data_1C49 # _entry.id 1C49 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1C49 pdb_00001c49 10.2210/pdb1c49/pdb RCSB RCSB001286 ? ? WWPDB D_1000001286 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1C49 _pdbx_database_status.recvd_initial_deposition_date 1999-08-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Klenk, K.C.' 1 'Tenenholz, T.C.' 2 'Matteson, D.R.' 3 'Rogowski, R.S.' 4 'Blaustein, M.P.' 5 'Weber, D.J.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural and functional differences of two toxins from the scorpion Pandinus imperator.' Proteins 38 441 449 2000 PSFGEY US 0887-3585 0867 ? 10707030 '10.1002/(SICI)1097-0134(20000301)38:4<441::AID-PROT9>3.3.CO;2-C' 1 'Three New Toxins from the Scorpion Pandinus Imperator Selectively Block Certain Voltage-Gated K+ Channels' Mol.Pharmacol. 50 1167 ? 1996 MOPMA3 US 0026-895X 0197 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Klenk, K.C.' 1 ? primary 'Tenenholz, T.C.' 2 ? primary 'Matteson, D.R.' 3 ? primary 'Rogowski, R.S.' 4 ? primary 'Blaustein, M.P.' 5 ? primary 'Weber, D.J.' 6 ? 1 'Rogowski, R.S.' 7 ? 1 'Collins, J.H.' 8 ? 1 ;O'Neill, T.J. ; 9 ? 1 'Gustafson, T.A.' 10 ? 1 'Werkman, T.R.' 11 ? 1 'Rogawski, M.A.' 12 ? 1 'Tenenholz, T.C.' 13 ? 1 'Weber, D.J.' 14 ? 1 'Blaustein, M.P.' 15 ? # _cell.entry_id 1C49 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1C49 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TOXIN K-BETA' _entity.formula_weight 4080.824 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'COMPLETE PEPTIDE' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PITX-KB, ALPHA-KTX5.2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TISCTNEKQCYPHCKKETGYPNAKCMNRKCKCFGR _entity_poly.pdbx_seq_one_letter_code_can TISCTNEKQCYPHCKKETGYPNAKCMNRKCKCFGR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ILE n 1 3 SER n 1 4 CYS n 1 5 THR n 1 6 ASN n 1 7 GLU n 1 8 LYS n 1 9 GLN n 1 10 CYS n 1 11 TYR n 1 12 PRO n 1 13 HIS n 1 14 CYS n 1 15 LYS n 1 16 LYS n 1 17 GLU n 1 18 THR n 1 19 GLY n 1 20 TYR n 1 21 PRO n 1 22 ASN n 1 23 ALA n 1 24 LYS n 1 25 CYS n 1 26 MET n 1 27 ASN n 1 28 ARG n 1 29 LYS n 1 30 CYS n 1 31 LYS n 1 32 CYS n 1 33 PHE n 1 34 GLY n 1 35 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'emperor scorpion' _entity_src_gen.gene_src_genus Pandinus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue VENOM _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pandinus imperator' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 55084 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PSR9 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCKB_PANIM _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P55928 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1C49 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P55928 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 35 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 38 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 DQF-COSY 1 4 1 ROESY 1 5 1 P.E.COSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310.00 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.50 _pdbx_nmr_exptl_sample_conditions.ionic_strength '1.44 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '10% D2O AND 100%D2O' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1C49 _pdbx_nmr_refine.method 'DISTANCE GEOMETRY SIMULATED ANNEALING' _pdbx_nmr_refine.details ;425 NOE DISTANCE CONSTRAINTS, 22 H-BOND CONSTRAINTS, 11 CHI ANGLE CONSTRAINTS, 26 PHI ANGLE CONSTRAINTS ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1C49 _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED USING TWO-DIMENSIONAL NMR ON AN UNLABELED SAMPLE OF RECOMBINANT PITX-KB (M). ; # _pdbx_nmr_ensemble.entry_id 1C49 _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 18 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR 3.1 BRUNGER 2 # _exptl.entry_id 1C49 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1C49 _struct.title 'STRUCTURAL AND FUNCTIONAL DIFFERENCES OF TWO TOXINS FROM THE SCORPION PANDINUS IMPERATOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1C49 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'SCORPION TOXIN, POTASSIUM CHANNELS BLOCKERS, ALPHA-K TOXIN FAMILY, NEUROTOXIN, NMR SOLUTION STRUCTURE, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 6 ? GLN A 9 ? ASN A 9 GLN A 12 5 ? 4 HELX_P HELX_P2 2 CYS A 10 ? THR A 18 ? CYS A 13 THR A 21 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 7 A CYS 28 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 17 A CYS 35 1_555 ? ? ? ? ? ? ? 2.019 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 23 ? MET A 26 ? ALA A 26 MET A 29 A 2 LYS A 29 ? CYS A 32 ? LYS A 32 CYS A 35 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id MET _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 26 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id MET _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 29 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 29 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 32 # _database_PDB_matrix.entry_id 1C49 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1C49 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 4 4 THR THR A . n A 1 2 ILE 2 5 5 ILE ILE A . n A 1 3 SER 3 6 6 SER SER A . n A 1 4 CYS 4 7 7 CYS CYS A . n A 1 5 THR 5 8 8 THR THR A . n A 1 6 ASN 6 9 9 ASN ASN A . n A 1 7 GLU 7 10 10 GLU GLU A . n A 1 8 LYS 8 11 11 LYS LYS A . n A 1 9 GLN 9 12 12 GLN GLN A . n A 1 10 CYS 10 13 13 CYS CYS A . n A 1 11 TYR 11 14 14 TYR TYR A . n A 1 12 PRO 12 15 15 PRO PRO A . n A 1 13 HIS 13 16 16 HIS HIS A . n A 1 14 CYS 14 17 17 CYS CYS A . n A 1 15 LYS 15 18 18 LYS LYS A . n A 1 16 LYS 16 19 19 LYS LYS A . n A 1 17 GLU 17 20 20 GLU GLU A . n A 1 18 THR 18 21 21 THR THR A . n A 1 19 GLY 19 22 22 GLY GLY A . n A 1 20 TYR 20 23 23 TYR TYR A . n A 1 21 PRO 21 24 24 PRO PRO A . n A 1 22 ASN 22 25 25 ASN ASN A . n A 1 23 ALA 23 26 26 ALA ALA A . n A 1 24 LYS 24 27 27 LYS LYS A . n A 1 25 CYS 25 28 28 CYS CYS A . n A 1 26 MET 26 29 29 MET MET A . n A 1 27 ASN 27 30 30 ASN ASN A . n A 1 28 ARG 28 31 31 ARG ARG A . n A 1 29 LYS 29 32 32 LYS LYS A . n A 1 30 CYS 30 33 33 CYS CYS A . n A 1 31 LYS 31 34 34 LYS LYS A . n A 1 32 CYS 32 35 35 CYS CYS A . n A 1 33 PHE 33 36 36 PHE PHE A . n A 1 34 GLY 34 37 37 GLY GLY A . n A 1 35 ARG 35 38 38 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-03-22 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 2 2 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 3 3 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 4 4 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 5 5 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 6 6 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 7 7 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 8 8 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 9 9 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 10 10 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 11 11 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 12 12 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 13 13 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 14 14 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 15 15 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 16 16 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 17 17 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 18 18 SG A CYS 13 ? ? SG A CYS 33 ? ? 2.02 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 5 ? ? -55.95 -163.67 2 1 THR A 8 ? ? -131.49 -59.40 3 2 THR A 21 ? ? -136.01 -45.26 4 2 ASN A 25 ? ? -41.46 107.97 5 2 MET A 29 ? ? -115.09 -165.15 6 2 ASN A 30 ? ? -52.21 90.68 7 2 PHE A 36 ? ? -155.71 46.33 8 3 ASN A 25 ? ? -54.37 103.25 9 4 THR A 8 ? ? -130.36 -37.81 10 5 THR A 8 ? ? -138.66 -39.92 11 5 THR A 21 ? ? -146.07 -40.17 12 5 ASN A 25 ? ? -45.48 109.28 13 5 CYS A 33 ? ? -43.48 152.58 14 6 ILE A 5 ? ? -58.19 -163.00 15 6 ASN A 25 ? ? -52.21 91.42 16 6 ASN A 30 ? ? 45.89 70.93 17 6 ARG A 31 ? ? 38.98 40.17 18 6 PHE A 36 ? ? -156.04 -36.77 19 7 THR A 21 ? ? -139.53 -36.34 20 7 ASN A 30 ? ? -50.22 93.90 21 8 ILE A 5 ? ? -64.87 -154.27 22 8 SER A 6 ? ? -169.12 98.86 23 8 THR A 8 ? ? -133.12 -50.59 24 8 ASN A 25 ? ? -39.65 94.03 25 8 ASN A 30 ? ? -59.92 98.10 26 8 PHE A 36 ? ? -149.24 -81.30 27 9 PHE A 36 ? ? -151.72 57.83 28 10 ILE A 5 ? ? -67.00 -168.82 29 10 THR A 8 ? ? -140.24 -47.47 30 10 ASN A 30 ? ? 38.24 56.24 31 11 ILE A 5 ? ? -62.69 -169.01 32 11 THR A 21 ? ? -150.07 -51.66 33 11 ASN A 25 ? ? -61.41 91.00 34 11 ARG A 31 ? ? 43.60 29.77 35 11 PHE A 36 ? ? -81.06 -70.31 36 12 SER A 6 ? ? -106.04 44.37 37 12 THR A 8 ? ? -140.36 14.43 38 12 THR A 21 ? ? -143.60 -60.85 39 13 ILE A 5 ? ? -72.28 -154.01 40 13 SER A 6 ? ? 177.90 106.64 41 13 PRO A 24 ? ? -80.58 42.56 42 14 THR A 8 ? ? -140.93 12.83 43 14 ASN A 25 ? ? -62.41 90.25 44 15 ILE A 5 ? ? -69.36 -174.98 45 15 THR A 21 ? ? -148.40 -59.21 46 16 THR A 21 ? ? -148.04 -70.70 47 16 MET A 29 ? ? -100.50 -165.41 48 16 ASN A 30 ? ? -50.41 88.97 49 17 ILE A 5 ? ? -61.08 -156.93 50 17 THR A 8 ? ? -138.96 -50.60 51 17 ASN A 25 ? ? -46.16 103.76 52 17 ASN A 30 ? ? 39.11 55.04 53 18 THR A 8 ? ? -143.51 -40.70 54 18 THR A 21 ? ? -133.41 -39.48 55 18 ASN A 25 ? ? -45.51 99.22 56 18 PHE A 36 ? ? -161.51 62.59 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 31 ? ? 0.123 'SIDE CHAIN' 2 1 ARG A 38 ? ? 0.260 'SIDE CHAIN' 3 2 ARG A 31 ? ? 0.257 'SIDE CHAIN' 4 2 ARG A 38 ? ? 0.271 'SIDE CHAIN' 5 3 ARG A 31 ? ? 0.262 'SIDE CHAIN' 6 3 ARG A 38 ? ? 0.301 'SIDE CHAIN' 7 4 ARG A 31 ? ? 0.175 'SIDE CHAIN' 8 4 ARG A 38 ? ? 0.215 'SIDE CHAIN' 9 5 ARG A 31 ? ? 0.313 'SIDE CHAIN' 10 5 ARG A 38 ? ? 0.225 'SIDE CHAIN' 11 6 ARG A 31 ? ? 0.241 'SIDE CHAIN' 12 6 ARG A 38 ? ? 0.317 'SIDE CHAIN' 13 7 ARG A 31 ? ? 0.177 'SIDE CHAIN' 14 7 ARG A 38 ? ? 0.318 'SIDE CHAIN' 15 8 ARG A 31 ? ? 0.238 'SIDE CHAIN' 16 8 ARG A 38 ? ? 0.312 'SIDE CHAIN' 17 9 ARG A 31 ? ? 0.279 'SIDE CHAIN' 18 9 ARG A 38 ? ? 0.099 'SIDE CHAIN' 19 10 ARG A 31 ? ? 0.210 'SIDE CHAIN' 20 10 ARG A 38 ? ? 0.203 'SIDE CHAIN' 21 11 ARG A 31 ? ? 0.315 'SIDE CHAIN' 22 11 ARG A 38 ? ? 0.207 'SIDE CHAIN' 23 12 ARG A 31 ? ? 0.274 'SIDE CHAIN' 24 12 ARG A 38 ? ? 0.233 'SIDE CHAIN' 25 13 ARG A 31 ? ? 0.244 'SIDE CHAIN' 26 13 ARG A 38 ? ? 0.243 'SIDE CHAIN' 27 14 ARG A 31 ? ? 0.279 'SIDE CHAIN' 28 14 ARG A 38 ? ? 0.174 'SIDE CHAIN' 29 15 ARG A 31 ? ? 0.317 'SIDE CHAIN' 30 15 ARG A 38 ? ? 0.091 'SIDE CHAIN' 31 16 ARG A 31 ? ? 0.223 'SIDE CHAIN' 32 17 ARG A 31 ? ? 0.195 'SIDE CHAIN' 33 17 ARG A 38 ? ? 0.318 'SIDE CHAIN' 34 18 ARG A 31 ? ? 0.293 'SIDE CHAIN' 35 18 ARG A 38 ? ? 0.317 'SIDE CHAIN' #