARG n 1 85 VAL n 1 86 ASN n 1 87 ILE n 1 88 PRO n 1 89 SER n 1 90 TYR n 1 91 ARG n 1 92 VAL n 1 93 LYS n 1 94 PRO n 1 95 GLY n 1 96 GLN n 1 97 THR n 1 98 ILE n 1 99 ALA n 1 100 VAL n 1 101 ARG n 1 102 GLU n 1 103 LYS n 1 104 SER n 1 105 ARG n 1 106 ASN n 1 107 LEU n 1 108 GLN n 1 109 VAL n 1 110 ILE n 1 111 LYS n 1 112 GLU n 1 113 ALA n 1 114 LEU n 1 115 GLU n 1 116 ALA n 1 117 ASN n 1 118 ASN n 1 119 TYR n 1 120 ILE n 1 121 PRO n 1 122 ASP n 1 123 TYR n 1 124 LEU n 1 125 SER n 1 126 PHE n 1 127 ASP n 1 128 PRO n 1 129 GLU n 1 130 LYS n 1 131 MET n 1 132 GLU n 1 133 GLY n 1 134 THR n 1 135 TYR n 1 136 THR n 1 137 ARG n 1 138 LEU n 1 139 PRO n 1 140 GLU n 1 141 ARG n 1 142 SER n 1 143 GLU n 1 144 LEU n 1 145 PRO n 1 146 ALA n 1 147 GLU n 1 148 ILE n 1 149 ASN n 1 150 GLU n 1 151 ALA n 1 152 LEU n 1 153 ILE n 1 154 VAL n 1 155 GLU n 1 156 PHE n 1 157 TYR n 1 158 SER n 1 159 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Geobacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus stearothermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1422 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET13A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RS4_BACST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P81288 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1C05 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 159 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P81288 _struct_ref_seq.db_align_beg 41 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 198 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 159 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 3 1 3D_13C-separated_NOESY 3 3 1 4D_13C-separated_NOESY 4 1 1 HNHA 5 5 2 'IPAP 15N HSQC' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 310 1 5.4 '250 mM KCl' atm K 2 310 1 6.0 '80 mM KCl' atm K 3 310 1 6.5 '300 mM KCl' atm K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.1 mM S4 delta 41, U-15N,13C; 20 mM d4-acetate pH 5.4, 250 mM KCl, 0.1 mM sodium azide' '94% H2O, 6% D2O' 2 '0.8 mM S4 delta 41, U-15N; 20 mM d4-acetate pH 5.4, 250 mM KCl, 0.1 mM sodium azide' '94% H2O, 6% D2O' 3 '0.45 mM S4 delta 41, U-15N,13C; 20 mM d4-acetate pH 5.4, 250 mM KCl' '99.9% D2O' 4 '0.62 mM S4 delta 41, 10% 13C; 20 mM d4-acetate pH 5.4, 250 mM KCl' '99.9% D2O' 5 '0.10 mM S4 delta 41, U-15N; 7 mM d4-acetate pH 5.4, 7 mM KH2PO4 pH 6.5, 80 mM KCl, 5% w/v DMPC:DHPC (3:1)' '93% H2O/7% D2O' 6 ;0.21 mM S4 delta 41, U-15N, 85% 2H; 15N,13C,1H methionine; epsilon-13C, 1H tyrsoine; beta,gamma,delta 2H proline; 10 mM KH2PO4 pH 6.5, 300 mM KCl, 0.2 mM sodium azide, 2.5 mg/ml Pf1 ; '94% H2O, 6% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 750 2 ? Bruker DMX 500 # _pdbx_nmr_refine.entry_id 1C05 _pdbx_nmr_refine.method 'hybrid DGSA protocol without the dipolar coupling restraints followed by additional SA with the dipolar coupling restraints add' _pdbx_nmr_refine.details 'SUMMARY OF RESTRAINTS: 2170 NOE, 86 HYDROGEN BOND, 114 DIHEDRAL ANGLE, AND 101 DIPOLAR COUPLINGS' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1C05 _pdbx_nmr_details.text ;This structure was determined with NOE restraints from multidimensional heteronuclear experiments, dihedral angle restraints based on measurements of scalar coupling constants, and dipolar coupling restraints measured on samples in partially aligned phases. ; # _pdbx_nmr_ensemble.entry_id 1C05 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1C05 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' XWINNMR 2.5 BRUKER 1 'structure solution' NMRPIPE 1.7 DELAGLIO 2 'structure solution' PIPP 4.2.8 GARRETT 3 refinement X-PLOR '3.8, 4.0' BRUNGER 4 # _exptl.entry_id 1C05 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1C05 _struct.title 'SOLUTION STRUCTURE OF RIBOSOMAL PROTEIN S4 DELTA 41, REFINED WITH DIPOLAR COUPLINGS (MINIMIZED AVERAGE STRUCTURE)' _struct.pdbx_descriptor 'RIBOSOMAL PROTEIN S4 DELTA 41' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1C05 _struct_keywords.pdbx_keywords RIBOSOME _struct_keywords.text 'TWO SUBDOMAINS, UNIQUE TOPOLOGY, POSSIBLE HELIX-TURN-HELIX MOTIF, RIBOSOME' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? MET A 19 ? SER A 4 MET A 19 1 ? 16 HELX_P HELX_P2 2 ASN A 23 ? GLY A 35 ? ASN A 23 GLY A 35 1 ? 13 HELX_P HELX_P3 3 LYS A 40 ? ARG A 52 ? LYS A 40 ARG A 52 1 ? 13 HELX_P HELX_P4 4 ARG A 52 ? LEU A 60 ? ARG A 52 LEU A 60 1 ? 9 HELX_P HELX_P5 5 THR A 65 ? HIS A 75 ? THR A 65 HIS A 75 1 ? 11 HELX_P HELX_P6 6 LEU A 107 ? ALA A 116 ? LEU A 107 ALA A 116 1 ? 10 HELX_P HELX_P7 7 GLU A 150 ? ARG A 159 ? GLU A 150 ARG A 159 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 83 ? ARG A 84 ? SER A 83 ARG A 84 A 2 ILE A 78 ? VAL A 80 ? ILE A 78 VAL A 80 A 3 THR A 97 ? VAL A 100 ? THR A 97 VAL A 100 A 4 GLU A 132 ? TYR A 135 ? GLU A 132 TYR A 135 A 5 LEU A 124 ? ASP A 127 ? LEU A 124 ASP A 127 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 83 ? O SER A 83 N VAL A 80 ? N VAL A 80 A 2 3 N LEU A 79 ? N LEU A 79 O ALA A 99 ? O ALA A 99 A 3 4 O ILE A 98 ? O ILE A 98 N GLY A 133 ? N GLY A 133 A 4 5 N THR A 134 ? N THR A 134 O SER A 125 ? O SER A 125 # _database_PDB_matrix.entry_id 1C05 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1C05 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ARG 159 159 159 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-09-29 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_assembly 2 4 'Structure model' pdbx_struct_oper_list 3 4 'Structure model' struct_conf 4 4 'Structure model' struct_conf_type # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TYR 20 ? ? HH22 A ARG 52 ? ? 1.50 2 1 H A LEU 79 ? ? O A ALA 99 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 16 ? ? -48.42 -16.45 2 1 MET A 19 ? ? -69.63 -90.88 3 1 PHE A 31 ? ? -74.00 -76.82 4 1 GLU A 32 ? ? -48.97 -13.60 5 1 LYS A 40 ? ? 52.34 102.38 6 1 LEU A 60 ? ? -57.65 -103.55 7 1 ASP A 81 ? ? 45.17 20.62 8 1 TYR A 90 ? ? -55.62 179.53 9 1 PRO A 94 ? ? -36.04 147.65 10 1 GLU A 102 ? ? -46.50 -78.44 11 1 SER A 104 ? ? -98.66 48.14 12 1 ALA A 116 ? ? -63.93 3.55 13 1 ASN A 118 ? ? -157.51 26.21 14 1 TYR A 119 ? ? -178.65 88.92 15 1 PRO A 121 ? ? -42.24 172.50 16 1 SER A 142 ? ? -55.06 -0.51 17 1 PRO A 145 ? ? -36.28 120.02 #