data_1CGN # _entry.id 1CGN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1CGN WWPDB D_1000172311 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CGN _pdbx_database_status.recvd_initial_deposition_date 1995-05-01 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dobbs, A.J.' 1 'Faber, H.R.' 2 'Anderson, B.F.' 3 'Baker, E.N.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures. ; 'Acta Crystallogr.,Sect.D' 52 356 368 1996 ABCRE6 DK 0907-4449 0766 ? 15299707 10.1107/S0907444995008328 1 ;Atomic Structure of a Cytochrome C' with an Unusual Ligand-Controlled Dimer Dissociation at 1.8 Angstroms Resolution ; J.Mol.Biol. 234 433 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? 2 ;Three-Dimensional Structure of Ferricytochrome C' from Rhodospirillum Rubrum at 2.8 Angstroms Resolution ; 'J.Biochem.(Tokyo)' 111 317 ? 1992 JOBIAO JA 0021-924X 0418 ? ? ? 3 ;Structure of Ferricytochrome C' from Rhodospirillum Molischianum at 1.67 Angstroms ; J.Mol.Biol. 186 627 ? 1985 JMOBAK UK 0022-2836 0070 ? ? ? 4 ;Crystallographic Structure of Rhodospirillum Molischianum Ferricytochrome C' at 2.5 Angstroms Resolution ; J.Mol.Biol. 353 399 ? 1981 JMOBAK UK 0022-2836 0070 ? ? ? 5 ;The Amino Acid Sequence of Cytochrome C' from Alcaligenes Sp. N.C.I.B. 11015 ; Biochem.J. 135 751 ? 1973 BIJOAK UK 0264-6021 0043 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dobbs, A.J.' 1 ? primary 'Anderson, B.F.' 2 ? primary 'Faber, H.R.' 3 ? primary 'Baker, E.N.' 4 ? 1 'Ren, Z.' 5 ? 1 'Meyer, T.E.' 6 ? 1 'Mcree, D.E.' 7 ? 2 'Yasui, M.' 8 ? 2 'Harada, S.' 9 ? 2 'Kai, Y.' 10 ? 2 'Kasai, N.' 11 ? 2 'Kusunoki, M.' 12 ? 2 'Matsura, Y.' 13 ? 3 'Finzel, B.C.' 14 ? 3 'Weber, P.C.' 15 ? 3 'Hardman, K.D.' 16 ? 3 'Salemme, F.R.' 17 ? 4 'Weber, P.C.' 18 ? 4 'Howard, A.' 19 ? 4 'Xoung, N.H.' 20 ? 4 'Salemme, F.R.' 21 ? 5 'Ambler, R.P.' 22 ? # _cell.entry_id 1CGN _cell.length_a 54.600 _cell.length_b 54.600 _cell.length_c 180.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CGN _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME C' 13575.380 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? 3 water nat water 18.015 75 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(PCA)FAKPEDAVKYRQSALTLMASHFGRMAPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGAGTEGGDARPEIWSDA AGFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDSYRKKK ; _entity_poly.pdbx_seq_one_letter_code_can ;QFAKPEDAVKYRQSALTLMASHFGRMAPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGAGTEGGDARPEIWSDAAGFK QKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDSYRKKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 PHE n 1 3 ALA n 1 4 LYS n 1 5 PRO n 1 6 GLU n 1 7 ASP n 1 8 ALA n 1 9 VAL n 1 10 LYS n 1 11 TYR n 1 12 ARG n 1 13 GLN n 1 14 SER n 1 15 ALA n 1 16 LEU n 1 17 THR n 1 18 LEU n 1 19 MET n 1 20 ALA n 1 21 SER n 1 22 HIS n 1 23 PHE n 1 24 GLY n 1 25 ARG n 1 26 MET n 1 27 ALA n 1 28 PRO n 1 29 VAL n 1 30 VAL n 1 31 LYS n 1 32 GLY n 1 33 GLN n 1 34 ALA n 1 35 PRO n 1 36 TYR n 1 37 ASP n 1 38 ALA n 1 39 ALA n 1 40 GLN n 1 41 ILE n 1 42 LYS n 1 43 ALA n 1 44 ASN n 1 45 VAL n 1 46 GLU n 1 47 VAL n 1 48 LEU n 1 49 LYS n 1 50 THR n 1 51 LEU n 1 52 THR n 1 53 ALA n 1 54 LEU n 1 55 PRO n 1 56 TRP n 1 57 ALA n 1 58 ALA n 1 59 PHE n 1 60 GLY n 1 61 ALA n 1 62 GLY n 1 63 THR n 1 64 GLU n 1 65 GLY n 1 66 GLY n 1 67 ASP n 1 68 ALA n 1 69 ARG n 1 70 PRO n 1 71 GLU n 1 72 ILE n 1 73 TRP n 1 74 SER n 1 75 ASP n 1 76 ALA n 1 77 ALA n 1 78 GLY n 1 79 PHE n 1 80 LYS n 1 81 GLN n 1 82 LYS n 1 83 GLN n 1 84 GLN n 1 85 ALA n 1 86 PHE n 1 87 GLN n 1 88 ASP n 1 89 ASN n 1 90 ILE n 1 91 VAL n 1 92 LYS n 1 93 LEU n 1 94 SER n 1 95 ALA n 1 96 ALA n 1 97 ALA n 1 98 ASP n 1 99 ALA n 1 100 GLY n 1 101 ASP n 1 102 LEU n 1 103 ASP n 1 104 LYS n 1 105 LEU n 1 106 ARG n 1 107 ALA n 1 108 ALA n 1 109 PHE n 1 110 GLY n 1 111 ASP n 1 112 VAL n 1 113 GLY n 1 114 ALA n 1 115 SER n 1 116 CYS n 1 117 LYS n 1 118 ALA n 1 119 CYS n 1 120 HIS n 1 121 ASP n 1 122 SER n 1 123 TYR n 1 124 ARG n 1 125 LYS n 1 126 LYS n 1 127 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Achromobacter _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Achromobacter xylosoxidans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 85698 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYCP_ALCXX _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00138 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;QFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFK QKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CGN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 127 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00138 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 127 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 127 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1CGN ALA A 27 ? UNP P00138 THR 27 conflict 27 1 1 1CGN THR A 52 ? UNP P00138 SER 52 conflict 52 2 1 1CGN ALA A 61 ? UNP P00138 PRO 61 conflict 61 3 1 1CGN GLY A 78 ? UNP P00138 SER 78 conflict 78 4 1 1CGN SER A 122 ? UNP P00138 ALA 122 conflict 122 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1CGN _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.86 _exptl_crystal.density_percent_sol 56.96 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 1993-03-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source ? _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1CGN _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs ? _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs 0.032 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.4 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1CGN _refine.ls_number_reflns_obs 8220 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.15 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.167 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 910 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 1028 _refine_hist.d_res_high 2.15 _refine_hist.d_res_low 20.0 # _struct.entry_id 1CGN _struct.title ;CYTOCHROME C' ; _struct.pdbx_descriptor ;MOLECULE: CYTOCHROME C' ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CGN _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT (CYTOCHROME)' _struct_keywords.text 'ELECTRON TRANSPORT (CYTOCHROME)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ;SYMMETRY THE CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS PRESENTED BELOW GENERATE THE SUBUNITS OF THE POLYMERIC MOLECULE. APPLIED TO RESIDUES: PCA 1 .. HEM 128 SYMMETRY OPERATION TO GENERATE THE SECOND MOLECULE OF THE DIMERIC PARTICLE SYMMETRY1 1 -1.000000 0.000000 0.000000 0.00000 SYMMETRY2 1 0.000000 1.000000 0.000000 0.00000 SYMMETRY3 1 0.000000 0.000000 -1.000000 90.20000 ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 5 ? VAL A 30 ? PRO A 5 VAL A 30 1 ? 26 HELX_P HELX_P2 2 ALA A 38 ? ALA A 58 ? ALA A 38 ALA A 58 1 ? 21 HELX_P HELX_P3 3 PRO A 70 ? SER A 74 ? PRO A 70 SER A 74 5 ? 5 HELX_P HELX_P4 4 ALA A 76 ? ALA A 99 ? ALA A 76 ALA A 99 1 ? 24 HELX_P HELX_P5 5 LEU A 102 ? TYR A 123 ? LEU A 102 TYR A 123 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A PCA 1 C ? ? ? 1_555 A PHE 2 N ? ? A PCA 1 A PHE 2 1_555 ? ? ? ? ? ? ? 1.315 ? covale2 covale none ? A CYS 116 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 116 A HEC 128 1_555 ? ? ? ? ? ? ? 1.810 ? covale3 covale none ? A CYS 119 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 119 A HEC 128 1_555 ? ? ? ? ? ? ? 1.839 ? metalc1 metalc ? ? A HIS 120 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 120 A HEC 128 1_555 ? ? ? ? ? ? ? 2.006 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 17 _struct_site.details 'BINDING SITE FOR RESIDUE HEM A 128' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 ARG A 12 ? ARG A 12 . ? 1_555 ? 2 AC1 17 GLN A 13 ? GLN A 13 . ? 1_555 ? 3 AC1 17 LEU A 16 ? LEU A 16 . ? 1_555 ? 4 AC1 17 THR A 17 ? THR A 17 . ? 1_555 ? 5 AC1 17 ALA A 20 ? ALA A 20 . ? 1_555 ? 6 AC1 17 TRP A 56 ? TRP A 56 . ? 1_555 ? 7 AC1 17 ASP A 67 ? ASP A 67 . ? 1_555 ? 8 AC1 17 ILE A 72 ? ILE A 72 . ? 1_555 ? 9 AC1 17 GLN A 83 ? GLN A 83 . ? 1_555 ? 10 AC1 17 PHE A 86 ? PHE A 86 . ? 1_555 ? 11 AC1 17 CYS A 116 ? CYS A 116 . ? 1_555 ? 12 AC1 17 CYS A 119 ? CYS A 119 . ? 1_555 ? 13 AC1 17 HIS A 120 ? HIS A 120 . ? 1_555 ? 14 AC1 17 TYR A 123 ? TYR A 123 . ? 1_555 ? 15 AC1 17 ARG A 124 ? ARG A 124 . ? 1_555 ? 16 AC1 17 HOH C . ? HOH A 214 . ? 1_555 ? 17 AC1 17 HOH C . ? HOH A 241 . ? 1_555 ? # _database_PDB_matrix.entry_id 1CGN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CGN _atom_sites.fract_transf_matrix[1][1] 0.018315 _atom_sites.fract_transf_matrix[1][2] 0.010574 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021148 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005543 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 TRP 73 73 73 TRP TRP A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 LYS 126 126 ? ? ? A . n A 1 127 LYS 127 127 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 128 128 HEC HEM A . C 3 HOH 1 200 200 HOH HOH A . C 3 HOH 2 201 201 HOH HOH A . C 3 HOH 3 202 202 HOH HOH A . C 3 HOH 4 203 203 HOH HOH A . C 3 HOH 5 204 204 HOH HOH A . C 3 HOH 6 205 205 HOH HOH A . C 3 HOH 7 206 206 HOH HOH A . C 3 HOH 8 207 207 HOH HOH A . C 3 HOH 9 208 208 HOH HOH A . C 3 HOH 10 209 209 HOH HOH A . C 3 HOH 11 210 210 HOH HOH A . C 3 HOH 12 211 211 HOH HOH A . C 3 HOH 13 212 212 HOH HOH A . C 3 HOH 14 213 213 HOH HOH A . C 3 HOH 15 214 214 HOH HOH A . C 3 HOH 16 215 215 HOH HOH A . C 3 HOH 17 216 216 HOH HOH A . C 3 HOH 18 217 217 HOH HOH A . C 3 HOH 19 218 218 HOH HOH A . C 3 HOH 20 219 219 HOH HOH A . C 3 HOH 21 220 220 HOH HOH A . C 3 HOH 22 221 221 HOH HOH A . C 3 HOH 23 222 222 HOH HOH A . C 3 HOH 24 223 223 HOH HOH A . C 3 HOH 25 224 224 HOH HOH A . C 3 HOH 26 225 225 HOH HOH A . C 3 HOH 27 226 226 HOH HOH A . C 3 HOH 28 227 227 HOH HOH A . C 3 HOH 29 228 228 HOH HOH A . C 3 HOH 30 229 229 HOH HOH A . C 3 HOH 31 230 230 HOH HOH A . C 3 HOH 32 231 231 HOH HOH A . C 3 HOH 33 232 232 HOH HOH A . C 3 HOH 34 233 233 HOH HOH A . C 3 HOH 35 234 234 HOH HOH A . C 3 HOH 36 235 235 HOH HOH A . C 3 HOH 37 236 236 HOH HOH A . C 3 HOH 38 237 237 HOH HOH A . C 3 HOH 39 238 238 HOH HOH A . C 3 HOH 40 239 239 HOH HOH A . C 3 HOH 41 240 240 HOH HOH A . C 3 HOH 42 241 241 HOH HOH A . C 3 HOH 43 242 242 HOH HOH A . C 3 HOH 44 243 243 HOH HOH A . C 3 HOH 45 244 244 HOH HOH A . C 3 HOH 46 245 245 HOH HOH A . C 3 HOH 47 246 246 HOH HOH A . C 3 HOH 48 247 247 HOH HOH A . C 3 HOH 49 248 248 HOH HOH A . C 3 HOH 50 249 249 HOH HOH A . C 3 HOH 51 250 250 HOH HOH A . C 3 HOH 52 251 251 HOH HOH A . C 3 HOH 53 252 252 HOH HOH A . C 3 HOH 54 253 253 HOH HOH A . C 3 HOH 55 254 254 HOH HOH A . C 3 HOH 56 255 255 HOH HOH A . C 3 HOH 57 256 256 HOH HOH A . C 3 HOH 58 257 257 HOH HOH A . C 3 HOH 59 258 258 HOH HOH A . C 3 HOH 60 259 259 HOH HOH A . C 3 HOH 61 260 260 HOH HOH A . C 3 HOH 62 261 261 HOH HOH A . C 3 HOH 63 262 262 HOH HOH A . C 3 HOH 64 263 263 HOH HOH A . C 3 HOH 65 264 264 HOH HOH A . C 3 HOH 66 265 265 HOH HOH A . C 3 HOH 67 266 266 HOH HOH A . C 3 HOH 68 267 267 HOH HOH A . C 3 HOH 69 268 268 HOH HOH A . C 3 HOH 70 269 269 HOH HOH A . C 3 HOH 71 270 270 HOH HOH A . C 3 HOH 72 271 271 HOH HOH A . C 3 HOH 73 272 272 HOH HOH A . C 3 HOH 74 273 273 HOH HOH A . C 3 HOH 75 274 274 HOH HOH A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'PYROGLUTAMIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 120 ? A HIS 120 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 NA ? B HEC . ? A HEC 128 ? 1_555 95.0 ? 2 NE2 ? A HIS 120 ? A HIS 120 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 NB ? B HEC . ? A HEC 128 ? 1_555 93.5 ? 3 NA ? B HEC . ? A HEC 128 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 NB ? B HEC . ? A HEC 128 ? 1_555 91.4 ? 4 NE2 ? A HIS 120 ? A HIS 120 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 NC ? B HEC . ? A HEC 128 ? 1_555 96.2 ? 5 NA ? B HEC . ? A HEC 128 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 NC ? B HEC . ? A HEC 128 ? 1_555 168.7 ? 6 NB ? B HEC . ? A HEC 128 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 NC ? B HEC . ? A HEC 128 ? 1_555 88.7 ? 7 NE2 ? A HIS 120 ? A HIS 120 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 ND ? B HEC . ? A HEC 128 ? 1_555 100.4 ? 8 NA ? B HEC . ? A HEC 128 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 ND ? B HEC . ? A HEC 128 ? 1_555 89.3 ? 9 NB ? B HEC . ? A HEC 128 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 ND ? B HEC . ? A HEC 128 ? 1_555 165.9 ? 10 NC ? B HEC . ? A HEC 128 ? 1_555 FE ? B HEC . ? A HEC 128 ? 1_555 ND ? B HEC . ? A HEC 128 ? 1_555 88.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-07-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2019-12-25 5 'Structure model' 3 0 2020-01-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Polymer sequence' 7 5 'Structure model' Advisory 8 5 'Structure model' 'Atomic model' 9 5 'Structure model' 'Data collection' 10 5 'Structure model' 'Derived calculations' 11 5 'Structure model' 'Non-polymer description' 12 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_poly 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_mod_residue 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' atom_site 7 5 'Structure model' chem_comp 8 5 'Structure model' entity 9 5 'Structure model' pdbx_distant_solvent_atoms 10 5 'Structure model' pdbx_entity_nonpoly 11 5 'Structure model' pdbx_nonpoly_scheme 12 5 'Structure model' pdbx_struct_assembly 13 5 'Structure model' pdbx_struct_assembly_gen 14 5 'Structure model' pdbx_struct_conn_angle 15 5 'Structure model' pdbx_struct_oper_list 16 5 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 2 4 'Structure model' '_pdbx_database_status.process_site' 3 4 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_atom_site.B_iso_or_equiv' 7 5 'Structure model' '_atom_site.Cartn_x' 8 5 'Structure model' '_atom_site.Cartn_y' 9 5 'Structure model' '_atom_site.Cartn_z' 10 5 'Structure model' '_atom_site.auth_atom_id' 11 5 'Structure model' '_atom_site.auth_comp_id' 12 5 'Structure model' '_atom_site.label_atom_id' 13 5 'Structure model' '_atom_site.label_comp_id' 14 5 'Structure model' '_atom_site.type_symbol' 15 5 'Structure model' '_chem_comp.formula' 16 5 'Structure model' '_chem_comp.formula_weight' 17 5 'Structure model' '_chem_comp.id' 18 5 'Structure model' '_chem_comp.name' 19 5 'Structure model' '_chem_comp.pdbx_synonyms' 20 5 'Structure model' '_entity.formula_weight' 21 5 'Structure model' '_entity.pdbx_description' 22 5 'Structure model' '_pdbx_entity_nonpoly.comp_id' 23 5 'Structure model' '_pdbx_entity_nonpoly.name' 24 5 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 25 5 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 26 5 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 27 5 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 28 5 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 29 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 30 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 31 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 32 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 33 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 34 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 35 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 36 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal TNT refinement 5C ? 1 SUPPLIED 'data reduction' SOFTWARE ? 2 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 6 ? ? OE2 A GLU 6 ? ? 1.323 1.252 0.071 0.011 N 2 1 CD A GLU 64 ? ? OE2 A GLU 64 ? ? 1.320 1.252 0.068 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 37 ? ? CG A ASP 37 ? ? OD2 A ASP 37 ? ? 124.18 118.30 5.88 0.90 N 2 1 CB A ASP 67 ? ? CG A ASP 67 ? ? OD1 A ASP 67 ? ? 111.72 118.30 -6.58 0.90 N 3 1 CB A ASP 67 ? ? CG A ASP 67 ? ? OD2 A ASP 67 ? ? 124.54 118.30 6.24 0.90 N 4 1 CB A ASP 88 ? ? CG A ASP 88 ? ? OD1 A ASP 88 ? ? 124.14 118.30 5.84 0.90 N 5 1 CB A ASP 88 ? ? CG A ASP 88 ? ? OD2 A ASP 88 ? ? 112.04 118.30 -6.26 0.90 N 6 1 CB A ASP 98 ? ? CG A ASP 98 ? ? OD2 A ASP 98 ? ? 112.84 118.30 -5.46 0.90 N 7 1 CB A ASP 101 ? ? CG A ASP 101 ? ? OD1 A ASP 101 ? ? 112.87 118.30 -5.43 0.90 N 8 1 CB A ASP 121 ? ? CG A ASP 121 ? ? OD2 A ASP 121 ? ? 112.29 118.30 -6.01 0.90 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 75 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -118.82 _pdbx_validate_torsion.psi 53.35 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 232 ? 7.43 . 2 1 O ? A HOH 239 ? 6.53 . 3 1 O ? A HOH 240 ? 6.18 . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 4 ? CD ? A LYS 4 CD 2 1 Y 1 A LYS 4 ? CE ? A LYS 4 CE 3 1 Y 1 A LYS 4 ? NZ ? A LYS 4 NZ 4 1 Y 1 A LYS 10 ? CD ? A LYS 10 CD 5 1 Y 1 A LYS 10 ? CE ? A LYS 10 CE 6 1 Y 1 A LYS 10 ? NZ ? A LYS 10 NZ 7 1 Y 1 A LYS 31 ? CE ? A LYS 31 CE 8 1 Y 1 A LYS 31 ? NZ ? A LYS 31 NZ 9 1 Y 1 A LYS 42 ? CE ? A LYS 42 CE 10 1 Y 1 A LYS 42 ? NZ ? A LYS 42 NZ 11 1 Y 1 A GLU 46 ? CG ? A GLU 46 CG 12 1 Y 1 A GLU 46 ? CD ? A GLU 46 CD 13 1 Y 1 A GLU 46 ? OE1 ? A GLU 46 OE1 14 1 Y 1 A GLU 46 ? OE2 ? A GLU 46 OE2 15 1 Y 1 A LYS 49 ? CE ? A LYS 49 CE 16 1 Y 1 A LYS 49 ? NZ ? A LYS 49 NZ 17 1 Y 1 A LYS 80 ? CD ? A LYS 80 CD 18 1 Y 1 A LYS 80 ? CE ? A LYS 80 CE 19 1 Y 1 A LYS 80 ? NZ ? A LYS 80 NZ 20 1 Y 1 A GLN 84 ? CG ? A GLN 84 CG 21 1 Y 1 A GLN 84 ? CD ? A GLN 84 CD 22 1 Y 1 A GLN 84 ? OE1 ? A GLN 84 OE1 23 1 Y 1 A GLN 84 ? NE2 ? A GLN 84 NE2 24 1 Y 1 A LYS 104 ? CE ? A LYS 104 CE 25 1 Y 1 A LYS 104 ? NZ ? A LYS 104 NZ 26 1 Y 1 A LYS 117 ? CE ? A LYS 117 CE 27 1 Y 1 A LYS 117 ? NZ ? A LYS 117 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 126 ? A LYS 126 2 1 Y 1 A LYS 127 ? A LYS 127 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HEME C' HEC 3 water HOH #