data_1CCQ # _entry.id 1CCQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1CCQ RCSB RCSB000574 WWPDB D_1000000574 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CCQ _pdbx_database_status.recvd_initial_deposition_date 1999-03-02 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dementieva, D.V.' 1 'Bocharov, E.V.' 2 'Arseniev, A.S.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Two forms of cytotoxin II (cardiotoxin) from Naja naja oxiana in aqueous solution: spatial structures with tightly bound water molecules. ; Eur.J.Biochem. 263 152 162 1999 EJBCAI IX 0014-2956 0262 ? 10429199 10.1046/j.1432-1327.1999.00478.x 1 'Secondary Structure and Conformational Heterogeneity of Cytotoxin II from Naja Naja Oxiana' 'RUSS.J.BIOORGANIC CHEM.' V. 289 302 1996 ? US 1068-1620 ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Dementieva, D.V.' 1 primary 'Bocharov, E.V.' 2 primary 'Arseniev, A.S.' 3 1 'Dementieva, D.V.' 4 1 'Utkin Yu, N.' 5 1 'Arseniev, A.S.' 6 # _cell.entry_id 1CCQ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CCQ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'PROTEIN (CYTOTOXIN 2)' 6648.238 1 ? ? ? ? 2 water nat water 18.015 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN _entity_poly.pdbx_seq_one_letter_code_can LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 LYS n 1 3 CYS n 1 4 LYS n 1 5 LYS n 1 6 LEU n 1 7 VAL n 1 8 PRO n 1 9 LEU n 1 10 PHE n 1 11 SER n 1 12 LYS n 1 13 THR n 1 14 CYS n 1 15 PRO n 1 16 ALA n 1 17 GLY n 1 18 LYS n 1 19 ASN n 1 20 LEU n 1 21 CYS n 1 22 TYR n 1 23 LYS n 1 24 MET n 1 25 PHE n 1 26 MET n 1 27 VAL n 1 28 ALA n 1 29 ALA n 1 30 PRO n 1 31 HIS n 1 32 VAL n 1 33 PRO n 1 34 VAL n 1 35 LYS n 1 36 ARG n 1 37 GLY n 1 38 CYS n 1 39 ILE n 1 40 ASP n 1 41 VAL n 1 42 CYS n 1 43 PRO n 1 44 LYS n 1 45 SER n 1 46 SER n 1 47 LEU n 1 48 LEU n 1 49 VAL n 1 50 LYS n 1 51 TYR n 1 52 VAL n 1 53 CYS n 1 54 CYS n 1 55 ASN n 1 56 THR n 1 57 ASP n 1 58 LYS n 1 59 CYS n 1 60 ASN n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Central Asian cobra' _entity_src_nat.pdbx_organism_scientific 'Naja oxiana' _entity_src_nat.pdbx_ncbi_taxonomy_id 8657 _entity_src_nat.genus Naja _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion VENOM _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CX2_NAJOX _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01441 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CCQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01441 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 60 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 60 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 COSY 1 2 1 TOCSY 1 3 1 NOESY 1 4 1 ROESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER/10% D2O, 100% D2O' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITY-600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1CCQ _pdbx_nmr_refine.method 'SIMULATED ANNEALING BY MOLECULAR DYNAMICS IN TORSION ANGLE SPACE' _pdbx_nmr_refine.details 'THE RESTRAINED REFINMENT WAS MADE IN VACUUM AND ONLY FOR PROTEIN SIDE CHAINS.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1CCQ _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED BY HOMONUCLEAR NMR SPECTROSCOPY, USING GRADIENT TECHNIQUE. ROESY EXPERIMENTS WERE HELD AT 290 AND 318K. ; # _pdbx_nmr_ensemble.entry_id 1CCQ _pdbx_nmr_ensemble.conformers_calculated_total_number 220 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION (TARGET FUNCTION VALUE)' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement FANTOM 4.0 'FRACZKIEWICZ, MUMENTHALER, FREYBERG, SCHAUMANN' 1 'structure solution' 'VARIAN VNMR' VNMR ? 2 'structure solution' XEASY ? ? 3 'structure solution' DYANA ? ? 4 # _exptl.entry_id 1CCQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1CCQ _struct.title ;NMR STRUCTURE WITH TIGHTLY BOUND WATER MOLECULES OF CYTOTOXIN II (CARDIOTOXIN) FROM NAJA NAJA OXIANA IN AQUEOUS SOLUTION (MINOR FORM). ; _struct.pdbx_descriptor 'CYTOTOXIN 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CCQ _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'CYTOTOXIN (CARDIOTOXIN), MEMBRANE PERTURBATION, CIS/TRANS ISOMERIZATION, BOUND WATER, TOXIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 3 A CYS 21 1_555 ? ? ? ? ? ? ? 1.990 ? disulf2 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 14 A CYS 38 1_555 ? ? ? ? ? ? ? 1.994 ? disulf3 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 42 A CYS 53 1_555 ? ? ? ? ? ? ? 2.050 ? disulf4 disulf ? ? A CYS 54 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 54 A CYS 59 1_555 ? ? ? ? ? ? ? 2.060 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 1 0.03 2 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 2 -0.01 3 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 3 -0.02 4 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 4 0.02 5 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 5 0.01 6 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 6 0.02 7 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 7 0.01 8 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 8 0.02 9 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 9 0.02 10 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 10 0.06 11 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 11 -0.05 12 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 12 -0.04 13 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 13 -0.01 14 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 14 -0.01 15 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 15 -0.03 16 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 16 0.02 17 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 17 -0.01 18 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 18 0.05 19 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 19 -0.06 20 VAL 7 A . ? VAL 7 A PRO 8 A ? PRO 8 A 20 -0.02 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 2 ? S2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S2 1 2 ? anti-parallel S2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 LEU A 1 ? LEU A 6 ? LEU A 1 LEU A 6 S1 2 PHE A 10 ? CYS A 14 ? PHE A 10 CYS A 14 S2 1 LYS A 35 ? ILE A 39 ? LYS A 35 ILE A 39 S2 2 LEU A 20 ? MET A 26 ? LEU A 20 MET A 26 S2 3 VAL A 49 ? ASN A 55 ? VAL A 49 ASN A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N LYS A 5 ? N LYS A 5 O PHE A 10 ? O PHE A 10 S2 1 2 O ILE A 39 ? O ILE A 39 N LEU A 20 ? N LEU A 20 S2 2 3 O PHE A 25 ? O PHE A 25 N LYS A 50 ? N LYS A 50 # _database_PDB_matrix.entry_id 1CCQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CCQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 ASN 60 60 60 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 61 61 HOH HOH A . B 2 HOH 2 62 62 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-06-29 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_assembly 2 4 'Structure model' pdbx_struct_oper_list 3 4 'Structure model' struct_conf # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 7 ? ? -42.62 154.91 2 1 PHE A 10 ? ? -90.23 -146.81 3 1 VAL A 27 ? ? -66.14 72.58 4 1 ALA A 28 ? ? -165.75 -42.05 5 1 ALA A 29 ? ? -119.85 79.81 6 1 HIS A 31 ? ? -150.70 -49.30 7 1 LEU A 48 ? ? -99.87 -67.64 8 1 ASN A 55 ? ? -112.89 50.19 9 2 LEU A 9 ? ? -60.51 94.85 10 2 VAL A 27 ? ? -66.43 73.89 11 2 ALA A 28 ? ? -168.71 -41.77 12 2 HIS A 31 ? ? -149.50 -47.56 13 2 VAL A 34 ? ? -126.49 -53.59 14 2 LEU A 48 ? ? -96.67 -66.81 15 3 VAL A 7 ? ? -40.50 154.09 16 3 PHE A 10 ? ? -89.48 -146.25 17 3 VAL A 27 ? ? -66.39 72.63 18 3 ALA A 28 ? ? -166.26 -41.98 19 3 ALA A 29 ? ? -119.97 78.76 20 3 HIS A 31 ? ? -152.03 -47.81 21 3 VAL A 34 ? ? -128.29 -61.00 22 3 LEU A 48 ? ? -97.38 -66.29 23 3 ASN A 55 ? ? -113.28 53.85 24 4 LYS A 5 ? ? -101.77 -118.30 25 4 ASN A 19 ? ? -140.25 14.12 26 4 VAL A 27 ? ? -67.15 75.03 27 4 ALA A 28 ? ? -169.96 -41.12 28 4 HIS A 31 ? ? -146.81 -50.36 29 4 LEU A 48 ? ? -90.01 -64.26 30 4 ASN A 55 ? ? -101.59 46.66 31 5 VAL A 7 ? ? -39.57 156.87 32 5 LEU A 9 ? ? -173.37 91.91 33 5 ASN A 19 ? ? -143.88 17.55 34 5 VAL A 27 ? ? -66.50 74.26 35 5 ALA A 28 ? ? -169.91 -41.76 36 5 HIS A 31 ? ? -148.99 -46.27 37 5 VAL A 34 ? ? -122.37 -52.63 38 5 LEU A 48 ? ? -105.60 -68.77 39 5 ASN A 55 ? ? -106.40 49.46 40 6 VAL A 7 ? ? -47.90 156.39 41 6 PHE A 10 ? ? -97.15 -147.62 42 6 ASN A 19 ? ? -140.16 14.20 43 6 VAL A 27 ? ? -67.95 74.98 44 6 ALA A 28 ? ? -171.66 -40.67 45 6 HIS A 31 ? ? -149.08 -47.92 46 6 VAL A 34 ? ? -126.61 -60.78 47 6 LEU A 48 ? ? -91.65 -67.47 48 6 ASN A 55 ? ? -103.89 44.24 49 6 LYS A 58 ? ? 38.27 48.89 50 7 PHE A 10 ? ? -89.96 -149.63 51 7 VAL A 27 ? ? -66.11 73.75 52 7 ALA A 28 ? ? -167.07 -41.81 53 7 ALA A 29 ? ? -119.57 79.42 54 7 HIS A 31 ? ? -154.06 -47.83 55 7 LEU A 48 ? ? -96.12 -63.26 56 7 ASN A 55 ? ? -109.11 51.45 57 8 LYS A 5 ? ? -105.98 -101.17 58 8 ALA A 16 ? ? -39.78 130.27 59 8 VAL A 27 ? ? -69.01 78.08 60 8 ALA A 28 ? ? -176.04 -38.94 61 8 ALA A 29 ? ? -119.73 79.58 62 8 HIS A 31 ? ? -152.67 -47.29 63 8 LEU A 48 ? ? -91.05 -65.46 64 8 ASN A 55 ? ? -104.44 47.87 65 8 LYS A 58 ? ? 37.84 47.22 66 9 VAL A 7 ? ? -41.49 153.08 67 9 PHE A 10 ? ? -89.37 -145.60 68 9 VAL A 27 ? ? -65.63 76.16 69 9 ALA A 28 ? ? -173.58 -39.78 70 9 HIS A 31 ? ? -152.50 -45.86 71 9 LEU A 48 ? ? -100.65 -67.15 72 10 LYS A 5 ? ? -114.39 -168.00 73 10 LEU A 9 ? ? -59.32 102.18 74 10 VAL A 27 ? ? -67.94 77.17 75 10 ALA A 28 ? ? -172.42 -39.42 76 10 HIS A 31 ? ? -153.86 -47.32 77 10 VAL A 34 ? ? -123.36 -56.90 78 10 LEU A 48 ? ? -90.58 -65.32 79 11 LEU A 9 ? ? -59.09 98.78 80 11 VAL A 27 ? ? -66.63 75.35 81 11 ALA A 28 ? ? -170.58 -41.50 82 11 ALA A 29 ? ? -119.86 79.55 83 11 HIS A 31 ? ? -152.33 -47.19 84 11 VAL A 34 ? ? -127.40 -54.50 85 11 LEU A 48 ? ? -90.44 -65.89 86 11 ASN A 55 ? ? -106.99 43.12 87 12 LYS A 5 ? ? -106.24 -169.70 88 12 LEU A 9 ? ? -67.00 90.62 89 12 ASN A 19 ? ? -144.12 17.09 90 12 VAL A 27 ? ? -67.10 72.60 91 12 ALA A 28 ? ? -171.17 -42.56 92 12 VAL A 34 ? ? -129.42 -65.45 93 12 LEU A 48 ? ? -93.00 -68.30 94 12 ASN A 55 ? ? -102.22 48.32 95 12 LYS A 58 ? ? 39.67 45.71 96 13 CYS A 14 ? ? -46.04 108.55 97 13 VAL A 27 ? ? -66.43 75.27 98 13 ALA A 28 ? ? -172.65 -40.60 99 13 HIS A 31 ? ? -148.99 -45.83 100 13 ASN A 55 ? ? -119.56 53.81 101 14 CYS A 14 ? ? -50.00 106.76 102 14 VAL A 27 ? ? -66.10 75.05 103 14 ALA A 28 ? ? -171.79 -40.61 104 14 HIS A 31 ? ? -143.81 -44.90 105 14 VAL A 34 ? ? -130.99 -50.83 106 14 LEU A 48 ? ? -94.21 -65.75 107 14 ASN A 55 ? ? -105.10 47.84 108 15 LEU A 9 ? ? -65.84 93.47 109 15 VAL A 27 ? ? -66.09 74.48 110 15 ALA A 28 ? ? -168.53 -41.88 111 15 ALA A 29 ? ? -119.79 79.39 112 15 HIS A 31 ? ? -153.25 -49.36 113 15 VAL A 34 ? ? -123.73 -59.74 114 15 LEU A 48 ? ? -93.14 -66.98 115 15 ASN A 55 ? ? -100.70 47.18 116 15 LYS A 58 ? ? 39.93 45.30 117 16 VAL A 7 ? ? -44.29 155.22 118 16 PHE A 10 ? ? -91.47 -148.90 119 16 VAL A 27 ? ? -67.95 74.64 120 16 ALA A 28 ? ? -173.03 -40.82 121 16 LEU A 48 ? ? -93.06 -68.77 122 16 ASN A 55 ? ? -107.98 49.82 123 16 LYS A 58 ? ? 38.37 48.52 124 17 LYS A 5 ? ? -110.93 -169.60 125 17 LEU A 9 ? ? -61.67 94.45 126 17 ASN A 19 ? ? -145.96 18.63 127 17 VAL A 27 ? ? -66.00 66.71 128 17 ALA A 28 ? ? -157.69 -42.69 129 17 ALA A 29 ? ? -119.37 79.80 130 17 HIS A 31 ? ? -159.17 -46.77 131 17 LEU A 48 ? ? -108.43 -68.91 132 17 ASN A 55 ? ? -100.34 47.64 133 17 LYS A 58 ? ? 39.99 47.58 134 18 LYS A 5 ? ? -111.23 -167.79 135 18 ASN A 19 ? ? -143.58 16.76 136 18 VAL A 27 ? ? -68.40 76.10 137 18 ALA A 28 ? ? -172.30 -39.69 138 18 ALA A 29 ? ? -119.92 78.84 139 18 HIS A 31 ? ? -152.29 -46.01 140 18 VAL A 34 ? ? -131.35 -64.31 141 18 LEU A 48 ? ? -95.08 -66.59 142 18 ASN A 55 ? ? -103.40 48.15 143 19 ALA A 16 ? ? -39.75 132.12 144 19 ASN A 19 ? ? -142.69 16.27 145 19 VAL A 27 ? ? -67.12 70.43 146 19 ALA A 28 ? ? -166.21 -42.27 147 19 HIS A 31 ? ? -154.51 -45.83 148 19 VAL A 34 ? ? -127.67 -56.14 149 19 LEU A 48 ? ? -102.55 -72.45 150 19 ASN A 55 ? ? -92.64 34.81 151 19 LYS A 58 ? ? 39.92 43.78 152 20 VAL A 27 ? ? -65.74 73.36 153 20 ALA A 28 ? ? -165.23 -41.68 154 20 ALA A 29 ? ? -119.93 78.11 155 20 HIS A 31 ? ? -155.09 -51.16 156 20 LEU A 48 ? ? -98.83 -67.54 157 20 ASN A 55 ? ? -104.04 49.24 158 20 LYS A 58 ? ? 39.88 46.16 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #