data_1C9P # _entry.id 1C9P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1C9P pdb_00001c9p 10.2210/pdb1c9p/pdb RCSB RCSB009466 ? ? WWPDB D_1000009466 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1C9P _pdbx_database_status.recvd_initial_deposition_date 1999-08-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _audit_author.name 'Rester, U.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Structure of the complex of the antistasin-type inhibitor bdellastasin with trypsin and modelling of the bdellastasin-microplasmin system. ; J.Mol.Biol. 293 93 106 1999 JMOBAK UK 0022-2836 0070 ? 10512718 10.1006/jmbi.1999.3162 1 ;Bdellastasin, a serine protease inhibitor of the antistasin family from the medical leech (Hirudo medicinalis)-primary structure, expression in yeast, and characterisation of native and recombinant inhibitor. ; Eur.J.Biochem. 253 212 220 1998 EJBCAI IX 0014-2956 0262 ? ? 10.1046/j.1432-1327.1998.2530212.x 2 'L-Isoaspartate 115 of porcine beta-trypsin promotes crystallization of its complex with bdellastasin' 'Acta Crystallogr.,Sect.D' 56 581 588 2000 ABCRE6 DK 0907-4449 0766 ? ? 10.1107/S0907444900003048 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rester, U.' 1 ? primary 'Bode, W.' 2 ? primary 'Moser, M.' 3 ? primary 'Parry, M.A.' 4 ? primary 'Huber, R.' 5 ? primary 'Auerswald, E.' 6 ? 1 'Moser, M.' 7 ? 1 'Auerswald, E.' 8 ? 1 'Mentele, R.' 9 ? 1 'Eckerskorn, C.' 10 ? 1 'Fritz, H.' 11 ? 1 'Fink, E.' 12 ? 2 'Rester, U.' 13 ? 2 'Moser, M.' 14 ? 2 'Huber, R.' 15 ? 2 'Bode, W.' 16 ? # _cell.entry_id 1C9P _cell.length_a 63.330 _cell.length_b 63.330 _cell.length_c 130.610 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1C9P _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting tetragonal _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat TRYPSIN 23494.480 1 3.4.21.4 ? ? ? 2 polymer man BDELLASTASIN 6351.208 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 135 ? ? ? ? # _entity_keywords.entity_id 1 _entity_keywords.text 'ISOASPARTATE115 RESULTS FROM A SPONTANEOUS DEAMIDATION, ACCOMPANIED BY A SIMULTANEOUS ISOMERISATION REACTION' # _entity_name_sys.entity_id 1 _entity_name_sys.name E.C.3.4.21.4 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNT LDNDIMLIKLSSPATL(IAS)SRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQI TGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN ; ;IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNT LDNDIMLIKLSSPATLDSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNM ICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN ; A ? 2 'polypeptide(L)' no no FDVNSHTTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ FDVNSHTTPCGPVTCSGAQMCEVDKCVCSDLHCKVKCEHGFKKDDNGCEYACICADAPQ B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 ALA n 1 9 ALA n 1 10 ASN n 1 11 SER n 1 12 ILE n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 GLY n 1 22 SER n 1 23 HIS n 1 24 PHE n 1 25 CYS n 1 26 GLY n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ASN n 1 32 SER n 1 33 GLN n 1 34 TRP n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 TYR n 1 43 LYS n 1 44 SER n 1 45 ARG n 1 46 ILE n 1 47 GLN n 1 48 VAL n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 GLU n 1 53 HIS n 1 54 ASN n 1 55 ILE n 1 56 ASP n 1 57 VAL n 1 58 LEU n 1 59 GLU n 1 60 GLY n 1 61 ASN n 1 62 GLU n 1 63 GLN n 1 64 PHE n 1 65 ILE n 1 66 ASN n 1 67 ALA n 1 68 ALA n 1 69 LYS n 1 70 ILE n 1 71 ILE n 1 72 THR n 1 73 HIS n 1 74 PRO n 1 75 ASN n 1 76 PHE n 1 77 ASN n 1 78 GLY n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 ASP n 1 83 ASN n 1 84 ASP n 1 85 ILE n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 LYS n 1 90 LEU n 1 91 SER n 1 92 SER n 1 93 PRO n 1 94 ALA n 1 95 THR n 1 96 LEU n 1 97 IAS n 1 98 SER n 1 99 ARG n 1 100 VAL n 1 101 ALA n 1 102 THR n 1 103 VAL n 1 104 SER n 1 105 LEU n 1 106 PRO n 1 107 ARG n 1 108 SER n 1 109 CYS n 1 110 ALA n 1 111 ALA n 1 112 ALA n 1 113 GLY n 1 114 THR n 1 115 GLU n 1 116 CYS n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 TRP n 1 122 GLY n 1 123 ASN n 1 124 THR n 1 125 LYS n 1 126 SER n 1 127 SER n 1 128 GLY n 1 129 SER n 1 130 SER n 1 131 TYR n 1 132 PRO n 1 133 SER n 1 134 LEU n 1 135 LEU n 1 136 GLN n 1 137 CYS n 1 138 LEU n 1 139 LYS n 1 140 ALA n 1 141 PRO n 1 142 VAL n 1 143 LEU n 1 144 SER n 1 145 ASP n 1 146 SER n 1 147 SER n 1 148 CYS n 1 149 LYS n 1 150 SER n 1 151 SER n 1 152 TYR n 1 153 PRO n 1 154 GLY n 1 155 GLN n 1 156 ILE n 1 157 THR n 1 158 GLY n 1 159 ASN n 1 160 MET n 1 161 ILE n 1 162 CYS n 1 163 VAL n 1 164 GLY n 1 165 PHE n 1 166 LEU n 1 167 GLU n 1 168 GLY n 1 169 GLY n 1 170 LYS n 1 171 ASP n 1 172 SER n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 GLY n 1 179 GLY n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 CYS n 1 184 ASN n 1 185 GLY n 1 186 GLN n 1 187 LEU n 1 188 GLN n 1 189 GLY n 1 190 ILE n 1 191 VAL n 1 192 SER n 1 193 TRP n 1 194 GLY n 1 195 TYR n 1 196 GLY n 1 197 CYS n 1 198 ALA n 1 199 GLN n 1 200 LYS n 1 201 ASN n 1 202 LYS n 1 203 PRO n 1 204 GLY n 1 205 VAL n 1 206 TYR n 1 207 THR n 1 208 LYS n 1 209 VAL n 1 210 CYS n 1 211 ASN n 1 212 TYR n 1 213 VAL n 1 214 ASN n 1 215 TRP n 1 216 ILE n 1 217 GLN n 1 218 GLN n 1 219 THR n 1 220 ILE n 1 221 ALA n 1 222 ALA n 1 223 ASN n 2 1 PHE n 2 2 ASP n 2 3 VAL n 2 4 ASN n 2 5 SER n 2 6 HIS n 2 7 THR n 2 8 THR n 2 9 PRO n 2 10 CYS n 2 11 GLY n 2 12 PRO n 2 13 VAL n 2 14 THR n 2 15 CYS n 2 16 SER n 2 17 GLY n 2 18 ALA n 2 19 GLN n 2 20 MET n 2 21 CYS n 2 22 GLU n 2 23 VAL n 2 24 ASP n 2 25 LYS n 2 26 CYS n 2 27 VAL n 2 28 CYS n 2 29 SER n 2 30 ASP n 2 31 LEU n 2 32 HIS n 2 33 CYS n 2 34 LYS n 2 35 VAL n 2 36 LYS n 2 37 CYS n 2 38 GLU n 2 39 HIS n 2 40 GLY n 2 41 PHE n 2 42 LYS n 2 43 LYS n 2 44 ASP n 2 45 ASP n 2 46 ASN n 2 47 GLY n 2 48 CYS n 2 49 GLU n 2 50 TYR n 2 51 ALA n 2 52 CYS n 2 53 ILE n 2 54 CYS n 2 55 ALA n 2 56 ASP n 2 57 ALA n 2 58 PRO n 2 59 GLN n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'medicinal leech' _entity_src_gen.gene_src_genus Hirudo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hirudo medicinalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ;baker's yeast ; _entity_src_gen.pdbx_host_org_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4932 _entity_src_gen.host_org_genus Saccharomyces _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name pig _entity_src_nat.pdbx_organism_scientific 'Sus scrofa' _entity_src_nat.pdbx_ncbi_taxonomy_id 9823 _entity_src_nat.genus Sus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion SALIVA _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_db_isoform 1 UNP TRYP_PIG 1 P00761 ? ? ? 2 UNP BDEL_HIRME 2 P82107 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1C9P A 1 ? 223 ? P00761 9 ? 231 ? 16 245 2 2 1C9P B 1 ? 59 ? P82107 1 ? 59 ? 1 59 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1C9P _struct_ref_seq_dif.mon_id IAS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 97 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00761 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 105 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 115 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 IAS 'L-beta-peptide, C-gamma linking' . 'BETA-L-ASPARTIC ACID' 'L-aspartic acid' 'C4 H7 N O4' 133.103 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1C9P _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_percent_sol 43.95 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.1M HEPES, 10% 2-PROPANOL, 20% PEG 4000, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 277 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1998-05-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1C9P _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 10 _reflns.d_resolution_high 2.8 _reflns.number_obs ? _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.096 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 6.1 _reflns.B_iso_Wilson_estimate 46.9 _reflns.pdbx_redundancy 4.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.8 _reflns_shell.d_res_low 2.9 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.28 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 4.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1C9P _refine.ls_number_reflns_obs 6481 _refine.ls_number_reflns_all 6676 _refine.pdbx_ls_sigma_I 2.0 _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 2.8 _refine.ls_percent_reflns_obs 86.6 _refine.ls_R_factor_obs 0.19 _refine.ls_R_factor_all 0.191 _refine.ls_R_factor_R_work 0.185 _refine.ls_R_factor_R_free 0.227 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10 _refine.ls_number_reflns_R_free 697 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'ASP 115 HAS BEEN REFINED USING A NEW CREATED TOP AND PAR' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH & HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2004 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 135 _refine_hist.number_atoms_total 2140 _refine_hist.d_res_high 2.8 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.466 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1C9P _struct.title 'COMPLEX OF BDELLASTASIN WITH PORCINE TRYPSIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1C9P _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' _struct_keywords.text 'COMPLEX (HYDROLASE-INHIBITOR), HYDROLASE, INHIBITOR, ANTISTASIN, PLASMIN, ISOASPARTATE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 38 ? TYR A 42 ? ALA A 55 TYR A 59 5 ? 5 HELX_P HELX_P2 2 SER A 144 ? TYR A 152 ? SER A 164 TYR A 172 1 ? 9 HELX_P HELX_P3 3 TYR A 212 ? ASN A 223 ? TYR A 234 ASN A 245 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 22 A CYS 157 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.039 ? ? disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.041 ? ? disulf7 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 21 SG ? ? B CYS 10 B CYS 21 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf8 disulf ? ? B CYS 15 SG ? ? ? 1_555 B CYS 26 SG ? ? B CYS 15 B CYS 26 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf9 disulf ? ? B CYS 28 SG ? ? ? 1_555 B CYS 48 SG ? ? B CYS 28 B CYS 48 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf10 disulf ? ? B CYS 33 SG ? ? ? 1_555 B CYS 52 SG ? ? B CYS 33 B CYS 52 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf11 disulf ? ? B CYS 37 SG ? ? ? 1_555 B CYS 54 SG ? ? B CYS 37 B CYS 54 1_555 ? ? ? ? ? ? ? 2.027 ? ? covale1 covale both ? A LEU 96 C ? ? ? 1_555 A IAS 97 N ? ? A LEU 114 A IAS 115 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A IAS 97 CG ? ? ? 1_555 A SER 98 N ? ? A IAS 115 A SER 116 1_555 ? ? ? ? ? ? ? 1.330 ? ? metalc1 metalc ? ? A GLU 52 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 70 A CA 501 1_555 ? ? ? ? ? ? ? 2.424 ? ? metalc2 metalc ? ? A ASN 54 O ? ? ? 1_555 C CA . CA ? ? A ASN 72 A CA 501 1_555 ? ? ? ? ? ? ? 2.272 ? ? metalc3 metalc ? ? A VAL 57 O ? ? ? 1_555 C CA . CA ? ? A VAL 75 A CA 501 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc4 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 80 A CA 501 1_555 ? ? ? ? ? ? ? 2.748 ? ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 501 A HOH 590 1_555 ? ? ? ? ? ? ? 3.350 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? A1 ? 4 ? B ? 7 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A1 1 2 ? anti-parallel A1 2 3 ? anti-parallel A1 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 160 ? VAL A 163 ? MET A 180 VAL A 183 A 2 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 A 3 GLN A 186 ? TYR A 195 ? GLN A 204 TYR A 217 A 4 PRO A 180 ? CYS A 183 ? PRO A 198 CYS A 201 A 5 GLU A 115 ? GLY A 120 ? GLU A 135 GLY A 140 A 6 GLN A 136 ? PRO A 141 ? GLN A 156 PRO A 161 A 7 TYR A 5 ? THR A 6 ? TYR A 20 THR A 21 A1 1 MET A 160 ? VAL A 163 ? MET A 180 VAL A 183 A1 2 GLY A 204 ? LYS A 208 ? GLY A 226 LYS A 230 A1 3 GLN A 186 ? TYR A 195 ? GLN A 204 TYR A 217 A1 4 LEU B 31 ? CYS B 33 ? LEU B 31 CYS B 33 B 1 GLN A 15 ? ASN A 19 ? GLN A 30 ASN A 34 B 2 HIS A 23 ? ASN A 31 ? HIS A 40 ASN A 48 B 3 GLN A 15 ? ASN A 19 ? GLN A 30 ASN A 34 B 4 GLN A 47 ? LEU A 50 ? GLN A 64 LEU A 67 B 5 GLN A 63 ? THR A 72 ? GLN A 81 THR A 90 B 6 MET A 86 ? LEU A 90 ? MET A 104 LEU A 108 B 7 TRP A 34 ? SER A 37 ? TRP A 51 SER A 54 C 1 MET B 20 ? GLU B 22 ? MET B 20 GLU B 22 C 2 LYS B 25 ? VAL B 27 ? LYS B 25 VAL B 27 D 1 PHE B 41 ? LYS B 43 ? PHE B 41 LYS B 43 D 2 GLU B 49 ? CYS B 54 ? GLU B 49 CYS B 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 163 ? N VAL A 183 O GLY A 204 ? O GLY A 226 A 2 3 N THR A 207 ? N THR A 229 O ILE A 190 ? O ILE A 212 A 3 4 N GLN A 188 ? N GLN A 210 O VAL A 181 ? O VAL A 199 A 4 5 O VAL A 182 ? O VAL A 200 N LEU A 117 ? N LEU A 137 A 5 6 O GLY A 120 ? O GLY A 140 N GLN A 136 ? N GLN A 156 A 6 7 N CYS A 137 ? N CYS A 157 O TYR A 5 ? O TYR A 20 A1 1 2 N VAL A 163 ? N VAL A 183 O GLY A 204 ? O GLY A 226 A1 2 3 N THR A 207 ? N THR A 229 O ILE A 190 ? O ILE A 212 A1 3 4 O GLY A 194 ? O GLY A 216 N HIS B 32 ? N HIS B 32 B 1 2 O LEU A 18 ? O LEU A 33 N PHE A 24 ? N PHE A 41 B 2 3 O GLY A 27 ? O GLY A 44 N VAL A 16 ? N VAL A 31 B 3 4 O ASN A 19 ? O ASN A 34 N GLN A 47 ? N GLN A 64 B 4 5 N LEU A 50 ? N LEU A 67 O GLN A 63 ? O GLN A 81 B 5 6 N ILE A 71 ? N ILE A 89 O LEU A 87 ? O LEU A 105 B 6 7 N ILE A 88 ? N ILE A 106 O VAL A 35 ? O VAL A 52 C 1 2 N GLU B 22 ? N GLU B 22 O LYS B 25 ? O LYS B 25 D 1 2 O LYS B 42 ? O LYS B 42 N TYR B 50 ? N TYR B 50 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 501 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 52 ? GLU A 70 . ? 1_555 ? 2 AC1 4 ASN A 54 ? ASN A 72 . ? 1_555 ? 3 AC1 4 VAL A 57 ? VAL A 75 . ? 1_555 ? 4 AC1 4 GLU A 62 ? GLU A 80 . ? 1_555 ? # _database_PDB_matrix.entry_id 1C9P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1C9P _atom_sites.fract_transf_matrix[1][1] 0.015790 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015790 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007656 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 16 16 ILE ILE A . n A 1 2 VAL 2 17 17 VAL VAL A . n A 1 3 GLY 3 18 18 GLY GLY A . n A 1 4 GLY 4 19 19 GLY GLY A . n A 1 5 TYR 5 20 20 TYR TYR A . n A 1 6 THR 6 21 21 THR THR A . n A 1 7 CYS 7 22 22 CYS CYS A . n A 1 8 ALA 8 23 23 ALA ALA A . n A 1 9 ALA 9 24 24 ALA ALA A . n A 1 10 ASN 10 25 25 ASN ASN A . n A 1 11 SER 11 26 26 SER SER A . n A 1 12 ILE 12 27 27 ILE ILE A . n A 1 13 PRO 13 28 28 PRO PRO A . n A 1 14 TYR 14 29 29 TYR TYR A . n A 1 15 GLN 15 30 30 GLN GLN A . n A 1 16 VAL 16 31 31 VAL VAL A . n A 1 17 SER 17 32 32 SER SER A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 ASN 19 34 34 ASN ASN A . n A 1 20 SER 20 37 37 SER SER A . n A 1 21 GLY 21 38 38 GLY GLY A . n A 1 22 SER 22 39 39 SER SER A . n A 1 23 HIS 23 40 40 HIS HIS A . n A 1 24 PHE 24 41 41 PHE PHE A . n A 1 25 CYS 25 42 42 CYS CYS A . n A 1 26 GLY 26 43 43 GLY GLY A . n A 1 27 GLY 27 44 44 GLY GLY A . n A 1 28 SER 28 45 45 SER SER A . n A 1 29 LEU 29 46 46 LEU LEU A . n A 1 30 ILE 30 47 47 ILE ILE A . n A 1 31 ASN 31 48 48 ASN ASN A . n A 1 32 SER 32 49 49 SER SER A . n A 1 33 GLN 33 50 50 GLN GLN A . n A 1 34 TRP 34 51 51 TRP TRP A . n A 1 35 VAL 35 52 52 VAL VAL A . n A 1 36 VAL 36 53 53 VAL VAL A . n A 1 37 SER 37 54 54 SER SER A . n A 1 38 ALA 38 55 55 ALA ALA A . n A 1 39 ALA 39 56 56 ALA ALA A . n A 1 40 HIS 40 57 57 HIS HIS A . n A 1 41 CYS 41 58 58 CYS CYS A . n A 1 42 TYR 42 59 59 TYR TYR A . n A 1 43 LYS 43 60 60 LYS LYS A . n A 1 44 SER 44 61 61 SER SER A . n A 1 45 ARG 45 62 62 ARG ARG A . n A 1 46 ILE 46 63 63 ILE ILE A . n A 1 47 GLN 47 64 64 GLN GLN A . n A 1 48 VAL 48 65 65 VAL VAL A . n A 1 49 ARG 49 66 66 ARG ARG A . n A 1 50 LEU 50 67 67 LEU LEU A . n A 1 51 GLY 51 69 69 GLY GLY A . n A 1 52 GLU 52 70 70 GLU GLU A . n A 1 53 HIS 53 71 71 HIS HIS A . n A 1 54 ASN 54 72 72 ASN ASN A . n A 1 55 ILE 55 73 73 ILE ILE A . n A 1 56 ASP 56 74 74 ASP ASP A . n A 1 57 VAL 57 75 75 VAL VAL A . n A 1 58 LEU 58 76 76 LEU LEU A . n A 1 59 GLU 59 77 77 GLU GLU A . n A 1 60 GLY 60 78 78 GLY GLY A . n A 1 61 ASN 61 79 79 ASN ASN A . n A 1 62 GLU 62 80 80 GLU GLU A . n A 1 63 GLN 63 81 81 GLN GLN A . n A 1 64 PHE 64 82 82 PHE PHE A . n A 1 65 ILE 65 83 83 ILE ILE A . n A 1 66 ASN 66 84 84 ASN ASN A . n A 1 67 ALA 67 85 85 ALA ALA A . n A 1 68 ALA 68 86 86 ALA ALA A . n A 1 69 LYS 69 87 87 LYS LYS A . n A 1 70 ILE 70 88 88 ILE ILE A . n A 1 71 ILE 71 89 89 ILE ILE A . n A 1 72 THR 72 90 90 THR THR A . n A 1 73 HIS 73 91 91 HIS HIS A . n A 1 74 PRO 74 92 92 PRO PRO A . n A 1 75 ASN 75 93 93 ASN ASN A . n A 1 76 PHE 76 94 94 PHE PHE A . n A 1 77 ASN 77 95 95 ASN ASN A . n A 1 78 GLY 78 96 96 GLY GLY A . n A 1 79 ASN 79 97 97 ASN ASN A . n A 1 80 THR 80 98 98 THR THR A . n A 1 81 LEU 81 99 99 LEU LEU A . n A 1 82 ASP 82 100 100 ASP ASP A . n A 1 83 ASN 83 101 101 ASN ASN A . n A 1 84 ASP 84 102 102 ASP ASP A . n A 1 85 ILE 85 103 103 ILE ILE A . n A 1 86 MET 86 104 104 MET MET A . n A 1 87 LEU 87 105 105 LEU LEU A . n A 1 88 ILE 88 106 106 ILE ILE A . n A 1 89 LYS 89 107 107 LYS LYS A . n A 1 90 LEU 90 108 108 LEU LEU A . n A 1 91 SER 91 109 109 SER SER A . n A 1 92 SER 92 110 110 SER SER A . n A 1 93 PRO 93 111 111 PRO PRO A . n A 1 94 ALA 94 112 112 ALA ALA A . n A 1 95 THR 95 113 113 THR THR A . n A 1 96 LEU 96 114 114 LEU LEU A . n A 1 97 IAS 97 115 115 IAS ASP A . n A 1 98 SER 98 116 116 SER SER A . n A 1 99 ARG 99 117 117 ARG ARG A . n A 1 100 VAL 100 118 118 VAL VAL A . n A 1 101 ALA 101 119 119 ALA ALA A . n A 1 102 THR 102 120 120 THR THR A . n A 1 103 VAL 103 121 121 VAL VAL A . n A 1 104 SER 104 122 122 SER SER A . n A 1 105 LEU 105 123 123 LEU LEU A . n A 1 106 PRO 106 124 124 PRO PRO A . n A 1 107 ARG 107 125 125 ARG ARG A . n A 1 108 SER 108 127 127 SER SER A . n A 1 109 CYS 109 128 128 CYS CYS A . n A 1 110 ALA 110 129 129 ALA ALA A . n A 1 111 ALA 111 130 130 ALA ALA A . n A 1 112 ALA 112 132 132 ALA ALA A . n A 1 113 GLY 113 133 133 GLY GLY A . n A 1 114 THR 114 134 134 THR THR A . n A 1 115 GLU 115 135 135 GLU GLU A . n A 1 116 CYS 116 136 136 CYS CYS A . n A 1 117 LEU 117 137 137 LEU LEU A . n A 1 118 ILE 118 138 138 ILE ILE A . n A 1 119 SER 119 139 139 SER SER A . n A 1 120 GLY 120 140 140 GLY GLY A . n A 1 121 TRP 121 141 141 TRP TRP A . n A 1 122 GLY 122 142 142 GLY GLY A . n A 1 123 ASN 123 143 143 ASN ASN A . n A 1 124 THR 124 144 144 THR THR A . n A 1 125 LYS 125 145 145 LYS LYS A . n A 1 126 SER 126 146 146 SER SER A . n A 1 127 SER 127 147 147 SER SER A . n A 1 128 GLY 128 148 148 GLY GLY A . n A 1 129 SER 129 149 149 SER SER A . n A 1 130 SER 130 150 150 SER SER A . n A 1 131 TYR 131 151 151 TYR TYR A . n A 1 132 PRO 132 152 152 PRO PRO A . n A 1 133 SER 133 153 153 SER SER A . n A 1 134 LEU 134 154 154 LEU LEU A . n A 1 135 LEU 135 155 155 LEU LEU A . n A 1 136 GLN 136 156 156 GLN GLN A . n A 1 137 CYS 137 157 157 CYS CYS A . n A 1 138 LEU 138 158 158 LEU LEU A . n A 1 139 LYS 139 159 159 LYS LYS A . n A 1 140 ALA 140 160 160 ALA ALA A . n A 1 141 PRO 141 161 161 PRO PRO A . n A 1 142 VAL 142 162 162 VAL VAL A . n A 1 143 LEU 143 163 163 LEU LEU A . n A 1 144 SER 144 164 164 SER SER A . n A 1 145 ASP 145 165 165 ASP ASP A . n A 1 146 SER 146 166 166 SER SER A . n A 1 147 SER 147 167 167 SER SER A . n A 1 148 CYS 148 168 168 CYS CYS A . n A 1 149 LYS 149 169 169 LYS LYS A . n A 1 150 SER 150 170 170 SER SER A . n A 1 151 SER 151 171 171 SER SER A . n A 1 152 TYR 152 172 172 TYR TYR A . n A 1 153 PRO 153 173 173 PRO PRO A . n A 1 154 GLY 154 174 174 GLY GLY A . n A 1 155 GLN 155 175 175 GLN GLN A . n A 1 156 ILE 156 176 176 ILE ILE A . n A 1 157 THR 157 177 177 THR THR A . n A 1 158 GLY 158 178 178 GLY GLY A . n A 1 159 ASN 159 179 179 ASN ASN A . n A 1 160 MET 160 180 180 MET MET A . n A 1 161 ILE 161 181 181 ILE ILE A . n A 1 162 CYS 162 182 182 CYS CYS A . n A 1 163 VAL 163 183 183 VAL VAL A . n A 1 164 GLY 164 184 184 GLY GLY A . n A 1 165 PHE 165 184 184 PHE PHE A B n A 1 166 LEU 166 185 185 LEU LEU A . n A 1 167 GLU 167 186 186 GLU GLU A . n A 1 168 GLY 168 187 187 GLY GLY A . n A 1 169 GLY 169 188 188 GLY GLY A . n A 1 170 LYS 170 188 188 LYS LYS A B n A 1 171 ASP 171 189 189 ASP ASP A . n A 1 172 SER 172 190 190 SER SER A . n A 1 173 CYS 173 191 191 CYS CYS A . n A 1 174 GLN 174 192 192 GLN GLN A . n A 1 175 GLY 175 193 193 GLY GLY A . n A 1 176 ASP 176 194 194 ASP ASP A . n A 1 177 SER 177 195 195 SER SER A . n A 1 178 GLY 178 196 196 GLY GLY A . n A 1 179 GLY 179 197 197 GLY GLY A . n A 1 180 PRO 180 198 198 PRO PRO A . n A 1 181 VAL 181 199 199 VAL VAL A . n A 1 182 VAL 182 200 200 VAL VAL A . n A 1 183 CYS 183 201 201 CYS CYS A . n A 1 184 ASN 184 202 202 ASN ASN A . n A 1 185 GLY 185 203 203 GLY GLY A . n A 1 186 GLN 186 204 204 GLN GLN A . n A 1 187 LEU 187 209 209 LEU LEU A . n A 1 188 GLN 188 210 210 GLN GLN A . n A 1 189 GLY 189 211 211 GLY GLY A . n A 1 190 ILE 190 212 212 ILE ILE A . n A 1 191 VAL 191 213 213 VAL VAL A . n A 1 192 SER 192 214 214 SER SER A . n A 1 193 TRP 193 215 215 TRP TRP A . n A 1 194 GLY 194 216 216 GLY GLY A . n A 1 195 TYR 195 217 217 TYR TYR A . n A 1 196 GLY 196 219 219 GLY GLY A . n A 1 197 CYS 197 220 220 CYS CYS A . n A 1 198 ALA 198 221 221 ALA ALA A . n A 1 199 GLN 199 221 221 GLN GLN A B n A 1 200 LYS 200 222 222 LYS LYS A . n A 1 201 ASN 201 223 223 ASN ASN A . n A 1 202 LYS 202 224 224 LYS LYS A . n A 1 203 PRO 203 225 225 PRO PRO A . n A 1 204 GLY 204 226 226 GLY GLY A . n A 1 205 VAL 205 227 227 VAL VAL A . n A 1 206 TYR 206 228 228 TYR TYR A . n A 1 207 THR 207 229 229 THR THR A . n A 1 208 LYS 208 230 230 LYS LYS A . n A 1 209 VAL 209 231 231 VAL VAL A . n A 1 210 CYS 210 232 232 CYS CYS A . n A 1 211 ASN 211 233 233 ASN ASN A . n A 1 212 TYR 212 234 234 TYR TYR A . n A 1 213 VAL 213 235 235 VAL VAL A . n A 1 214 ASN 214 236 236 ASN ASN A . n A 1 215 TRP 215 237 237 TRP TRP A . n A 1 216 ILE 216 238 238 ILE ILE A . n A 1 217 GLN 217 239 239 GLN GLN A . n A 1 218 GLN 218 240 240 GLN GLN A . n A 1 219 THR 219 241 241 THR THR A . n A 1 220 ILE 220 242 242 ILE ILE A . n A 1 221 ALA 221 243 243 ALA ALA A . n A 1 222 ALA 222 244 244 ALA ALA A . n A 1 223 ASN 223 245 245 ASN ASN A . n B 2 1 PHE 1 1 ? ? ? B . n B 2 2 ASP 2 2 ? ? ? B . n B 2 3 VAL 3 3 ? ? ? B . n B 2 4 ASN 4 4 ? ? ? B . n B 2 5 SER 5 5 ? ? ? B . n B 2 6 HIS 6 6 ? ? ? B . n B 2 7 THR 7 7 ? ? ? B . n B 2 8 THR 8 8 ? ? ? B . n B 2 9 PRO 9 9 ? ? ? B . n B 2 10 CYS 10 10 10 CYS CYS B . n B 2 11 GLY 11 11 11 GLY GLY B . n B 2 12 PRO 12 12 12 PRO PRO B . n B 2 13 VAL 13 13 13 VAL VAL B . n B 2 14 THR 14 14 14 THR THR B . n B 2 15 CYS 15 15 15 CYS CYS B . n B 2 16 SER 16 16 16 SER SER B . n B 2 17 GLY 17 17 17 GLY GLY B . n B 2 18 ALA 18 18 18 ALA ALA B . n B 2 19 GLN 19 19 19 GLN GLN B . n B 2 20 MET 20 20 20 MET MET B . n B 2 21 CYS 21 21 21 CYS CYS B . n B 2 22 GLU 22 22 22 GLU GLU B . n B 2 23 VAL 23 23 23 VAL VAL B . n B 2 24 ASP 24 24 24 ASP ASP B . n B 2 25 LYS 25 25 25 LYS LYS B . n B 2 26 CYS 26 26 26 CYS CYS B . n B 2 27 VAL 27 27 27 VAL VAL B . n B 2 28 CYS 28 28 28 CYS CYS B . n B 2 29 SER 29 29 29 SER SER B . n B 2 30 ASP 30 30 30 ASP ASP B . n B 2 31 LEU 31 31 31 LEU LEU B . n B 2 32 HIS 32 32 32 HIS HIS B . n B 2 33 CYS 33 33 33 CYS CYS B . n B 2 34 LYS 34 34 34 LYS LYS B . n B 2 35 VAL 35 35 35 VAL VAL B . n B 2 36 LYS 36 36 36 LYS LYS B . n B 2 37 CYS 37 37 37 CYS CYS B . n B 2 38 GLU 38 38 38 GLU GLU B . n B 2 39 HIS 39 39 39 HIS HIS B . n B 2 40 GLY 40 40 40 GLY GLY B . n B 2 41 PHE 41 41 41 PHE PHE B . n B 2 42 LYS 42 42 42 LYS LYS B . n B 2 43 LYS 43 43 43 LYS LYS B . n B 2 44 ASP 44 44 44 ASP ASP B . n B 2 45 ASP 45 45 45 ASP ASP B . n B 2 46 ASN 46 46 46 ASN ASN B . n B 2 47 GLY 47 47 47 GLY GLY B . n B 2 48 CYS 48 48 48 CYS CYS B . n B 2 49 GLU 49 49 49 GLU GLU B . n B 2 50 TYR 50 50 50 TYR TYR B . n B 2 51 ALA 51 51 51 ALA ALA B . n B 2 52 CYS 52 52 52 CYS CYS B . n B 2 53 ILE 53 53 53 ILE ILE B . n B 2 54 CYS 54 54 54 CYS CYS B . n B 2 55 ALA 55 55 55 ALA ALA B . n B 2 56 ASP 56 56 56 ASP ASP B . n B 2 57 ALA 57 57 57 ALA ALA B . n B 2 58 PRO 58 58 58 PRO PRO B . n B 2 59 GLN 59 59 59 GLN GLN B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 501 1 CA CA A . D 4 HOH 1 502 1 HOH HOH A . D 4 HOH 2 503 2 HOH HOH A . D 4 HOH 3 504 3 HOH HOH A . D 4 HOH 4 505 4 HOH HOH A . D 4 HOH 5 506 5 HOH HOH A . D 4 HOH 6 507 6 HOH HOH A . D 4 HOH 7 508 7 HOH HOH A . D 4 HOH 8 509 8 HOH HOH A . D 4 HOH 9 510 9 HOH HOH A . D 4 HOH 10 511 10 HOH HOH A . D 4 HOH 11 512 11 HOH HOH A . D 4 HOH 12 513 12 HOH HOH A . D 4 HOH 13 514 13 HOH HOH A . D 4 HOH 14 515 14 HOH HOH A . D 4 HOH 15 516 15 HOH HOH A . D 4 HOH 16 517 16 HOH HOH A . D 4 HOH 17 518 17 HOH HOH A . D 4 HOH 18 519 19 HOH HOH A . D 4 HOH 19 520 21 HOH HOH A . D 4 HOH 20 521 22 HOH HOH A . D 4 HOH 21 522 23 HOH HOH A . D 4 HOH 22 523 24 HOH HOH A . D 4 HOH 23 524 25 HOH HOH A . D 4 HOH 24 525 26 HOH HOH A . D 4 HOH 25 526 27 HOH HOH A . D 4 HOH 26 527 28 HOH HOH A . D 4 HOH 27 528 29 HOH HOH A . D 4 HOH 28 529 30 HOH HOH A . D 4 HOH 29 530 31 HOH HOH A . D 4 HOH 30 531 32 HOH HOH A . D 4 HOH 31 532 33 HOH HOH A . D 4 HOH 32 533 34 HOH HOH A . D 4 HOH 33 534 35 HOH HOH A . D 4 HOH 34 535 36 HOH HOH A . D 4 HOH 35 536 37 HOH HOH A . D 4 HOH 36 537 38 HOH HOH A . D 4 HOH 37 538 39 HOH HOH A . D 4 HOH 38 539 40 HOH HOH A . D 4 HOH 39 540 41 HOH HOH A . D 4 HOH 40 541 42 HOH HOH A . D 4 HOH 41 542 43 HOH HOH A . D 4 HOH 42 543 44 HOH HOH A . D 4 HOH 43 544 45 HOH HOH A . D 4 HOH 44 545 46 HOH HOH A . D 4 HOH 45 546 47 HOH HOH A . D 4 HOH 46 547 48 HOH HOH A . D 4 HOH 47 548 49 HOH HOH A . D 4 HOH 48 549 51 HOH HOH A . D 4 HOH 49 550 55 HOH HOH A . D 4 HOH 50 551 56 HOH HOH A . D 4 HOH 51 552 57 HOH HOH A . D 4 HOH 52 553 58 HOH HOH A . D 4 HOH 53 554 59 HOH HOH A . D 4 HOH 54 555 60 HOH HOH A . D 4 HOH 55 556 61 HOH HOH A . D 4 HOH 56 557 62 HOH HOH A . D 4 HOH 57 558 63 HOH HOH A . D 4 HOH 58 559 64 HOH HOH A . D 4 HOH 59 560 65 HOH HOH A . D 4 HOH 60 561 66 HOH HOH A . D 4 HOH 61 562 67 HOH HOH A . D 4 HOH 62 563 68 HOH HOH A . D 4 HOH 63 564 69 HOH HOH A . D 4 HOH 64 565 70 HOH HOH A . D 4 HOH 65 566 71 HOH HOH A . D 4 HOH 66 567 72 HOH HOH A . D 4 HOH 67 568 73 HOH HOH A . D 4 HOH 68 569 74 HOH HOH A . D 4 HOH 69 570 75 HOH HOH A . D 4 HOH 70 571 76 HOH HOH A . D 4 HOH 71 572 77 HOH HOH A . D 4 HOH 72 573 78 HOH HOH A . D 4 HOH 73 574 79 HOH HOH A . D 4 HOH 74 575 80 HOH HOH A . D 4 HOH 75 576 81 HOH HOH A . D 4 HOH 76 577 82 HOH HOH A . D 4 HOH 77 578 83 HOH HOH A . D 4 HOH 78 579 84 HOH HOH A . D 4 HOH 79 580 85 HOH HOH A . D 4 HOH 80 581 86 HOH HOH A . D 4 HOH 81 582 87 HOH HOH A . D 4 HOH 82 583 88 HOH HOH A . D 4 HOH 83 584 90 HOH HOH A . D 4 HOH 84 585 91 HOH HOH A . D 4 HOH 85 586 92 HOH HOH A . D 4 HOH 86 587 93 HOH HOH A . D 4 HOH 87 588 94 HOH HOH A . D 4 HOH 88 589 95 HOH HOH A . D 4 HOH 89 590 96 HOH HOH A . D 4 HOH 90 591 97 HOH HOH A . D 4 HOH 91 592 98 HOH HOH A . D 4 HOH 92 593 99 HOH HOH A . D 4 HOH 93 594 100 HOH HOH A . D 4 HOH 94 595 101 HOH HOH A . D 4 HOH 95 596 102 HOH HOH A . D 4 HOH 96 597 103 HOH HOH A . D 4 HOH 97 598 105 HOH HOH A . D 4 HOH 98 599 106 HOH HOH A . D 4 HOH 99 600 107 HOH HOH A . D 4 HOH 100 601 108 HOH HOH A . D 4 HOH 101 602 109 HOH HOH A . D 4 HOH 102 603 112 HOH HOH A . D 4 HOH 103 604 113 HOH HOH A . D 4 HOH 104 605 114 HOH HOH A . D 4 HOH 105 606 115 HOH HOH A . D 4 HOH 106 607 116 HOH HOH A . D 4 HOH 107 608 117 HOH HOH A . D 4 HOH 108 609 118 HOH HOH A . D 4 HOH 109 610 119 HOH HOH A . D 4 HOH 110 611 120 HOH HOH A . D 4 HOH 111 612 121 HOH HOH A . D 4 HOH 112 613 122 HOH HOH A . D 4 HOH 113 614 123 HOH HOH A . D 4 HOH 114 615 124 HOH HOH A . D 4 HOH 115 616 125 HOH HOH A . D 4 HOH 116 617 126 HOH HOH A . D 4 HOH 117 618 127 HOH HOH A . D 4 HOH 118 619 128 HOH HOH A . D 4 HOH 119 620 130 HOH HOH A . D 4 HOH 120 621 131 HOH HOH A . E 4 HOH 1 60 18 HOH HOH B . E 4 HOH 2 61 20 HOH HOH B . E 4 HOH 3 62 50 HOH HOH B . E 4 HOH 4 63 52 HOH HOH B . E 4 HOH 5 64 53 HOH HOH B . E 4 HOH 6 65 54 HOH HOH B . E 4 HOH 7 66 89 HOH HOH B . E 4 HOH 8 67 104 HOH HOH B . E 4 HOH 9 68 110 HOH HOH B . E 4 HOH 10 69 111 HOH HOH B . E 4 HOH 11 70 129 HOH HOH B . E 4 HOH 12 71 132 HOH HOH B . E 4 HOH 13 72 133 HOH HOH B . E 4 HOH 14 73 134 HOH HOH B . E 4 HOH 15 74 135 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1380 ? 1 MORE -21 ? 1 'SSA (A^2)' 11740 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A ASN 54 ? A ASN 72 ? 1_555 109.1 ? 2 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 165.2 ? 3 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A VAL 57 ? A VAL 75 ? 1_555 78.7 ? 4 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 92.5 ? 5 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 155.4 ? 6 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 82.9 ? 7 OE1 ? A GLU 52 ? A GLU 70 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? D HOH . ? A HOH 590 ? 1_555 77.5 ? 8 O ? A ASN 54 ? A ASN 72 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? D HOH . ? A HOH 590 ? 1_555 98.0 ? 9 O ? A VAL 57 ? A VAL 75 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? D HOH . ? A HOH 590 ? 1_555 89.2 ? 10 OE2 ? A GLU 62 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? D HOH . ? A HOH 590 ? 1_555 97.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-03 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-07-27 5 'Structure model' 1 4 2017-10-04 6 'Structure model' 1 5 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Non-polymer description' 6 5 'Structure model' Advisory 7 5 'Structure model' 'Refinement description' 8 6 'Structure model' Advisory 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' pdbx_unobs_or_zero_occ_atoms 2 5 'Structure model' pdbx_unobs_or_zero_occ_residues 3 5 'Structure model' pdbx_validate_polymer_linkage 4 5 'Structure model' software 5 6 'Structure model' database_2 6 6 'Structure model' pdbx_struct_conn_angle 7 6 'Structure model' pdbx_unobs_or_zero_occ_atoms 8 6 'Structure model' pdbx_unobs_or_zero_occ_residues 9 6 'Structure model' struct_conn 10 6 'Structure model' struct_ref_seq_dif 11 6 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 6 'Structure model' '_database_2.pdbx_DOI' 2 6 'Structure model' '_database_2.pdbx_database_accession' 3 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 6 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 6 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 6 'Structure model' '_pdbx_struct_conn_angle.value' 16 6 'Structure model' '_struct_conn.pdbx_dist_value' 17 6 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 18 6 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 6 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 6 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 6 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 6 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 6 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 6 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 6 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 6 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 6 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 6 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 6 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 6 'Structure model' '_struct_ref_seq_dif.details' 31 6 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 6 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 6 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 ROTAVATA 'data reduction' . ? 2 Agrovata 'data reduction' . ? 3 AMoRE phasing . ? 4 CNS refinement . ? 5 CCP4 'data scaling' '(AGROVATA' ? 6 ROTAVATA 'data scaling' . ? 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 25 ? ? -106.98 42.84 2 1 SER A 37 ? ? -146.21 49.34 3 1 SER A 49 ? ? -48.67 -13.14 4 1 HIS A 71 ? ? -126.08 -61.17 5 1 SER A 147 ? ? -146.48 -50.09 6 1 SER A 214 ? ? -125.63 -86.52 7 1 VAL B 23 ? ? 68.48 -75.67 8 1 VAL B 27 ? ? -89.14 -146.03 9 1 CYS B 28 ? ? -151.52 -159.63 10 1 LYS B 34 ? ? -91.07 45.39 11 1 ASP B 45 ? ? -3.56 -54.25 12 1 PRO B 58 ? ? -68.59 -173.67 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ALA 24 ? CB ? A ALA 9 CB 2 1 Y 0 A ASN 25 ? CB ? A ASN 10 CB 3 1 Y 0 A ASN 25 ? OD1 ? A ASN 10 OD1 4 1 Y 0 A ASN 25 ? ND2 ? A ASN 10 ND2 5 1 Y 0 A ARG 62 ? CZ ? A ARG 45 CZ 6 1 Y 0 A ARG 62 ? NH1 ? A ARG 45 NH1 7 1 Y 0 A ARG 62 ? NH2 ? A ARG 45 NH2 8 1 Y 0 A ARG 117 ? CB ? A ARG 99 CB 9 1 Y 0 A ARG 117 ? CG ? A ARG 99 CG 10 1 Y 0 A ARG 117 ? CD ? A ARG 99 CD 11 1 Y 0 A ARG 117 ? NE ? A ARG 99 NE 12 1 Y 0 A ARG 117 ? CZ ? A ARG 99 CZ 13 1 Y 0 A ARG 117 ? NH1 ? A ARG 99 NH1 14 1 Y 0 A ARG 117 ? NH2 ? A ARG 99 NH2 15 1 Y 0 A ARG 125 ? CG ? A ARG 107 CG 16 1 Y 0 A ARG 125 ? CD ? A ARG 107 CD 17 1 Y 0 A ARG 125 ? NE ? A ARG 107 NE 18 1 Y 0 A ARG 125 ? CZ ? A ARG 107 CZ 19 1 Y 0 A ARG 125 ? NH1 ? A ARG 107 NH1 20 1 Y 0 A ARG 125 ? NH2 ? A ARG 107 NH2 21 1 Y 0 A SER 127 ? CB ? A SER 108 CB 22 1 Y 0 A SER 127 ? OG ? A SER 108 OG 23 1 Y 0 A GLU 135 ? CD ? A GLU 115 CD 24 1 Y 0 A GLU 135 ? OE1 ? A GLU 115 OE1 25 1 Y 0 A GLU 135 ? OE2 ? A GLU 115 OE2 26 1 Y 0 A LYS 159 ? CE ? A LYS 139 CE 27 1 Y 0 A LYS 159 ? NZ ? A LYS 139 NZ 28 1 Y 0 A SER 170 ? OG ? A SER 150 OG 29 1 Y 0 A ASN 202 ? CB ? A ASN 184 CB 30 1 Y 0 A TYR 217 ? CD2 ? A TYR 195 CD2 31 1 Y 0 A TYR 217 ? CE2 ? A TYR 195 CE2 32 1 Y 0 A TYR 217 ? CZ ? A TYR 195 CZ 33 1 Y 0 A TYR 217 ? OH ? A TYR 195 OH 34 1 Y 0 A GLN 240 ? CG ? A GLN 218 CG 35 1 Y 0 A GLN 240 ? CD ? A GLN 218 CD 36 1 Y 0 A GLN 240 ? OE1 ? A GLN 218 OE1 37 1 Y 0 A GLN 240 ? NE2 ? A GLN 218 NE2 38 1 Y 0 B GLY 17 ? N ? B GLY 17 N 39 1 Y 0 B GLY 17 ? CA ? B GLY 17 CA 40 1 Y 0 B GLY 17 ? O ? B GLY 17 O 41 1 Y 0 B CYS 28 ? C ? B CYS 28 C 42 1 Y 0 B CYS 28 ? O ? B CYS 28 O 43 1 Y 0 B CYS 28 ? CB ? B CYS 28 CB 44 1 Y 0 B CYS 28 ? SG ? B CYS 28 SG 45 1 Y 0 B SER 29 ? N ? B SER 29 N 46 1 Y 0 B SER 29 ? O ? B SER 29 O 47 1 Y 0 B SER 29 ? CB ? B SER 29 CB 48 1 Y 0 B SER 29 ? OG ? B SER 29 OG 49 1 Y 0 B ASP 30 ? N ? B ASP 30 N 50 1 Y 0 B ASP 30 ? CA ? B ASP 30 CA 51 1 Y 0 B ASP 30 ? CB ? B ASP 30 CB 52 1 Y 0 B ASP 30 ? CG ? B ASP 30 CG 53 1 Y 0 B ASP 30 ? OD1 ? B ASP 30 OD1 54 1 Y 0 B ASP 30 ? OD2 ? B ASP 30 OD2 55 1 Y 0 B LEU 31 ? CD1 ? B LEU 31 CD1 56 1 Y 0 B LEU 31 ? CD2 ? B LEU 31 CD2 57 1 Y 0 B CYS 37 ? N ? B CYS 37 N 58 1 Y 0 B CYS 37 ? O ? B CYS 37 O 59 1 Y 0 B GLU 38 ? CB ? B GLU 38 CB 60 1 Y 0 B GLU 38 ? CG ? B GLU 38 CG 61 1 Y 0 B GLU 38 ? CD ? B GLU 38 CD 62 1 Y 0 B GLU 38 ? OE1 ? B GLU 38 OE1 63 1 Y 0 B GLU 38 ? OE2 ? B GLU 38 OE2 64 1 Y 0 B LYS 42 ? O ? B LYS 42 O 65 1 Y 0 B LYS 42 ? CG ? B LYS 42 CG 66 1 Y 0 B LYS 42 ? CD ? B LYS 42 CD 67 1 Y 0 B LYS 42 ? CE ? B LYS 42 CE 68 1 Y 0 B LYS 42 ? NZ ? B LYS 42 NZ 69 1 Y 0 B LYS 43 ? CB ? B LYS 43 CB 70 1 Y 0 B LYS 43 ? CG ? B LYS 43 CG 71 1 Y 0 B LYS 43 ? CD ? B LYS 43 CD 72 1 Y 0 B LYS 43 ? CE ? B LYS 43 CE 73 1 Y 0 B LYS 43 ? NZ ? B LYS 43 NZ 74 1 Y 0 B ASP 44 ? C ? B ASP 44 C 75 1 Y 0 B ASP 44 ? O ? B ASP 44 O 76 1 Y 0 B ASP 44 ? CB ? B ASP 44 CB 77 1 Y 0 B ASP 44 ? CG ? B ASP 44 CG 78 1 Y 0 B ASP 44 ? OD1 ? B ASP 44 OD1 79 1 Y 0 B ASP 44 ? OD2 ? B ASP 44 OD2 80 1 Y 0 B GLY 47 ? N ? B GLY 47 N 81 1 Y 0 B GLY 47 ? CA ? B GLY 47 CA 82 1 Y 0 B GLY 47 ? O ? B GLY 47 O 83 1 Y 0 B CYS 48 ? C ? B CYS 48 C 84 1 Y 0 B CYS 48 ? O ? B CYS 48 O 85 1 Y 0 B GLU 49 ? N ? B GLU 49 N 86 1 Y 0 B TYR 50 ? CD1 ? B TYR 50 CD1 87 1 Y 0 B TYR 50 ? CD2 ? B TYR 50 CD2 88 1 Y 0 B TYR 50 ? CE1 ? B TYR 50 CE1 89 1 Y 0 B TYR 50 ? CE2 ? B TYR 50 CE2 90 1 Y 0 B TYR 50 ? CZ ? B TYR 50 CZ 91 1 Y 0 B TYR 50 ? OH ? B TYR 50 OH 92 1 Y 0 B ILE 53 ? O ? B ILE 53 O 93 1 Y 0 B ILE 53 ? CG1 ? B ILE 53 CG1 94 1 Y 0 B CYS 54 ? CA ? B CYS 54 CA 95 1 Y 0 B CYS 54 ? CB ? B CYS 54 CB 96 1 Y 0 B ALA 55 ? O ? B ALA 55 O 97 1 Y 0 B ASP 56 ? N ? B ASP 56 N 98 1 Y 0 B ASP 56 ? CA ? B ASP 56 CA 99 1 Y 0 B ASP 56 ? C ? B ASP 56 C 100 1 Y 0 B ASP 56 ? O ? B ASP 56 O 101 1 Y 0 B ALA 57 ? N ? B ALA 57 N 102 1 Y 0 B ALA 57 ? O ? B ALA 57 O 103 1 Y 0 B ALA 57 ? CB ? B ALA 57 CB 104 1 Y 0 B PRO 58 ? C ? B PRO 58 C 105 1 Y 0 B PRO 58 ? O ? B PRO 58 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B PHE 1 ? B PHE 1 2 1 Y 1 B ASP 2 ? B ASP 2 3 1 Y 1 B VAL 3 ? B VAL 3 4 1 Y 1 B ASN 4 ? B ASN 4 5 1 Y 1 B SER 5 ? B SER 5 6 1 Y 1 B HIS 6 ? B HIS 6 7 1 Y 1 B THR 7 ? B THR 7 8 1 Y 1 B THR 8 ? B THR 8 9 1 Y 1 B PRO 9 ? B PRO 9 10 1 Y 0 B CYS 10 ? B CYS 10 11 1 Y 0 B GLY 11 ? B GLY 11 12 1 Y 0 B PRO 12 ? B PRO 12 13 1 Y 0 B VAL 13 ? B VAL 13 14 1 Y 0 B THR 14 ? B THR 14 15 1 Y 0 B CYS 15 ? B CYS 15 16 1 Y 0 B SER 16 ? B SER 16 17 1 Y 0 B GLN 19 ? B GLN 19 18 1 Y 0 B MET 20 ? B MET 20 19 1 Y 0 B CYS 21 ? B CYS 21 20 1 Y 0 B GLU 22 ? B GLU 22 21 1 Y 0 B VAL 23 ? B VAL 23 22 1 Y 0 B ASP 24 ? B ASP 24 23 1 Y 0 B LYS 25 ? B LYS 25 24 1 Y 0 B CYS 26 ? B CYS 26 25 1 Y 0 B VAL 27 ? B VAL 27 26 1 Y 0 B ASP 45 ? B ASP 45 27 1 Y 0 B ASN 46 ? B ASN 46 28 1 Y 0 B GLN 59 ? B GLN 59 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 water HOH #