data_1C8P # _entry.id 1C8P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1C8P RCSB RCSB001474 WWPDB D_1000001474 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2000-06-21 _pdbx_database_PDB_obs_spr.pdb_id 1C8P _pdbx_database_PDB_obs_spr.replace_pdb_id 1D4Q _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 4308 _pdbx_database_related.details '1H AND 15N CHEMICAL SHIFT DATA' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1C8P _pdbx_database_status.recvd_initial_deposition_date 1999-10-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mulhern, T.D.' 1 ;D'Andrea, R.J. ; 2 'Gaunt, C.' 3 'Vandeleur, L.' 4 'Vadas, M.A.' 5 'Lopez, A.F.' 6 'Booker, G.W.' 7 'Bagley, C.J.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;The solution structure of the cytokine-binding domain of the common beta-chain of the receptors for granulocyte-macrophage colony-stimulating factor, interleukin-3 and interleukin-5. ; J.Mol.Biol. 297 989 1001 2000 JMOBAK UK 0022-2836 0070 ? 10736232 10.1006/jmbi.2000.3610 1 '1H and 15N Chemical Shift Assignments for Domain 4 of the Common Beta-Chain of the IL-3, IL-5 and GM-CSF Receptors' J.Biomol.NMR 14 281 282 1999 JBNME9 NE 0925-2738 0800 ? ? 10.1023/A:1008360024435 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Mulhern, T.D.' 1 primary 'Lopez, A.F.' 2 primary ;D'Andrea, R.J. ; 3 primary 'Gaunt, C.' 4 primary 'Vandeleur, L.' 5 primary 'Vadas, M.A.' 6 primary 'Booker, G.W.' 7 primary 'Bagley, C.J.' 8 1 'Mulhern, T.D.' 9 1 'Bagley, C.J.' 10 1 'Gaunt, C.' 11 1 'Lopez, A.F.' 12 1 'Vadas, M.A.' 13 1 ;D'Andrea, R.J. ; 14 1 'Booker, G.W.' 15 # _cell.entry_id 1C8P _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1C8P _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CYTOKINE RECEPTOR COMMON BETA CHAIN' _entity.formula_weight 12122.479 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'DOMAIN 4' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRT SRTGYNGIWSEWSEARSWDTES ; _entity_poly.pdbx_seq_one_letter_code_can ;MIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRT SRTGYNGIWSEWSEARSWDTES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 GLN n 1 4 MET n 1 5 ALA n 1 6 PRO n 1 7 PRO n 1 8 SER n 1 9 LEU n 1 10 ASN n 1 11 VAL n 1 12 THR n 1 13 LYS n 1 14 ASP n 1 15 GLY n 1 16 ASP n 1 17 SER n 1 18 TYR n 1 19 SER n 1 20 LEU n 1 21 ARG n 1 22 TRP n 1 23 GLU n 1 24 THR n 1 25 MET n 1 26 LYS n 1 27 MET n 1 28 ARG n 1 29 TYR n 1 30 GLU n 1 31 HIS n 1 32 ILE n 1 33 ASP n 1 34 HIS n 1 35 THR n 1 36 PHE n 1 37 GLU n 1 38 ILE n 1 39 GLN n 1 40 TYR n 1 41 ARG n 1 42 LYS n 1 43 ASP n 1 44 THR n 1 45 ALA n 1 46 THR n 1 47 TRP n 1 48 LYS n 1 49 ASP n 1 50 SER n 1 51 LYS n 1 52 THR n 1 53 GLU n 1 54 THR n 1 55 LEU n 1 56 GLN n 1 57 ASN n 1 58 ALA n 1 59 HIS n 1 60 SER n 1 61 MET n 1 62 ALA n 1 63 LEU n 1 64 PRO n 1 65 ALA n 1 66 LEU n 1 67 GLU n 1 68 PRO n 1 69 SER n 1 70 THR n 1 71 ARG n 1 72 TYR n 1 73 TRP n 1 74 ALA n 1 75 ARG n 1 76 VAL n 1 77 ARG n 1 78 VAL n 1 79 ARG n 1 80 THR n 1 81 SER n 1 82 ARG n 1 83 THR n 1 84 GLY n 1 85 TYR n 1 86 ASN n 1 87 GLY n 1 88 ILE n 1 89 TRP n 1 90 SER n 1 91 GLU n 1 92 TRP n 1 93 SER n 1 94 GLU n 1 95 ALA n 1 96 ARG n 1 97 SER n 1 98 TRP n 1 99 ASP n 1 100 THR n 1 101 GLU n 1 102 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell 'HEMOPOIETIC CELLS' _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PEC611 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IL3RB_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P32927 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1C8P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32927 _struct_ref_seq.db_align_beg 338 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 438 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 102 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1C8P _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P32927 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'CLONING ARTIFACT' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '2D NOESY' 2 3 1 3D_15N-SEPARATED_NOESY 1 4 1 HMQC-J 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.06M _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.4MM D4BC U-15N; 10MM PHOSPHATE BUFFER;90% H2O, 10% D2O' ? 2 '0.4MM D4BC U-15N; 10MM PHOSPHATE BUFFER;100% D2O' ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1C8P _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON 1500 UNAMBIGUOUS NOE-DERIVED DISTANCE RESTRAINTS, 1034 AMBIGUOUS NOE-DERIVED DISTANCE RESTRAINTS, 42 DIHEDRAL ANGLE RESTRAINTS AND 30 DISTANCE RESTRAINTS FROM HYDROGEN BONDS. THE ARIA METHOD OF NILGES ET AL. (1997) WAS USED ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1C8P _pdbx_nmr_details.text 'THIS STRUCTURE WAS CALCULATED USING THE ARIA METHOD' # _pdbx_nmr_ensemble.entry_id 1C8P _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1C8P _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing VNMR 6.1B 'VARIAN AND ASSOCIATES' 1 'data analysis' XEASY 1.3.13 'BARTELS ET AL.' 2 'structure solution' X-PLOR 3.851 BRUNGER 3 refinement X-PLOR 3.851 BRUNGER 4 # _exptl.entry_id 1C8P _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1C8P _struct.title 'NMR STRUCTURE OF THE LIGAND BINDING DOMAIN OF THE COMMON BETA-CHAIN IN THE GM-CSF, IL-3 AND IL-5 RECEPTORS' _struct.pdbx_descriptor 'GM-CSFR, IL-3R & IL-5R COMMON BETA-CHAIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1C8P _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'BETA SANDWICH, CYTOKINE RECEPTOR, FN3 DOMAIN, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 46 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 50 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 46 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 50 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 8 ? ASP A 14 ? SER A 8 ASP A 14 A 2 SER A 17 ? GLU A 23 ? SER A 17 GLU A 23 A 3 SER A 60 ? LEU A 63 ? SER A 60 LEU A 63 B 1 THR A 52 ? GLN A 56 ? THR A 52 GLN A 56 B 2 THR A 35 ? LYS A 42 ? THR A 35 LYS A 42 B 3 TYR A 72 ? ARG A 79 ? TYR A 72 ARG A 79 B 4 ARG A 96 ? TRP A 98 ? ARG A 96 TRP A 98 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 14 ? N ASP A 14 O SER A 17 ? O SER A 17 A 2 3 N LEU A 20 ? N LEU A 20 O MET A 61 ? O MET A 61 B 1 2 O LEU A 55 ? O LEU A 55 N PHE A 36 ? N PHE A 36 B 2 3 N ARG A 41 ? N ARG A 41 O TRP A 73 ? O TRP A 73 B 3 4 N ALA A 74 ? N ALA A 74 O ARG A 96 ? O ARG A 96 # _database_PDB_matrix.entry_id 1C8P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1C8P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 SER 102 102 102 SER SER A . n # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-06-15 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLU 67 ? ? HG1 A THR 100 ? ? 1.48 2 2 O A TRP 47 ? ? HG A SER 50 ? ? 1.52 3 2 H A ASP 43 ? ? O A ARG 71 ? ? 1.59 4 4 H A SER 69 ? ? O A THR 100 ? ? 1.55 5 4 H A ARG 41 ? ? O A TRP 73 ? ? 1.56 6 4 OE1 A GLN 39 ? ? HH21 A ARG 75 ? ? 1.59 7 5 H A THR 12 ? ? O A SER 19 ? ? 1.56 8 5 HG A SER 19 ? ? O A MET 61 ? ? 1.59 9 6 O A ARG 82 ? ? H A TYR 85 ? ? 1.57 10 6 H A ARG 41 ? ? O A TRP 73 ? ? 1.59 11 7 O A ASN 10 ? ? H A ARG 21 ? ? 1.56 12 7 H A TRP 22 ? ? O A HIS 59 ? ? 1.58 13 7 O A ARG 82 ? ? H A TYR 85 ? ? 1.58 14 7 O A GLU 67 ? ? HG1 A THR 100 ? ? 1.59 15 8 H A THR 12 ? ? O A SER 19 ? ? 1.53 16 9 O A TRP 47 ? ? HG A SER 50 ? ? 1.55 17 9 H A THR 12 ? ? O A SER 19 ? ? 1.56 18 10 O A GLU 67 ? ? HG1 A THR 100 ? ? 1.52 19 11 O A TRP 47 ? ? HG A SER 50 ? ? 1.52 20 11 O A GLU 67 ? ? HG1 A THR 100 ? ? 1.54 21 12 O A GLU 67 ? ? HG1 A THR 100 ? ? 1.56 22 12 H A ASP 43 ? ? O A ARG 71 ? ? 1.59 23 13 H A SER 69 ? ? O A GLU 101 ? ? 1.59 24 13 H A THR 12 ? ? O A SER 19 ? ? 1.59 25 13 H A ARG 41 ? ? O A TRP 73 ? ? 1.60 26 15 O A TRP 47 ? ? HG A SER 50 ? ? 1.47 27 16 H A ARG 41 ? ? O A TRP 73 ? ? 1.55 28 16 O A ASN 10 ? ? H A ARG 21 ? ? 1.58 29 19 O A TRP 47 ? ? HG A SER 50 ? ? 1.49 30 19 O A ARG 82 ? ? H A TYR 85 ? ? 1.59 31 20 O A GLU 67 ? ? HG1 A THR 100 ? ? 1.50 32 20 H A THR 12 ? ? O A SER 19 ? ? 1.54 33 20 O A ILE 38 ? ? H A GLU 53 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? -67.41 -171.94 2 1 MET A 4 ? ? 62.55 -176.02 3 1 PRO A 7 ? ? -63.94 -177.88 4 1 ASP A 16 ? ? 83.24 -52.62 5 1 MET A 25 ? ? -151.45 20.57 6 1 MET A 27 ? ? -129.59 -62.36 7 1 ARG A 28 ? ? 36.96 32.90 8 1 TYR A 29 ? ? -83.21 -78.37 9 1 HIS A 31 ? ? -68.86 63.40 10 1 HIS A 34 ? ? 54.65 97.12 11 1 ARG A 41 ? ? -104.42 -158.61 12 1 ALA A 45 ? ? -108.99 -158.83 13 1 SER A 50 ? ? -52.60 178.26 14 1 SER A 60 ? ? 168.17 163.82 15 1 ALA A 62 ? ? -112.61 73.47 16 1 LEU A 63 ? ? -37.42 95.81 17 1 ARG A 79 ? ? -99.50 -152.51 18 1 SER A 81 ? ? -67.24 74.88 19 1 THR A 83 ? ? 73.18 -59.97 20 1 ASN A 86 ? ? -57.17 -101.74 21 1 TRP A 92 ? ? 63.89 121.10 22 1 GLU A 101 ? ? 40.60 -162.00 23 2 PRO A 7 ? ? -66.76 -170.58 24 2 ASP A 14 ? ? -158.72 38.21 25 2 ASP A 16 ? ? 175.31 -63.20 26 2 MET A 27 ? ? 48.22 25.57 27 2 GLU A 30 ? ? -61.96 -176.39 28 2 HIS A 34 ? ? 65.81 111.05 29 2 ARG A 41 ? ? -95.42 -154.75 30 2 ASN A 57 ? ? 174.01 65.42 31 2 SER A 60 ? ? 179.09 160.16 32 2 LEU A 63 ? ? -51.02 104.24 33 2 PRO A 64 ? ? -92.57 -62.17 34 2 THR A 80 ? ? -104.25 65.32 35 2 SER A 81 ? ? -63.70 74.35 36 2 THR A 83 ? ? 59.94 -73.43 37 2 TYR A 85 ? ? -60.40 -161.42 38 2 ASN A 86 ? ? -101.93 -106.18 39 2 TRP A 89 ? ? 65.48 150.59 40 2 SER A 90 ? ? -55.19 -73.57 41 2 GLU A 91 ? ? 170.67 -76.31 42 2 TRP A 92 ? ? 178.11 125.21 43 2 GLU A 101 ? ? 68.57 150.73 44 3 MET A 4 ? ? 60.88 -164.26 45 3 PRO A 7 ? ? -53.07 -166.05 46 3 ASP A 16 ? ? 171.93 -65.01 47 3 MET A 25 ? ? 178.77 40.89 48 3 MET A 27 ? ? -138.40 -52.56 49 3 TYR A 29 ? ? -53.02 -74.18 50 3 GLU A 30 ? ? -148.97 -64.72 51 3 HIS A 31 ? ? -154.29 -55.27 52 3 ILE A 32 ? ? 54.65 165.82 53 3 ASP A 33 ? ? -98.31 32.54 54 3 HIS A 34 ? ? -30.85 105.67 55 3 ARG A 41 ? ? -103.40 -157.60 56 3 THR A 46 ? ? -119.36 55.69 57 3 TRP A 47 ? ? 58.13 18.78 58 3 SER A 60 ? ? 173.56 151.80 59 3 ALA A 62 ? ? -108.21 68.22 60 3 LEU A 63 ? ? -35.89 93.46 61 3 LEU A 66 ? ? -106.20 -166.67 62 3 ARG A 82 ? ? 35.06 32.20 63 3 THR A 83 ? ? 63.45 -66.26 64 3 TRP A 89 ? ? 76.83 177.71 65 3 SER A 90 ? ? -84.69 -76.90 66 3 GLU A 91 ? ? 175.94 -79.23 67 3 TRP A 92 ? ? 178.96 124.86 68 3 GLU A 101 ? ? 65.29 168.52 69 4 GLN A 3 ? ? -52.10 -82.08 70 4 ALA A 5 ? ? -57.21 106.66 71 4 PRO A 7 ? ? -79.99 -165.99 72 4 ASP A 14 ? ? -150.12 39.34 73 4 ASP A 16 ? ? 79.53 -55.51 74 4 MET A 25 ? ? -160.69 26.26 75 4 MET A 27 ? ? -142.12 -40.64 76 4 ILE A 32 ? ? 45.58 -89.55 77 4 ASP A 33 ? ? -168.57 -50.98 78 4 HIS A 34 ? ? 34.92 45.43 79 4 ARG A 41 ? ? -113.93 -156.71 80 4 SER A 60 ? ? 177.80 156.24 81 4 MET A 61 ? ? -127.98 -156.06 82 4 LEU A 63 ? ? -42.19 101.58 83 4 PRO A 64 ? ? -76.84 -83.57 84 4 LEU A 66 ? ? -123.74 -164.49 85 4 SER A 81 ? ? 57.02 -78.88 86 4 ARG A 82 ? ? 171.76 35.86 87 4 THR A 83 ? ? 67.04 -60.83 88 4 ASN A 86 ? ? 160.58 134.75 89 4 TRP A 89 ? ? 158.05 150.54 90 4 SER A 90 ? ? -65.65 -178.84 91 4 GLU A 91 ? ? -82.21 -80.13 92 4 TRP A 92 ? ? 176.07 118.10 93 4 SER A 93 ? ? -53.89 -172.33 94 4 THR A 100 ? ? -106.61 78.51 95 4 GLU A 101 ? ? -38.90 154.16 96 5 PRO A 7 ? ? -63.08 -178.57 97 5 ASP A 14 ? ? -145.67 37.04 98 5 MET A 27 ? ? 45.63 26.94 99 5 TYR A 29 ? ? -85.08 -83.02 100 5 GLU A 30 ? ? -177.55 -157.50 101 5 HIS A 31 ? ? -64.94 75.83 102 5 HIS A 34 ? ? -26.55 109.64 103 5 SER A 60 ? ? 171.70 156.34 104 5 MET A 61 ? ? -132.55 -158.92 105 5 LEU A 63 ? ? -41.63 101.28 106 5 THR A 80 ? ? -100.39 52.25 107 5 SER A 81 ? ? -42.67 -80.67 108 5 ARG A 82 ? ? 95.70 75.93 109 5 THR A 83 ? ? 54.79 -121.22 110 5 TYR A 85 ? ? -62.90 -157.15 111 5 ASN A 86 ? ? -97.42 -109.94 112 5 SER A 90 ? ? -75.01 -162.24 113 5 TRP A 92 ? ? 65.15 133.90 114 5 GLU A 101 ? ? 62.28 154.92 115 6 GLN A 3 ? ? -54.68 -87.26 116 6 PRO A 7 ? ? -80.42 -157.87 117 6 GLU A 23 ? ? -79.93 -161.73 118 6 MET A 27 ? ? 34.25 100.58 119 6 TYR A 29 ? ? -101.37 -76.78 120 6 GLU A 30 ? ? -169.15 70.54 121 6 HIS A 31 ? ? 68.09 -82.95 122 6 ILE A 32 ? ? 55.83 164.61 123 6 HIS A 34 ? ? 64.59 139.72 124 6 ARG A 41 ? ? -109.38 -157.10 125 6 THR A 46 ? ? -107.86 47.05 126 6 MET A 61 ? ? -120.62 -119.68 127 6 ALA A 62 ? ? 175.88 72.75 128 6 LEU A 63 ? ? -40.47 96.99 129 6 ARG A 79 ? ? -123.09 -117.71 130 6 THR A 80 ? ? -160.17 99.53 131 6 SER A 81 ? ? -69.71 63.04 132 6 THR A 83 ? ? -47.43 107.26 133 6 ASN A 86 ? ? 150.60 156.14 134 6 TRP A 89 ? ? 165.31 145.36 135 6 SER A 90 ? ? -48.20 168.55 136 6 GLU A 91 ? ? -77.46 -75.73 137 6 TRP A 92 ? ? 166.93 121.47 138 6 GLU A 101 ? ? 48.73 -177.32 139 7 MET A 4 ? ? 54.96 -157.73 140 7 ALA A 5 ? ? 175.66 127.36 141 7 PRO A 7 ? ? -65.93 -154.58 142 7 ASP A 16 ? ? -140.46 24.99 143 7 GLU A 30 ? ? -74.76 -164.33 144 7 HIS A 34 ? ? 51.02 -175.70 145 7 GLN A 39 ? ? -160.35 112.68 146 7 ARG A 41 ? ? -108.93 -157.74 147 7 MET A 61 ? ? -136.73 -159.39 148 7 LEU A 63 ? ? -34.08 99.33 149 7 PRO A 64 ? ? -75.17 -73.46 150 7 LEU A 66 ? ? -125.97 -149.50 151 7 SER A 81 ? ? -67.50 65.18 152 7 ASN A 86 ? ? -59.83 -102.26 153 7 GLU A 94 ? ? -57.75 107.82 154 7 GLU A 101 ? ? 61.98 156.85 155 8 GLN A 3 ? ? -137.85 -42.23 156 8 ALA A 5 ? ? -49.91 107.55 157 8 PRO A 7 ? ? -58.86 -165.84 158 8 ASP A 16 ? ? 178.92 -51.88 159 8 MET A 27 ? ? 44.91 -170.35 160 8 ARG A 28 ? ? -142.31 27.62 161 8 ILE A 32 ? ? 57.01 153.37 162 8 HIS A 34 ? ? 59.86 119.86 163 8 THR A 46 ? ? -111.13 57.74 164 8 SER A 60 ? ? 178.90 146.85 165 8 ALA A 62 ? ? 41.50 82.06 166 8 PRO A 64 ? ? -86.91 -78.59 167 8 LEU A 66 ? ? -121.36 -168.37 168 8 ARG A 82 ? ? 34.28 31.78 169 8 THR A 83 ? ? 39.81 89.77 170 8 TYR A 85 ? ? -46.88 162.35 171 8 ASN A 86 ? ? 161.55 164.19 172 8 TRP A 89 ? ? 162.44 136.50 173 8 GLU A 91 ? ? -56.04 -86.59 174 8 TRP A 92 ? ? 177.25 125.05 175 8 GLU A 101 ? ? -52.88 98.49 176 9 MET A 4 ? ? -113.82 -157.60 177 9 ASP A 16 ? ? 80.88 -56.04 178 9 MET A 25 ? ? -141.60 18.83 179 9 TYR A 29 ? ? -127.76 -164.65 180 9 GLU A 30 ? ? -37.89 160.11 181 9 HIS A 31 ? ? -69.00 64.20 182 9 ASP A 33 ? ? -50.95 -71.99 183 9 HIS A 34 ? ? 60.42 99.05 184 9 ARG A 41 ? ? -104.50 -164.00 185 9 ALA A 45 ? ? -99.64 -159.84 186 9 SER A 50 ? ? -49.27 150.04 187 9 SER A 60 ? ? 179.13 157.81 188 9 LEU A 63 ? ? -45.87 103.25 189 9 THR A 80 ? ? -115.17 67.68 190 9 SER A 81 ? ? -38.71 -26.94 191 9 THR A 83 ? ? 73.81 61.41 192 9 ASN A 86 ? ? -107.51 -108.38 193 9 GLU A 91 ? ? 61.86 -176.73 194 9 GLU A 101 ? ? 72.29 94.88 195 10 MET A 4 ? ? 43.19 99.71 196 10 PRO A 6 ? ? -39.40 156.05 197 10 ASP A 14 ? ? -160.31 70.04 198 10 ASP A 16 ? ? 58.38 19.80 199 10 GLU A 23 ? ? -80.20 -152.00 200 10 THR A 24 ? ? -161.35 -35.46 201 10 LYS A 26 ? ? 41.57 27.98 202 10 MET A 27 ? ? 37.74 29.92 203 10 TYR A 29 ? ? -118.30 -86.26 204 10 GLU A 30 ? ? -176.19 -162.79 205 10 HIS A 34 ? ? 56.82 131.77 206 10 SER A 50 ? ? -47.32 151.44 207 10 SER A 60 ? ? 175.57 153.13 208 10 MET A 61 ? ? -127.78 -164.08 209 10 LEU A 63 ? ? -40.17 100.26 210 10 ARG A 82 ? ? -172.54 -173.28 211 10 THR A 83 ? ? 71.84 78.52 212 10 ASN A 86 ? ? -59.20 -102.49 213 10 SER A 90 ? ? -64.59 -84.35 214 10 GLU A 91 ? ? 179.04 -84.60 215 10 TRP A 92 ? ? 169.80 103.05 216 10 SER A 93 ? ? -47.81 170.07 217 10 GLU A 101 ? ? 71.53 101.99 218 11 ILE A 2 ? ? 38.71 -163.44 219 11 MET A 4 ? ? 69.13 -159.14 220 11 ALA A 5 ? ? -169.42 119.87 221 11 ASP A 14 ? ? -147.13 42.29 222 11 ASP A 16 ? ? 171.08 -50.78 223 11 MET A 27 ? ? 68.59 -61.71 224 11 ARG A 28 ? ? 81.26 31.65 225 11 TYR A 29 ? ? -98.50 -63.51 226 11 GLU A 30 ? ? -152.08 -89.09 227 11 HIS A 31 ? ? -150.33 56.36 228 11 THR A 46 ? ? -103.41 -60.37 229 11 TRP A 47 ? ? 167.97 -39.70 230 11 SER A 60 ? ? 170.59 161.97 231 11 LEU A 63 ? ? -36.94 100.93 232 11 PRO A 64 ? ? -77.09 -77.48 233 11 LEU A 66 ? ? -129.54 -160.74 234 11 THR A 80 ? ? -115.49 79.14 235 11 SER A 81 ? ? -48.31 -81.53 236 11 ARG A 82 ? ? 80.86 169.62 237 11 GLU A 91 ? ? -86.49 -73.71 238 11 TRP A 92 ? ? 168.05 115.57 239 11 GLU A 101 ? ? 56.12 108.33 240 12 ILE A 2 ? ? 52.32 160.54 241 12 MET A 4 ? ? -122.08 -166.62 242 12 PRO A 7 ? ? -73.05 -165.20 243 12 ASP A 14 ? ? -147.38 38.31 244 12 ASP A 16 ? ? 170.99 -52.52 245 12 MET A 25 ? ? 178.30 36.07 246 12 MET A 27 ? ? -143.20 -76.43 247 12 ARG A 28 ? ? 48.64 28.01 248 12 TYR A 29 ? ? -66.48 -81.73 249 12 HIS A 31 ? ? -64.92 77.16 250 12 ASP A 33 ? ? 80.68 -54.31 251 12 HIS A 34 ? ? 63.20 165.47 252 12 ARG A 41 ? ? -100.78 -168.63 253 12 SER A 50 ? ? -47.52 159.15 254 12 GLN A 56 ? ? -80.44 -70.65 255 12 ASN A 57 ? ? -119.89 59.52 256 12 MET A 61 ? ? -131.01 -159.72 257 12 LEU A 63 ? ? -39.02 97.43 258 12 LEU A 66 ? ? -119.21 -167.56 259 12 THR A 80 ? ? -119.74 69.98 260 12 SER A 81 ? ? -64.41 73.61 261 12 ARG A 82 ? ? -84.56 49.57 262 12 THR A 83 ? ? 49.43 100.88 263 12 ASN A 86 ? ? 171.00 -177.70 264 12 SER A 90 ? ? -66.58 -98.40 265 12 GLU A 91 ? ? 174.32 31.48 266 12 TRP A 92 ? ? 59.88 136.03 267 12 GLU A 101 ? ? 56.27 -167.22 268 13 ILE A 2 ? ? 52.97 150.88 269 13 MET A 4 ? ? -164.33 118.03 270 13 PRO A 7 ? ? -68.76 -158.89 271 13 ASP A 16 ? ? -158.52 25.97 272 13 MET A 25 ? ? 175.45 39.28 273 13 MET A 27 ? ? -151.08 -57.75 274 13 TYR A 29 ? ? -99.29 -70.29 275 13 GLU A 30 ? ? -163.65 -162.74 276 13 ASP A 33 ? ? -89.25 35.79 277 13 HIS A 34 ? ? -37.10 93.51 278 13 ARG A 41 ? ? -108.59 -165.86 279 13 GLN A 56 ? ? -80.02 -77.66 280 13 SER A 60 ? ? 173.46 140.74 281 13 MET A 61 ? ? -114.20 -156.18 282 13 LEU A 63 ? ? -39.90 98.45 283 13 THR A 80 ? ? -102.59 51.50 284 13 SER A 81 ? ? -36.16 -30.96 285 13 ARG A 82 ? ? 35.74 37.87 286 13 THR A 83 ? ? 70.86 -61.19 287 13 TRP A 89 ? ? 73.65 167.64 288 13 TRP A 92 ? ? -41.85 109.96 289 13 SER A 93 ? ? -44.22 166.74 290 13 GLU A 101 ? ? 64.56 175.65 291 14 GLN A 3 ? ? -99.11 -85.82 292 14 ALA A 5 ? ? -56.36 107.21 293 14 PRO A 7 ? ? -55.94 -161.10 294 14 ASP A 14 ? ? -104.76 51.89 295 14 ASP A 16 ? ? -178.96 -65.24 296 14 MET A 25 ? ? -172.36 32.99 297 14 MET A 27 ? ? -148.69 -48.78 298 14 TYR A 29 ? ? -63.51 -172.39 299 14 HIS A 31 ? ? -60.34 83.81 300 14 ILE A 32 ? ? -92.51 -84.12 301 14 ASP A 33 ? ? 164.63 -55.05 302 14 HIS A 34 ? ? 38.58 78.63 303 14 ARG A 41 ? ? -106.96 -160.48 304 14 LEU A 63 ? ? -39.93 123.12 305 14 PRO A 64 ? ? -87.38 -83.21 306 14 LEU A 66 ? ? -116.51 -159.18 307 14 THR A 83 ? ? 47.74 90.47 308 14 GLU A 91 ? ? -90.12 -70.24 309 14 TRP A 92 ? ? 165.35 119.87 310 14 GLU A 101 ? ? 71.10 151.97 311 15 MET A 4 ? ? -138.40 -158.48 312 15 ALA A 5 ? ? -171.35 121.66 313 15 PRO A 7 ? ? -71.22 -158.66 314 15 ASN A 10 ? ? -160.02 119.60 315 15 ASP A 14 ? ? -152.49 47.82 316 15 MET A 25 ? ? -156.45 23.32 317 15 MET A 27 ? ? -141.79 -65.25 318 15 TYR A 29 ? ? -53.55 -78.91 319 15 GLU A 30 ? ? -144.94 -83.22 320 15 HIS A 31 ? ? -139.61 -52.99 321 15 ILE A 32 ? ? 52.72 167.39 322 15 HIS A 34 ? ? 39.56 79.29 323 15 ARG A 41 ? ? -96.84 -158.22 324 15 SER A 60 ? ? 174.47 152.23 325 15 MET A 61 ? ? -122.49 -159.18 326 15 LEU A 63 ? ? -38.23 102.73 327 15 LEU A 66 ? ? -129.54 -163.11 328 15 SER A 81 ? ? -67.77 65.73 329 15 THR A 83 ? ? 67.80 -61.44 330 15 ASN A 86 ? ? -60.52 -178.52 331 15 ILE A 88 ? ? -111.44 -162.28 332 15 TRP A 92 ? ? 65.34 123.99 333 15 SER A 93 ? ? -64.98 -169.42 334 15 GLU A 101 ? ? 66.39 100.82 335 16 GLN A 3 ? ? -51.38 -106.01 336 16 PRO A 7 ? ? -60.83 -171.36 337 16 ASP A 14 ? ? -159.79 37.19 338 16 MET A 25 ? ? 178.92 36.69 339 16 MET A 27 ? ? -162.17 -46.53 340 16 ARG A 28 ? ? 66.33 -62.62 341 16 TYR A 29 ? ? 64.04 -85.25 342 16 GLU A 30 ? ? -155.61 -85.84 343 16 HIS A 31 ? ? -147.75 36.75 344 16 HIS A 34 ? ? 47.02 91.56 345 16 ARG A 41 ? ? -111.02 -167.24 346 16 SER A 60 ? ? 168.96 149.85 347 16 MET A 61 ? ? -123.90 -162.54 348 16 LEU A 63 ? ? -37.92 108.77 349 16 PRO A 64 ? ? -90.02 -77.01 350 16 ARG A 79 ? ? -125.15 -103.53 351 16 THR A 80 ? ? -160.99 76.82 352 16 THR A 83 ? ? 65.13 -67.23 353 16 TYR A 85 ? ? 65.90 -174.88 354 16 GLU A 91 ? ? -78.58 -84.67 355 16 TRP A 92 ? ? 175.40 135.51 356 16 GLU A 101 ? ? 61.18 112.88 357 17 ILE A 2 ? ? -66.45 -177.29 358 17 MET A 4 ? ? 64.41 -162.31 359 17 ALA A 5 ? ? -173.20 126.71 360 17 PRO A 7 ? ? -74.94 -162.58 361 17 ASP A 14 ? ? -159.34 50.66 362 17 ASP A 16 ? ? 83.95 -49.95 363 17 MET A 25 ? ? -173.43 32.98 364 17 MET A 27 ? ? -167.12 -38.78 365 17 ARG A 28 ? ? 67.37 -67.66 366 17 TYR A 29 ? ? 33.54 -88.80 367 17 GLU A 30 ? ? -176.66 -159.90 368 17 ASP A 33 ? ? 45.26 27.59 369 17 HIS A 34 ? ? -41.08 155.06 370 17 ARG A 41 ? ? -114.45 -155.26 371 17 SER A 60 ? ? 178.61 162.24 372 17 LEU A 63 ? ? 31.65 84.48 373 17 LEU A 66 ? ? -126.41 -165.70 374 17 SER A 69 ? ? 60.71 60.74 375 17 ARG A 82 ? ? 45.92 -92.82 376 17 THR A 83 ? ? -167.09 -43.62 377 17 ASN A 86 ? ? 160.79 145.64 378 17 TRP A 89 ? ? 158.05 152.82 379 17 GLU A 91 ? ? -60.38 -80.46 380 17 TRP A 92 ? ? -177.69 132.21 381 17 GLU A 101 ? ? 68.94 152.34 382 18 PRO A 7 ? ? -59.42 -165.21 383 18 ASP A 14 ? ? -154.44 58.63 384 18 ASP A 16 ? ? -144.37 24.86 385 18 MET A 25 ? ? 167.02 33.32 386 18 ARG A 28 ? ? 28.61 39.47 387 18 TYR A 29 ? ? -61.30 -89.05 388 18 GLU A 30 ? ? -146.33 -72.22 389 18 HIS A 31 ? ? -124.32 -86.19 390 18 ILE A 32 ? ? 57.61 148.78 391 18 HIS A 34 ? ? 45.91 99.56 392 18 SER A 60 ? ? 178.87 162.37 393 18 MET A 61 ? ? -134.03 -158.34 394 18 LEU A 63 ? ? -39.15 99.67 395 18 SER A 69 ? ? 71.06 49.74 396 18 THR A 80 ? ? -109.73 56.50 397 18 SER A 81 ? ? -64.78 69.19 398 18 THR A 83 ? ? -179.24 -62.71 399 18 ASN A 86 ? ? 165.84 -171.80 400 18 TRP A 89 ? ? -176.32 149.67 401 18 SER A 90 ? ? -50.92 -179.16 402 18 GLU A 91 ? ? -94.16 -81.51 403 18 TRP A 92 ? ? -179.45 128.86 404 18 GLU A 101 ? ? 59.78 149.77 405 19 PRO A 7 ? ? -63.49 -171.50 406 19 ASP A 14 ? ? -160.01 37.23 407 19 MET A 25 ? ? -171.47 34.76 408 19 MET A 27 ? ? -157.69 -45.40 409 19 ARG A 28 ? ? 45.72 27.22 410 19 TYR A 29 ? ? -55.00 -80.76 411 19 ILE A 32 ? ? 35.54 -89.06 412 19 ASP A 33 ? ? 168.85 -46.69 413 19 HIS A 34 ? ? 36.78 100.82 414 19 ARG A 41 ? ? -96.03 -158.02 415 19 SER A 60 ? ? 173.40 167.35 416 19 LEU A 63 ? ? -39.31 99.40 417 19 THR A 80 ? ? -111.87 71.64 418 19 SER A 81 ? ? -66.08 64.64 419 19 THR A 83 ? ? -51.37 95.34 420 19 ASN A 86 ? ? -54.45 -175.68 421 19 ILE A 88 ? ? -112.11 -168.73 422 19 SER A 90 ? ? -86.53 -155.35 423 19 TRP A 92 ? ? 153.88 121.14 424 19 GLU A 94 ? ? -44.43 108.42 425 20 ALA A 5 ? ? -58.79 108.81 426 20 PRO A 7 ? ? -78.95 -158.13 427 20 ASP A 14 ? ? -158.28 38.42 428 20 ASP A 16 ? ? 79.95 -56.28 429 20 MET A 25 ? ? -177.67 38.48 430 20 MET A 27 ? ? -145.54 -68.46 431 20 GLU A 30 ? ? 176.05 -149.99 432 20 ILE A 32 ? ? 42.74 -170.07 433 20 HIS A 34 ? ? -23.37 87.10 434 20 ARG A 41 ? ? -116.38 -160.57 435 20 SER A 50 ? ? -49.53 155.29 436 20 SER A 60 ? ? 175.00 165.04 437 20 LEU A 63 ? ? -39.80 96.71 438 20 SER A 81 ? ? -98.91 -66.05 439 20 ARG A 82 ? ? 152.56 173.33 440 20 THR A 83 ? ? -35.67 -71.11 441 20 TYR A 85 ? ? 47.10 -166.61 442 20 ASN A 86 ? ? -147.08 -102.28 443 20 SER A 93 ? ? -67.39 -178.81 444 20 GLU A 101 ? ? 62.23 107.07 #