data_1C0N # _entry.id 1C0N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1C0N RCSB RCSB009357 WWPDB D_1000009357 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1C0N _pdbx_database_status.recvd_initial_deposition_date 1999-07-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fujii, T.' 1 'Maeda, M.' 2 'Mihara, H.' 3 'Kurihara, T.' 4 'Esaki, N.' 5 'Hata, Y.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of a NifS homologue: X-ray structure analysis of CsdB, an Escherichia coli counterpart of mammalian selenocysteine lyase' Biochemistry 39 1263 1273 2000 BICHAW US 0006-2960 0033 ? 10684605 10.1021/bi991732a 1 ;A nifS-like Gene, csdB, Encodes an Escherichia coli Counterpart of Mammalian Selenocysteine Lyase. GENE CLONING, PURIFICATION, CHARACTERIZATION AND PRELIMINARY X-RAY CRYSTALLOGRAPHIC STUDIES ; J.Biol.Chem. 274 14768 14772 1999 JBCHA3 US 0021-9258 0071 ? ? 10.1074/jbc.274.21.14768 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Fujii, T.' 1 primary 'Maeda, M.' 2 primary 'Mihara, H.' 3 primary 'Kurihara, T.' 4 primary 'Esaki, N.' 5 primary 'Hata, Y.' 6 1 'Mihara, H.' 7 1 'Maeda, M.' 8 1 'Fujii, T.' 9 1 'Kurihara, T.' 10 1 'Hata, Y.' 11 1 'Esaki, N.' 12 # _cell.entry_id 1C0N _cell.length_a 128.1 _cell.length_b 128.1 _cell.length_c 137.0 _cell.angle_alpha 90.0 _cell.angle_beta 90.0 _cell.angle_gamma 90.0 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1C0N _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (CSDB PROTEIN)' 44077.035 1 ? ? ? ? 2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE" 247.142 1 ? ? ? ? 3 non-polymer syn 'ACETIC ACID' 60.052 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIFSVDAVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHAGAHTLSAQATEKMENVRKRASLFI NARSAEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTL FDAATRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKE ALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESV PDLTLYGPQARLGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQR IHRLLG ; _entity_poly.pdbx_seq_one_letter_code_can ;MIFSVDAVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHAGAHTLSAQATEKMENVRKRASLFI NARSAEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTL FDAATRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGILYVKE ALLQEMPPWEGGGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESV PDLTLYGPQARLGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQR IHRLLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 PHE n 1 4 SER n 1 5 VAL n 1 6 ASP n 1 7 ALA n 1 8 VAL n 1 9 ARG n 1 10 ALA n 1 11 ASP n 1 12 PHE n 1 13 PRO n 1 14 VAL n 1 15 LEU n 1 16 SER n 1 17 ARG n 1 18 GLU n 1 19 VAL n 1 20 ASN n 1 21 GLY n 1 22 LEU n 1 23 PRO n 1 24 LEU n 1 25 ALA n 1 26 TYR n 1 27 LEU n 1 28 ASP n 1 29 SER n 1 30 ALA n 1 31 ALA n 1 32 SER n 1 33 ALA n 1 34 GLN n 1 35 LYS n 1 36 PRO n 1 37 SER n 1 38 GLN n 1 39 VAL n 1 40 ILE n 1 41 ASP n 1 42 ALA n 1 43 GLU n 1 44 ALA n 1 45 GLU n 1 46 PHE n 1 47 TYR n 1 48 ARG n 1 49 HIS n 1 50 GLY n 1 51 TYR n 1 52 ALA n 1 53 ALA n 1 54 VAL n 1 55 HIS n 1 56 ALA n 1 57 GLY n 1 58 ALA n 1 59 HIS n 1 60 THR n 1 61 LEU n 1 62 SER n 1 63 ALA n 1 64 GLN n 1 65 ALA n 1 66 THR n 1 67 GLU n 1 68 LYS n 1 69 MET n 1 70 GLU n 1 71 ASN n 1 72 VAL n 1 73 ARG n 1 74 LYS n 1 75 ARG n 1 76 ALA n 1 77 SER n 1 78 LEU n 1 79 PHE n 1 80 ILE n 1 81 ASN n 1 82 ALA n 1 83 ARG n 1 84 SER n 1 85 ALA n 1 86 GLU n 1 87 GLU n 1 88 LEU n 1 89 VAL n 1 90 PHE n 1 91 VAL n 1 92 ARG n 1 93 GLY n 1 94 THR n 1 95 THR n 1 96 GLU n 1 97 GLY n 1 98 ILE n 1 99 ASN n 1 100 LEU n 1 101 VAL n 1 102 ALA n 1 103 ASN n 1 104 SER n 1 105 TRP n 1 106 GLY n 1 107 ASN n 1 108 SER n 1 109 ASN n 1 110 VAL n 1 111 ARG n 1 112 ALA n 1 113 GLY n 1 114 ASP n 1 115 ASN n 1 116 ILE n 1 117 ILE n 1 118 ILE n 1 119 SER n 1 120 GLN n 1 121 MET n 1 122 GLU n 1 123 HIS n 1 124 HIS n 1 125 ALA n 1 126 ASN n 1 127 ILE n 1 128 VAL n 1 129 PRO n 1 130 TRP n 1 131 GLN n 1 132 MET n 1 133 LEU n 1 134 CYS n 1 135 ALA n 1 136 ARG n 1 137 VAL n 1 138 GLY n 1 139 ALA n 1 140 GLU n 1 141 LEU n 1 142 ARG n 1 143 VAL n 1 144 ILE n 1 145 PRO n 1 146 LEU n 1 147 ASN n 1 148 PRO n 1 149 ASP n 1 150 GLY n 1 151 THR n 1 152 LEU n 1 153 GLN n 1 154 LEU n 1 155 GLU n 1 156 THR n 1 157 LEU n 1 158 PRO n 1 159 THR n 1 160 LEU n 1 161 PHE n 1 162 ASP n 1 163 ALA n 1 164 ALA n 1 165 THR n 1 166 ARG n 1 167 LEU n 1 168 LEU n 1 169 ALA n 1 170 ILE n 1 171 THR n 1 172 HIS n 1 173 VAL n 1 174 SER n 1 175 ASN n 1 176 VAL n 1 177 LEU n 1 178 GLY n 1 179 THR n 1 180 GLU n 1 181 ASN n 1 182 PRO n 1 183 LEU n 1 184 ALA n 1 185 GLU n 1 186 MET n 1 187 ILE n 1 188 THR n 1 189 LEU n 1 190 ALA n 1 191 HIS n 1 192 GLN n 1 193 HIS n 1 194 GLY n 1 195 ALA n 1 196 LYS n 1 197 VAL n 1 198 LEU n 1 199 VAL n 1 200 ASP n 1 201 GLY n 1 202 ALA n 1 203 GLN n 1 204 ALA n 1 205 VAL n 1 206 MET n 1 207 HIS n 1 208 HIS n 1 209 PRO n 1 210 VAL n 1 211 ASP n 1 212 VAL n 1 213 GLN n 1 214 ALA n 1 215 LEU n 1 216 ASP n 1 217 CYS n 1 218 ASP n 1 219 PHE n 1 220 TYR n 1 221 VAL n 1 222 PHE n 1 223 SER n 1 224 GLY n 1 225 HIS n 1 226 LYS n 1 227 LEU n 1 228 TYR n 1 229 GLY n 1 230 PRO n 1 231 THR n 1 232 GLY n 1 233 ILE n 1 234 GLY n 1 235 ILE n 1 236 LEU n 1 237 TYR n 1 238 VAL n 1 239 LYS n 1 240 GLU n 1 241 ALA n 1 242 LEU n 1 243 LEU n 1 244 GLN n 1 245 GLU n 1 246 MET n 1 247 PRO n 1 248 PRO n 1 249 TRP n 1 250 GLU n 1 251 GLY n 1 252 GLY n 1 253 GLY n 1 254 SER n 1 255 MET n 1 256 ILE n 1 257 ALA n 1 258 THR n 1 259 VAL n 1 260 SER n 1 261 LEU n 1 262 SER n 1 263 GLU n 1 264 GLY n 1 265 THR n 1 266 THR n 1 267 TRP n 1 268 THR n 1 269 LYS n 1 270 ALA n 1 271 PRO n 1 272 TRP n 1 273 ARG n 1 274 PHE n 1 275 GLU n 1 276 ALA n 1 277 GLY n 1 278 THR n 1 279 PRO n 1 280 ASN n 1 281 THR n 1 282 GLY n 1 283 GLY n 1 284 ILE n 1 285 ILE n 1 286 GLY n 1 287 LEU n 1 288 GLY n 1 289 ALA n 1 290 ALA n 1 291 LEU n 1 292 GLU n 1 293 TYR n 1 294 VAL n 1 295 SER n 1 296 ALA n 1 297 LEU n 1 298 GLY n 1 299 LEU n 1 300 ASN n 1 301 ASN n 1 302 ILE n 1 303 ALA n 1 304 GLU n 1 305 TYR n 1 306 GLU n 1 307 GLN n 1 308 ASN n 1 309 LEU n 1 310 MET n 1 311 HIS n 1 312 TYR n 1 313 ALA n 1 314 LEU n 1 315 SER n 1 316 GLN n 1 317 LEU n 1 318 GLU n 1 319 SER n 1 320 VAL n 1 321 PRO n 1 322 ASP n 1 323 LEU n 1 324 THR n 1 325 LEU n 1 326 TYR n 1 327 GLY n 1 328 PRO n 1 329 GLN n 1 330 ALA n 1 331 ARG n 1 332 LEU n 1 333 GLY n 1 334 VAL n 1 335 ILE n 1 336 ALA n 1 337 PHE n 1 338 ASN n 1 339 LEU n 1 340 GLY n 1 341 ALA n 1 342 HIS n 1 343 HIS n 1 344 ALA n 1 345 TYR n 1 346 ASP n 1 347 VAL n 1 348 GLY n 1 349 SER n 1 350 PHE n 1 351 LEU n 1 352 ASP n 1 353 ASN n 1 354 TYR n 1 355 GLY n 1 356 ILE n 1 357 ALA n 1 358 VAL n 1 359 ARG n 1 360 THR n 1 361 GLY n 1 362 HIS n 1 363 HIS n 1 364 CYS n 1 365 ALA n 1 366 MET n 1 367 PRO n 1 368 LEU n 1 369 MET n 1 370 ALA n 1 371 TYR n 1 372 TYR n 1 373 ASN n 1 374 VAL n 1 375 PRO n 1 376 ALA n 1 377 MET n 1 378 CYS n 1 379 ARG n 1 380 ALA n 1 381 SER n 1 382 LEU n 1 383 ALA n 1 384 MET n 1 385 TYR n 1 386 ASN n 1 387 THR n 1 388 HIS n 1 389 GLU n 1 390 GLU n 1 391 VAL n 1 392 ASP n 1 393 ARG n 1 394 LEU n 1 395 VAL n 1 396 THR n 1 397 GLY n 1 398 LEU n 1 399 GLN n 1 400 ARG n 1 401 ILE n 1 402 HIS n 1 403 ARG n 1 404 LEU n 1 405 LEU n 1 406 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PCSDB _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SUFS_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P77444 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1C0N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 406 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P77444 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 406 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 406 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACY non-polymer . 'ACETIC ACID' ? 'C2 H4 O2' 60.052 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLP non-polymer . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P' 247.142 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1C0N _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.pdbx_details 'sodium acetate, pottasium phosphate, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 293.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 1997-06-17 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU300' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1C0N _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 93.6 _reflns.d_resolution_high 2.8 _reflns.number_obs 27061 _reflns.number_all 27061 _reflns.percent_possible_obs 94.2 _reflns.pdbx_Rmerge_I_obs 0.0720000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 9.62 _reflns.B_iso_Wilson_estimate 44.1 _reflns.pdbx_redundancy 2.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 3.0 _reflns_shell.percent_possible_all 88.5 _reflns_shell.Rmerge_I_obs 0.2160000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 4641 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1C0N _refine.ls_number_reflns_obs 22429 _refine.ls_number_reflns_all 22429 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 2.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1900000 _refine.ls_R_factor_all 0.1900000 _refine.ls_R_factor_R_work 0.1870000 _refine.ls_R_factor_R_free 0.2390000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1090 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.overall_SU_ML ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_R_Free_selection_details ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3083 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3102 _refine_hist.d_res_high 2.8 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.003 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 0.821 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1C0N _struct.title 'CSDB PROTEIN, NIFS HOMOLOGUE' _struct.pdbx_descriptor 'CSDB PROTEIN, NIFS HOMOLOGUE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1C0N _struct_keywords.pdbx_keywords LYASE _struct_keywords.text 'ALPHA/BETA FOLD, LYASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? ALA A 10 ? SER A 4 ALA A 10 1 ? 7 HELX_P HELX_P2 2 ASP A 11 ? ARG A 17 ? ASP A 11 ARG A 17 5 ? 7 HELX_P HELX_P3 3 PRO A 36 ? GLY A 50 ? PRO A 36 GLY A 50 1 ? 15 HELX_P HELX_P4 4 HIS A 59 ? ILE A 80 ? HIS A 59 ILE A 80 1 ? 22 HELX_P HELX_P5 5 SER A 84 ? GLU A 86 ? SER A 84 GLU A 86 5 ? 3 HELX_P HELX_P6 6 GLY A 93 ? TRP A 105 ? GLY A 93 TRP A 105 1 ? 13 HELX_P HELX_P7 7 GLY A 106 ? ASN A 109 ? GLY A 106 ASN A 109 5 ? 4 HELX_P HELX_P8 8 HIS A 123 ? ASN A 126 ? HIS A 123 ASN A 126 5 ? 4 HELX_P HELX_P9 9 ILE A 127 ? GLY A 138 ? ILE A 127 GLY A 138 1 ? 12 HELX_P HELX_P10 10 GLN A 153 ? LEU A 157 ? GLN A 153 LEU A 157 5 ? 5 HELX_P HELX_P11 11 PRO A 182 ? HIS A 193 ? PRO A 182 HIS A 193 1 ? 12 HELX_P HELX_P12 12 ASP A 211 ? ASP A 216 ? ASP A 211 ASP A 216 1 ? 6 HELX_P HELX_P13 13 LYS A 239 ? GLN A 244 ? LYS A 239 GLN A 244 1 ? 6 HELX_P HELX_P14 14 PRO A 271 ? GLU A 275 ? PRO A 271 GLU A 275 5 ? 5 HELX_P HELX_P15 15 ASN A 280 ? GLY A 298 ? ASN A 280 GLY A 298 1 ? 19 HELX_P HELX_P16 16 GLY A 298 ? LEU A 317 ? GLY A 298 LEU A 317 1 ? 20 HELX_P HELX_P17 17 HIS A 343 ? TYR A 354 ? HIS A 343 TYR A 354 1 ? 12 HELX_P HELX_P18 18 ALA A 365 ? TYR A 372 ? ALA A 365 TYR A 372 1 ? 8 HELX_P HELX_P19 19 THR A 387 ? GLY A 406 ? THR A 387 GLY A 406 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 226 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id PLP _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C4A _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 226 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PLP _struct_conn.ptnr2_auth_seq_id 500 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.369 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 270 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 270 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 271 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 271 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.15 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 7 ? C ? 2 ? D ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? parallel B 6 7 ? parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel D 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 25 ? TYR A 26 ? ALA A 25 TYR A 26 A 2 ILE A 356 ? ALA A 357 ? ILE A 356 ALA A 357 B 1 LEU A 88 ? VAL A 91 ? LEU A 88 VAL A 91 B 2 GLY A 234 ? VAL A 238 ? GLY A 234 VAL A 238 B 3 PHE A 219 ? SER A 223 ? PHE A 219 SER A 223 B 4 LYS A 196 ? ASP A 200 ? LYS A 196 ASP A 200 B 5 THR A 165 ? THR A 171 ? THR A 165 THR A 171 B 6 ASN A 115 ? SER A 119 ? ASN A 115 SER A 119 B 7 GLU A 140 ? ILE A 144 ? GLU A 140 ILE A 144 C 1 ILE A 256 ? SER A 260 ? ILE A 256 SER A 260 C 2 GLY A 264 ? TRP A 267 ? GLY A 264 TRP A 267 D 1 LEU A 323 ? TYR A 326 ? LEU A 323 TYR A 326 D 2 VAL A 334 ? LEU A 339 ? VAL A 334 LEU A 339 D 3 MET A 377 ? SER A 381 ? MET A 377 SER A 381 D 4 ARG A 359 ? GLY A 361 ? ARG A 359 GLY A 361 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 25 ? O ALA A 25 N ALA A 357 ? N ALA A 357 B 1 2 O VAL A 91 ? O VAL A 91 N GLY A 234 ? N GLY A 234 B 2 3 N TYR A 237 ? N TYR A 237 O TYR A 220 ? O TYR A 220 B 3 4 N PHE A 219 ? N PHE A 219 O VAL A 197 ? O VAL A 197 B 4 5 N LYS A 196 ? N LYS A 196 O ARG A 166 ? O ARG A 166 B 5 6 N ARG A 166 ? N ARG A 166 O ASN A 115 ? O ASN A 115 B 6 7 N ILE A 116 ? N ILE A 116 O GLU A 140 ? O GLU A 140 C 1 2 O SER A 260 ? O SER A 260 N GLY A 264 ? N GLY A 264 D 1 2 N TYR A 326 ? N TYR A 326 O ALA A 336 ? O ALA A 336 D 2 3 O PHE A 337 ? O PHE A 337 N CYS A 378 ? N CYS A 378 D 3 4 N ARG A 379 ? N ARG A 379 O ARG A 359 ? O ARG A 359 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PLP A 500' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACY A 550' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 THR A 94 ? THR A 94 . ? 1_555 ? 2 AC1 10 THR A 95 ? THR A 95 . ? 1_555 ? 3 AC1 10 HIS A 123 ? HIS A 123 . ? 1_555 ? 4 AC1 10 ASP A 200 ? ASP A 200 . ? 1_555 ? 5 AC1 10 ALA A 202 ? ALA A 202 . ? 1_555 ? 6 AC1 10 GLN A 203 ? GLN A 203 . ? 1_555 ? 7 AC1 10 SER A 223 ? SER A 223 . ? 1_555 ? 8 AC1 10 HIS A 225 ? HIS A 225 . ? 1_555 ? 9 AC1 10 LYS A 226 ? LYS A 226 . ? 1_555 ? 10 AC1 10 THR A 278 ? THR A 278 . ? 7_555 ? 11 AC2 4 ALA A 31 ? ALA A 31 . ? 1_555 ? 12 AC2 4 ASN A 175 ? ASN A 175 . ? 1_555 ? 13 AC2 4 ARG A 359 ? ARG A 359 . ? 1_555 ? 14 AC2 4 ARG A 379 ? ARG A 379 . ? 1_555 ? # _database_PDB_matrix.entry_id 1C0N _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1C0N _atom_sites.fract_transf_matrix[1][1] 0.007806 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007806 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007299 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ILE 2 2 ? ? ? A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 TRP 130 130 130 TRP TRP A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 MET 132 132 132 MET MET A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 CYS 134 134 134 CYS CYS A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 GLU 185 185 185 GLU GLU A . n A 1 186 MET 186 186 186 MET MET A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 THR 188 188 188 THR THR A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 HIS 191 191 191 HIS HIS A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 HIS 193 193 193 HIS HIS A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 ASP 200 200 200 ASP ASP A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 ALA 204 204 204 ALA ALA A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 MET 206 206 206 MET MET A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 HIS 208 208 208 HIS HIS A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 GLN 213 213 213 GLN GLN A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 CYS 217 217 217 CYS CYS A . n A 1 218 ASP 218 218 218 ASP ASP A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 TYR 220 220 220 TYR TYR A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 PHE 222 222 222 PHE PHE A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 HIS 225 225 225 HIS HIS A . n A 1 226 LYS 226 226 226 LYS LYS A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 TYR 228 228 228 TYR TYR A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 THR 231 231 231 THR THR A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 GLY 234 234 234 GLY GLY A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 TYR 237 237 237 TYR TYR A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 ALA 241 241 241 ALA ALA A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 GLN 244 244 244 GLN GLN A . n A 1 245 GLU 245 245 245 GLU GLU A . n A 1 246 MET 246 246 246 MET MET A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 TRP 249 249 249 TRP TRP A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 GLY 252 252 252 GLY GLY A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 SER 254 254 254 SER SER A . n A 1 255 MET 255 255 255 MET MET A . n A 1 256 ILE 256 256 256 ILE ILE A . n A 1 257 ALA 257 257 257 ALA ALA A . n A 1 258 THR 258 258 258 THR THR A . n A 1 259 VAL 259 259 259 VAL VAL A . n A 1 260 SER 260 260 260 SER SER A . n A 1 261 LEU 261 261 261 LEU LEU A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 THR 265 265 265 THR THR A . n A 1 266 THR 266 266 266 THR THR A . n A 1 267 TRP 267 267 267 TRP TRP A . n A 1 268 THR 268 268 268 THR THR A . n A 1 269 LYS 269 269 269 LYS LYS A . n A 1 270 ALA 270 270 270 ALA ALA A . n A 1 271 PRO 271 271 271 PRO PRO A . n A 1 272 TRP 272 272 272 TRP TRP A . n A 1 273 ARG 273 273 273 ARG ARG A . n A 1 274 PHE 274 274 274 PHE PHE A . n A 1 275 GLU 275 275 275 GLU GLU A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 THR 278 278 278 THR THR A . n A 1 279 PRO 279 279 279 PRO PRO A . n A 1 280 ASN 280 280 280 ASN ASN A . n A 1 281 THR 281 281 281 THR THR A . n A 1 282 GLY 282 282 282 GLY GLY A . n A 1 283 GLY 283 283 283 GLY GLY A . n A 1 284 ILE 284 284 284 ILE ILE A . n A 1 285 ILE 285 285 285 ILE ILE A . n A 1 286 GLY 286 286 286 GLY GLY A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 GLY 288 288 288 GLY GLY A . n A 1 289 ALA 289 289 289 ALA ALA A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 TYR 293 293 293 TYR TYR A . n A 1 294 VAL 294 294 294 VAL VAL A . n A 1 295 SER 295 295 295 SER SER A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 LEU 297 297 297 LEU LEU A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 LEU 299 299 299 LEU LEU A . n A 1 300 ASN 300 300 300 ASN ASN A . n A 1 301 ASN 301 301 301 ASN ASN A . n A 1 302 ILE 302 302 302 ILE ILE A . n A 1 303 ALA 303 303 303 ALA ALA A . n A 1 304 GLU 304 304 304 GLU GLU A . n A 1 305 TYR 305 305 305 TYR TYR A . n A 1 306 GLU 306 306 306 GLU GLU A . n A 1 307 GLN 307 307 307 GLN GLN A . n A 1 308 ASN 308 308 308 ASN ASN A . n A 1 309 LEU 309 309 309 LEU LEU A . n A 1 310 MET 310 310 310 MET MET A . n A 1 311 HIS 311 311 311 HIS HIS A . n A 1 312 TYR 312 312 312 TYR TYR A . n A 1 313 ALA 313 313 313 ALA ALA A . n A 1 314 LEU 314 314 314 LEU LEU A . n A 1 315 SER 315 315 315 SER SER A . n A 1 316 GLN 316 316 316 GLN GLN A . n A 1 317 LEU 317 317 317 LEU LEU A . n A 1 318 GLU 318 318 318 GLU GLU A . n A 1 319 SER 319 319 319 SER SER A . n A 1 320 VAL 320 320 320 VAL VAL A . n A 1 321 PRO 321 321 321 PRO PRO A . n A 1 322 ASP 322 322 322 ASP ASP A . n A 1 323 LEU 323 323 323 LEU LEU A . n A 1 324 THR 324 324 324 THR THR A . n A 1 325 LEU 325 325 325 LEU LEU A . n A 1 326 TYR 326 326 326 TYR TYR A . n A 1 327 GLY 327 327 327 GLY GLY A . n A 1 328 PRO 328 328 328 PRO PRO A . n A 1 329 GLN 329 329 329 GLN GLN A . n A 1 330 ALA 330 330 330 ALA ALA A . n A 1 331 ARG 331 331 331 ARG ARG A . n A 1 332 LEU 332 332 332 LEU LEU A . n A 1 333 GLY 333 333 333 GLY GLY A . n A 1 334 VAL 334 334 334 VAL VAL A . n A 1 335 ILE 335 335 335 ILE ILE A . n A 1 336 ALA 336 336 336 ALA ALA A . n A 1 337 PHE 337 337 337 PHE PHE A . n A 1 338 ASN 338 338 338 ASN ASN A . n A 1 339 LEU 339 339 339 LEU LEU A . n A 1 340 GLY 340 340 340 GLY GLY A . n A 1 341 ALA 341 341 341 ALA ALA A . n A 1 342 HIS 342 342 342 HIS HIS A . n A 1 343 HIS 343 343 343 HIS HIS A . n A 1 344 ALA 344 344 344 ALA ALA A . n A 1 345 TYR 345 345 345 TYR TYR A . n A 1 346 ASP 346 346 346 ASP ASP A . n A 1 347 VAL 347 347 347 VAL VAL A . n A 1 348 GLY 348 348 348 GLY GLY A . n A 1 349 SER 349 349 349 SER SER A . n A 1 350 PHE 350 350 350 PHE PHE A . n A 1 351 LEU 351 351 351 LEU LEU A . n A 1 352 ASP 352 352 352 ASP ASP A . n A 1 353 ASN 353 353 353 ASN ASN A . n A 1 354 TYR 354 354 354 TYR TYR A . n A 1 355 GLY 355 355 355 GLY GLY A . n A 1 356 ILE 356 356 356 ILE ILE A . n A 1 357 ALA 357 357 357 ALA ALA A . n A 1 358 VAL 358 358 358 VAL VAL A . n A 1 359 ARG 359 359 359 ARG ARG A . n A 1 360 THR 360 360 360 THR THR A . n A 1 361 GLY 361 361 361 GLY GLY A . n A 1 362 HIS 362 362 362 HIS HIS A . n A 1 363 HIS 363 363 363 HIS HIS A . n A 1 364 CYS 364 364 364 CYS CYS A . n A 1 365 ALA 365 365 365 ALA ALA A . n A 1 366 MET 366 366 366 MET MET A . n A 1 367 PRO 367 367 367 PRO PRO A . n A 1 368 LEU 368 368 368 LEU LEU A . n A 1 369 MET 369 369 369 MET MET A . n A 1 370 ALA 370 370 370 ALA ALA A . n A 1 371 TYR 371 371 371 TYR TYR A . n A 1 372 TYR 372 372 372 TYR TYR A . n A 1 373 ASN 373 373 373 ASN ASN A . n A 1 374 VAL 374 374 374 VAL VAL A . n A 1 375 PRO 375 375 375 PRO PRO A . n A 1 376 ALA 376 376 376 ALA ALA A . n A 1 377 MET 377 377 377 MET MET A . n A 1 378 CYS 378 378 378 CYS CYS A . n A 1 379 ARG 379 379 379 ARG ARG A . n A 1 380 ALA 380 380 380 ALA ALA A . n A 1 381 SER 381 381 381 SER SER A . n A 1 382 LEU 382 382 382 LEU LEU A . n A 1 383 ALA 383 383 383 ALA ALA A . n A 1 384 MET 384 384 384 MET MET A . n A 1 385 TYR 385 385 385 TYR TYR A . n A 1 386 ASN 386 386 386 ASN ASN A . n A 1 387 THR 387 387 387 THR THR A . n A 1 388 HIS 388 388 388 HIS HIS A . n A 1 389 GLU 389 389 389 GLU GLU A . n A 1 390 GLU 390 390 390 GLU GLU A . n A 1 391 VAL 391 391 391 VAL VAL A . n A 1 392 ASP 392 392 392 ASP ASP A . n A 1 393 ARG 393 393 393 ARG ARG A . n A 1 394 LEU 394 394 394 LEU LEU A . n A 1 395 VAL 395 395 395 VAL VAL A . n A 1 396 THR 396 396 396 THR THR A . n A 1 397 GLY 397 397 397 GLY GLY A . n A 1 398 LEU 398 398 398 LEU LEU A . n A 1 399 GLN 399 399 399 GLN GLN A . n A 1 400 ARG 400 400 400 ARG ARG A . n A 1 401 ILE 401 401 401 ILE ILE A . n A 1 402 HIS 402 402 402 HIS HIS A . n A 1 403 ARG 403 403 403 ARG ARG A . n A 1 404 LEU 404 404 404 LEU LEU A . n A 1 405 LEU 405 405 405 LEU LEU A . n A 1 406 GLY 406 406 406 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PLP 1 500 500 PLP PLP A . C 3 ACY 1 550 550 ACY ACY A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7320 ? 1 MORE -36 ? 1 'SSA (A^2)' 26250 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-07-17 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MLPHARE phasing . ? 1 X-PLOR refinement 3.851 ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 32 ? ? -175.08 118.77 2 1 ALA A 52 ? ? 179.84 170.76 3 1 ASN A 107 ? ? -59.20 -6.01 4 1 ILE A 127 ? ? -134.92 -66.80 5 1 ASP A 162 ? ? -148.70 -157.84 6 1 LEU A 227 ? ? -99.24 41.91 7 1 LEU A 317 ? ? -58.17 -8.18 8 1 ALA A 330 ? ? -100.50 60.99 9 1 ALA A 365 ? ? -146.13 49.48 10 1 ASN A 373 ? ? 48.82 29.42 11 1 ALA A 376 ? ? 179.49 156.03 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ILE 2 ? A ILE 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "PYRIDOXAL-5'-PHOSPHATE" PLP 3 'ACETIC ACID' ACY #