data_1CCD # _entry.id 1CCD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1CCD WWPDB D_1000172225 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CCD _pdbx_database_status.recvd_initial_deposition_date 1991-09-17 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Umland, T.C.' 1 'Swaminathan, S.' 2 'Furey, W.' 3 'Singh, G.' 4 'Pletcher, J.' 5 'Sax, M.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Refined structure of rat Clara cell 17 kDa protein at 3.0 A resolution.' J.Mol.Biol. 224 441 448 1992 JMOBAK UK 0022-2836 0070 ? 1560460 '10.1016/0022-2836(92)91006-B' 1 'Crystallization and Preliminary X-Ray Study of Rat Clara Cell 10,000 MR Protein' J.Mol.Biol. 211 17 ? 1990 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Umland, T.C.' 1 primary 'Swaminathan, S.' 2 primary 'Furey, W.' 3 primary 'Singh, G.' 4 primary 'Pletcher, J.' 5 primary 'Sax, M.' 6 1 'Swaminathan, S.' 7 1 'Furey, W.' 8 1 'Pletcher, J.' 9 1 'Katyal, S.' 10 1 'Singh, G.' 11 1 'Sax, M.' 12 # _cell.entry_id 1CCD _cell.length_a 52.070 _cell.length_b 52.070 _cell.length_c 109.270 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CCD _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CLARA CELL 17 kD PROTEIN' 8475.677 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV _entity_poly.pdbx_seq_one_letter_code_can SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 ASP n 1 4 ILE n 1 5 CYS n 1 6 PRO n 1 7 GLY n 1 8 PHE n 1 9 LEU n 1 10 GLN n 1 11 VAL n 1 12 LEU n 1 13 GLU n 1 14 ALA n 1 15 LEU n 1 16 LEU n 1 17 LEU n 1 18 GLY n 1 19 SER n 1 20 GLU n 1 21 SER n 1 22 ASN n 1 23 TYR n 1 24 GLU n 1 25 ALA n 1 26 ALA n 1 27 LEU n 1 28 LYS n 1 29 PRO n 1 30 PHE n 1 31 ASN n 1 32 PRO n 1 33 ALA n 1 34 SER n 1 35 ASP n 1 36 LEU n 1 37 GLN n 1 38 ASN n 1 39 ALA n 1 40 GLY n 1 41 THR n 1 42 GLN n 1 43 LEU n 1 44 LYS n 1 45 ARG n 1 46 LEU n 1 47 VAL n 1 48 ASP n 1 49 THR n 1 50 LEU n 1 51 PRO n 1 52 GLN n 1 53 GLU n 1 54 THR n 1 55 ARG n 1 56 ILE n 1 57 ASN n 1 58 ILE n 1 59 VAL n 1 60 LYS n 1 61 LEU n 1 62 THR n 1 63 GLU n 1 64 LYS n 1 65 ILE n 1 66 LEU n 1 67 THR n 1 68 SER n 1 69 PRO n 1 70 LEU n 1 71 CYS n 1 72 GLU n 1 73 GLN n 1 74 ASP n 1 75 LEU n 1 76 ARG n 1 77 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'black rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus rattus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10117 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UTER_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P17559 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKIAITITVLMLSICCSSASSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKL TEKILTSPLCEQDLRV ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CCD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P17559 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -2 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1CCD _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_percent_sol 51.21 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1CCD _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 3.0 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.2250000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 594 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 599 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low . # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.016 0.020 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.062 0.045 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.040 0.035 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr 0.009 0.020 ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr 0.284 0.200 ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd 0.216 0.300 ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd 0.248 0.300 ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd 0.174 0.300 ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor 2.6 5.0 ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor 26.3 15.0 ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor 32.2 15.0 ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1CCD _struct.title 'REFINED STRUCTURE OF RAT CLARA CELL 17 KDA PROTEIN AT 3.0 ANGSTROMS RESOLUTION' _struct.pdbx_descriptor 'CLARA CELL 17-KDA PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CCD _struct_keywords.pdbx_keywords 'PHOSPHOLIPASE A2 INHIBITOR' _struct_keywords.text 'PHOSPHOLIPASE A2 INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 PRO A 6 ? LEU A 16 ? PRO A 4 LEU A 14 1 ? 11 HELX_P HELX_P2 H2 GLU A 20 ? LYS A 28 ? GLU A 18 LYS A 26 1 ? 9 HELX_P HELX_P3 H3 SER A 34 ? THR A 49 ? SER A 32 THR A 47 1 ? 16 HELX_P HELX_P4 H4 GLN A 52 ? LEU A 66 ? GLN A 50 LEU A 64 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 5 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 71 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 3 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 69 _struct_conn.ptnr2_symmetry 10_665 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.040 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 76' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASN A 31 ? ASN A 29 . ? 2_654 ? 2 AC1 4 PRO A 32 ? PRO A 30 . ? 2_654 ? 3 AC1 4 ALA A 33 ? ALA A 31 . ? 2_654 ? 4 AC1 4 LYS A 64 ? LYS A 62 . ? 1_555 ? # _database_PDB_matrix.entry_id 1CCD _database_PDB_matrix.origx[1][1] 0.019205 _database_PDB_matrix.origx[1][2] 0.011088 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 0.022176 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 0.009152 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CCD _atom_sites.fract_transf_matrix[1][1] 0.019205 _atom_sites.fract_transf_matrix[1][2] 0.011088 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022176 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009152 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 -2 SER SER A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 ASP 3 1 1 ASP ASP A . n A 1 4 ILE 4 2 2 ILE ILE A . n A 1 5 CYS 5 3 3 CYS CYS A . n A 1 6 PRO 6 4 4 PRO PRO A . n A 1 7 GLY 7 5 5 GLY GLY A . n A 1 8 PHE 8 6 6 PHE PHE A . n A 1 9 LEU 9 7 7 LEU LEU A . n A 1 10 GLN 10 8 8 GLN GLN A . n A 1 11 VAL 11 9 9 VAL VAL A . n A 1 12 LEU 12 10 10 LEU LEU A . n A 1 13 GLU 13 11 11 GLU GLU A . n A 1 14 ALA 14 12 12 ALA ALA A . n A 1 15 LEU 15 13 13 LEU LEU A . n A 1 16 LEU 16 14 14 LEU LEU A . n A 1 17 LEU 17 15 15 LEU LEU A . n A 1 18 GLY 18 16 16 GLY GLY A . n A 1 19 SER 19 17 17 SER SER A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 SER 21 19 19 SER SER A . n A 1 22 ASN 22 20 20 ASN ASN A . n A 1 23 TYR 23 21 21 TYR TYR A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 ALA 25 23 23 ALA ALA A . n A 1 26 ALA 26 24 24 ALA ALA A . n A 1 27 LEU 27 25 25 LEU LEU A . n A 1 28 LYS 28 26 26 LYS LYS A . n A 1 29 PRO 29 27 27 PRO PRO A . n A 1 30 PHE 30 28 28 PHE PHE A . n A 1 31 ASN 31 29 29 ASN ASN A . n A 1 32 PRO 32 30 30 PRO PRO A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 SER 34 32 32 SER SER A . n A 1 35 ASP 35 33 33 ASP ASP A . n A 1 36 LEU 36 34 34 LEU LEU A . n A 1 37 GLN 37 35 35 GLN GLN A . n A 1 38 ASN 38 36 36 ASN ASN A . n A 1 39 ALA 39 37 37 ALA ALA A . n A 1 40 GLY 40 38 38 GLY GLY A . n A 1 41 THR 41 39 39 THR THR A . n A 1 42 GLN 42 40 40 GLN GLN A . n A 1 43 LEU 43 41 41 LEU LEU A . n A 1 44 LYS 44 42 42 LYS LYS A . n A 1 45 ARG 45 43 43 ARG ARG A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 VAL 47 45 45 VAL VAL A . n A 1 48 ASP 48 46 46 ASP ASP A . n A 1 49 THR 49 47 47 THR THR A . n A 1 50 LEU 50 48 48 LEU LEU A . n A 1 51 PRO 51 49 49 PRO PRO A . n A 1 52 GLN 52 50 50 GLN GLN A . n A 1 53 GLU 53 51 51 GLU GLU A . n A 1 54 THR 54 52 52 THR THR A . n A 1 55 ARG 55 53 53 ARG ARG A . n A 1 56 ILE 56 54 54 ILE ILE A . n A 1 57 ASN 57 55 55 ASN ASN A . n A 1 58 ILE 58 56 56 ILE ILE A . n A 1 59 VAL 59 57 57 VAL VAL A . n A 1 60 LYS 60 58 58 LYS LYS A . n A 1 61 LEU 61 59 59 LEU LEU A . n A 1 62 THR 62 60 60 THR THR A . n A 1 63 GLU 63 61 61 GLU GLU A . n A 1 64 LYS 64 62 62 LYS LYS A . n A 1 65 ILE 65 63 63 ILE ILE A . n A 1 66 LEU 66 64 64 LEU LEU A . n A 1 67 THR 67 65 65 THR THR A . n A 1 68 SER 68 66 66 SER SER A . n A 1 69 PRO 69 67 67 PRO PRO A . n A 1 70 LEU 70 68 68 LEU LEU A . n A 1 71 CYS 71 69 69 CYS CYS A . n A 1 72 GLU 72 70 70 GLU GLU A . n A 1 73 GLN 73 71 71 GLN GLN A . n A 1 74 ASP 74 72 72 ASP ASP A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 ARG 76 74 74 ARG ARG A . n A 1 77 VAL 77 75 75 VAL VAL A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id SO4 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 76 _pdbx_nonpoly_scheme.auth_seq_num 76 _pdbx_nonpoly_scheme.pdb_mon_id SO4 _pdbx_nonpoly_scheme.auth_mon_id SO4 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3000 ? 1 MORE -35 ? 1 'SSA (A^2)' 9220 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/6 0.5000000000 -0.8660254038 0.0000000000 26.0350000000 -0.8660254038 -0.5000000000 0.0000000000 45.0939427751 0.0000000000 0.0000000000 -1.0000000000 18.2116666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-01-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 GPRLSA refinement . ? 2 X-PLOR refinement . ? 3 X-PLOR phasing . ? 4 # _pdbx_entry_details.entry_id 1CCD _pdbx_entry_details.compound_details ;THE AMINO ACID SEQUENCE OF RAT CLARA CELL 17 KDA PROTEIN IS 55.7 PERCENT IDENTICAL TO THAT OF RABBIT UTEROGLOBIN. PRIOR TO THE DETERMINATION OF THE SEQUENCE OF CLARA CELL 17 KDA PROTEIN, IT HAD BEEN REFERRED TO IN THE LITERATURE AS CLARA CELL 10 KDA PROTEIN BASED ON ITS ESTIMATED MOLECULAR WEIGHT. THE AMINO ACID RESIDUES OF RAT CLARA CELL 17 KDA PROTEIN HAVE BEEN NUMBERED SO AS TO EMPHASIZE ITS SEQUENCE HOMOLOGY WITH RABBIT UTEROGLOBIN. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NE _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 43 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LEU _pdbx_validate_symm_contact.auth_seq_id_2 68 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_565 _pdbx_validate_symm_contact.dist 1.82 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A SER -1 ? ? CB A SER -1 ? ? OG A SER -1 ? ? 130.53 111.20 19.33 2.70 N 2 1 CA A ASP 1 ? ? CB A ASP 1 ? ? CG A ASP 1 ? ? 135.26 113.40 21.86 2.20 N 3 1 CA A LEU 13 ? ? C A LEU 13 ? ? O A LEU 13 ? ? 136.58 120.10 16.48 2.10 N 4 1 CA A GLU 22 ? ? CB A GLU 22 ? ? CG A GLU 22 ? ? 133.10 113.40 19.70 2.20 N 5 1 OE1 A GLU 22 ? ? CD A GLU 22 ? ? OE2 A GLU 22 ? ? 113.76 123.30 -9.54 1.20 N 6 1 CG A GLU 22 ? ? CD A GLU 22 ? ? OE1 A GLU 22 ? ? 131.60 118.30 13.30 2.00 N 7 1 CA A ASN 29 ? ? CB A ASN 29 ? ? CG A ASN 29 ? ? 138.44 113.40 25.04 2.20 N 8 1 CB A ASP 33 ? ? CG A ASP 33 ? ? OD2 A ASP 33 ? ? 125.70 118.30 7.40 0.90 N 9 1 CA A LEU 34 ? ? CB A LEU 34 ? ? CG A LEU 34 ? ? 133.04 115.30 17.74 2.30 N 10 1 CA A GLU 51 ? ? CB A GLU 51 ? ? CG A GLU 51 ? ? 128.01 113.40 14.61 2.20 N 11 1 N A THR 52 ? ? CA A THR 52 ? ? CB A THR 52 ? ? 122.53 110.30 12.23 1.90 N 12 1 CD A ARG 53 ? ? NE A ARG 53 ? ? CZ A ARG 53 ? ? 134.14 123.60 10.54 1.40 N 13 1 CB A ILE 56 ? ? CA A ILE 56 ? ? C A ILE 56 ? ? 124.82 111.60 13.22 2.00 N 14 1 CA A VAL 57 ? ? CB A VAL 57 ? ? CG1 A VAL 57 ? ? 120.58 110.90 9.68 1.50 N 15 1 N A LYS 58 ? ? CA A LYS 58 ? ? CB A LYS 58 ? ? 123.92 110.60 13.32 1.80 N 16 1 CA A CYS 69 ? ? CB A CYS 69 ? ? SG A CYS 69 ? ? 98.03 114.00 -15.97 1.80 N 17 1 N A ASP 72 ? ? CA A ASP 72 ? ? CB A ASP 72 ? ? 98.47 110.60 -12.13 1.80 N 18 1 CB A ASP 72 ? ? CG A ASP 72 ? ? OD1 A ASP 72 ? ? 128.45 118.30 10.15 0.90 N 19 1 CB A ASP 72 ? ? CG A ASP 72 ? ? OD2 A ASP 72 ? ? 109.49 118.30 -8.81 0.90 N 20 1 CG A ARG 74 ? ? CD A ARG 74 ? ? NE A ARG 74 ? ? 129.25 111.80 17.45 2.10 N 21 1 NE A ARG 74 ? ? CZ A ARG 74 ? ? NH2 A ARG 74 ? ? 124.93 120.30 4.63 0.50 N 22 1 C A ARG 74 ? ? N A VAL 75 ? ? CA A VAL 75 ? ? 138.02 121.70 16.32 2.50 Y 23 1 N A VAL 75 ? ? CA A VAL 75 ? ? CB A VAL 75 ? ? 125.14 111.50 13.64 2.20 N 24 1 CA A VAL 75 ? ? CB A VAL 75 ? ? CG2 A VAL 75 ? ? 120.20 110.90 9.30 1.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A -1 ? ? -63.47 20.42 2 1 PRO A 4 ? ? -39.94 -36.56 3 1 SER A 17 ? ? -33.09 158.10 4 1 PRO A 27 ? ? -57.17 -7.01 5 1 PRO A 67 ? ? -51.67 -1.98 6 1 LEU A 73 ? ? -72.50 -79.53 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 43 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.078 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'SULFATE ION' _pdbx_entity_nonpoly.comp_id SO4 #