data_1CHC # _entry.id 1CHC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1CHC pdb_00001chc 10.2210/pdb1chc/pdb WWPDB D_1000172323 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CHC _pdbx_database_status.recvd_initial_deposition_date 1994-02-02 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barlow, P.N.' 1 'Everett, R.D.' 2 'Luisi, B.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of the C3HC4 domain by 1H-nuclear magnetic resonance spectroscopy. A new structural class of zinc-finger.' J.Mol.Biol. 237 201 211 1994 JMOBAK UK 0022-2836 0070 ? 8126734 10.1006/jmbi.1994.1222 1 'A Novel Arrangement of Zinc-Binding Residues and Secondary Structure in the C3Hc4 Motif of an Alpha Herpes Virus Protein Family' J.Mol.Biol. 234 1038 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? 2 'A Novel Cysteine-Rich Sequence Motif' 'Cell(Cambridge,Mass.)' 64 483 ? 1991 CELLB5 US 0092-8674 0998 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Barlow, P.N.' 1 ? primary 'Luisi, B.' 2 ? primary 'Milner, A.' 3 ? primary 'Elliott, M.' 4 ? primary 'Everett, R.' 5 ? 1 'Everett, R.D.' 6 ? 1 'Barlow, P.' 7 ? 1 'Milner, A.' 8 ? 1 'Luisi, B.' 9 ? 1 'Orr, A.' 10 ? 1 'Hope, G.' 11 ? 1 'Lyon, D.' 12 ? 2 'Freemont, P.S.' 13 ? 2 'Handon, I.M.' 14 ? 2 'Trowsdale, J.' 15 ? # _cell.entry_id 1CHC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CHC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'EQUINE HERPES VIRUS-1 RING DOMAIN' 7651.879 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGDQLI _entity_poly.pdbx_seq_one_letter_code_can MATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGDQLI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 THR n 1 4 VAL n 1 5 ALA n 1 6 GLU n 1 7 ARG n 1 8 CYS n 1 9 PRO n 1 10 ILE n 1 11 CYS n 1 12 LEU n 1 13 GLU n 1 14 ASP n 1 15 PRO n 1 16 SER n 1 17 ASN n 1 18 TYR n 1 19 SER n 1 20 MET n 1 21 ALA n 1 22 LEU n 1 23 PRO n 1 24 CYS n 1 25 LEU n 1 26 HIS n 1 27 ALA n 1 28 PHE n 1 29 CYS n 1 30 TYR n 1 31 VAL n 1 32 CYS n 1 33 ILE n 1 34 THR n 1 35 ARG n 1 36 TRP n 1 37 ILE n 1 38 ARG n 1 39 GLN n 1 40 ASN n 1 41 PRO n 1 42 THR n 1 43 CYS n 1 44 PRO n 1 45 LEU n 1 46 CYS n 1 47 LYS n 1 48 VAL n 1 49 PRO n 1 50 VAL n 1 51 GLU n 1 52 SER n 1 53 VAL n 1 54 VAL n 1 55 HIS n 1 56 THR n 1 57 ILE n 1 58 GLU n 1 59 SER n 1 60 ASP n 1 61 SER n 1 62 GLU n 1 63 PHE n 1 64 GLY n 1 65 ASP n 1 66 GLN n 1 67 LEU n 1 68 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Equine herpesvirus 1' _entity_src_gen.gene_src_genus Varicellovirus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Equid herpesvirus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10326 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ICP0_EHV1B _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P28990 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFKETKVSVDFDYDSEEDE DSFEGQFLAVDSGDAPANISAWNGPMAFVPLNANGTAGAPRLQPLVDWLVERLDQLFETPELALVMRNIVMDTLCEHGCN EEELTRQFWPMFHEDTVPFVTDLIVQAELCVASRPILPIARGRGVEYIDSSSSSSSSEEETDSDIEVDPNNLTDPEDTSD ETSTDNSSAQAPRQEDSRPARARPGPPTRGRRRGRRPAAPGPASRRSARLRRRQPRTNSRTNGGDNGEIIDLTLDSDGDT EPADVSGSLNTTDQPVLIPDEEEAAPASPHTSSNSAIICLVSELTPESEEPPRDQPVAPSGSSAGERPMRPRCSLREFAR RFMALAPRDSSTSEAAGPSRLGAGPRATEPFSVAVVLVDRSSEGAGLFGGRFAQHVRRRTEDESARRRGNVLLRPRRQSV PPVPYPDIASTSPLIRQGGQRVRDLQRAFQTQPAEPEEMRCPHNCQRYRRNQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CHC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P28990 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 63 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 63 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _pdbx_nmr_ensemble.entry_id 1CHC _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1CHC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1CHC _struct.title 'STRUCTURE OF THE C3HC4 DOMAIN BY 1H-NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY; A NEW STRUCTURAL CLASS OF ZINC-FINGER' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CHC _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'Viral protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 31 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ARG _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 38 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 31 _struct_conf.end_auth_comp_id ARG _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 38 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details RIGHT-HANDED _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 8 A ZN 71 1_555 ? ? ? ? ? ? ? 2.300 ? ? metalc2 metalc ? ? A CYS 11 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 11 A ZN 71 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc3 metalc ? ? A CYS 24 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 24 A ZN 70 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc4 metalc ? ? A HIS 26 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 70 1_555 ? ? ? ? ? ? ? 2.001 ? ? metalc5 metalc ? ? A CYS 29 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 29 A ZN 71 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc6 metalc ? ? A CYS 32 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 32 A ZN 71 1_555 ? ? ? ? ? ? ? 2.314 ? ? metalc7 metalc ? ? A CYS 43 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 43 A ZN 70 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc8 metalc ? ? A CYS 46 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 46 A ZN 70 1_555 ? ? ? ? ? ? ? 2.308 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 22 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 22 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 23 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 23 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -8.22 # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 HIS A 26 ? CYS A 29 ? HIS A 26 CYS A 29 S1 2 TYR A 18 ? LEU A 22 ? TYR A 18 LEU A 22 S1 3 SER A 52 ? THR A 56 ? SER A 52 THR A 56 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details S1 Unknown ? ? ? ? 4 ? TWO Unknown ? ? ? ? 4 ? AC1 Software A ZN 70 ? 4 'BINDING SITE FOR RESIDUE ZN A 70' AC2 Software A ZN 71 ? 4 'BINDING SITE FOR RESIDUE ZN A 71' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 S1 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 2 S1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 3 S1 4 CYS A 29 ? CYS A 29 . ? 1_555 ? 4 S1 4 CYS A 32 ? CYS A 32 . ? 1_555 ? 5 TWO 4 CYS A 24 ? CYS A 24 . ? 1_555 ? 6 TWO 4 HIS A 26 ? HIS A 26 . ? 1_555 ? 7 TWO 4 CYS A 43 ? CYS A 43 . ? 1_555 ? 8 TWO 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 9 AC1 4 CYS A 24 ? CYS A 24 . ? 1_555 ? 10 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? 11 AC1 4 CYS A 43 ? CYS A 43 . ? 1_555 ? 12 AC1 4 CYS A 46 ? CYS A 46 . ? 1_555 ? 13 AC2 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 14 AC2 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 15 AC2 4 CYS A 29 ? CYS A 29 . ? 1_555 ? 16 AC2 4 CYS A 32 ? CYS A 32 . ? 1_555 ? # _database_PDB_matrix.entry_id 1CHC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CHC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'CIS PROLINE - PRO 23' # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ILE 68 68 68 ILE ILE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 70 70 ZN ZN A . C 2 ZN 1 71 71 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? C ZN . ? A ZN 71 ? 1_555 SG ? A CYS 11 ? A CYS 11 ? 1_555 110.8 ? 2 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? C ZN . ? A ZN 71 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 103.1 ? 3 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? C ZN . ? A ZN 71 ? 1_555 SG ? A CYS 29 ? A CYS 29 ? 1_555 111.0 ? 4 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? C ZN . ? A ZN 71 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 115.1 ? 5 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? C ZN . ? A ZN 71 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 113.7 ? 6 SG ? A CYS 29 ? A CYS 29 ? 1_555 ZN ? C ZN . ? A ZN 71 ? 1_555 SG ? A CYS 32 ? A CYS 32 ? 1_555 102.2 ? 7 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 70 ? 1_555 ND1 ? A HIS 26 ? A HIS 26 ? 1_555 107.1 ? 8 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 70 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 111.1 ? 9 ND1 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 70 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 109.6 ? 10 SG ? A CYS 24 ? A CYS 24 ? 1_555 ZN ? B ZN . ? A ZN 70 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 103.7 ? 11 ND1 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 70 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 112.5 ? 12 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? B ZN . ? A ZN 70 ? 1_555 SG ? A CYS 46 ? A CYS 46 ? 1_555 112.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-04-30 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 8 ? ? CB A CYS 8 ? ? SG A CYS 8 ? ? 121.50 114.20 7.30 1.10 N 2 1 CA A CYS 11 ? ? CB A CYS 11 ? ? SG A CYS 11 ? ? 120.90 114.20 6.70 1.10 N 3 1 CA A CYS 29 ? ? CB A CYS 29 ? ? SG A CYS 29 ? ? 123.86 114.20 9.66 1.10 N 4 1 CB A TYR 30 ? ? CG A TYR 30 ? ? CD1 A TYR 30 ? ? 124.80 121.00 3.80 0.60 N 5 1 CA A CYS 32 ? ? CB A CYS 32 ? ? SG A CYS 32 ? ? 123.79 114.20 9.59 1.10 N 6 1 CG A TRP 36 ? ? CD1 A TRP 36 ? ? NE1 A TRP 36 ? ? 103.83 110.10 -6.27 1.00 N 7 1 CD1 A TRP 36 ? ? NE1 A TRP 36 ? ? CE2 A TRP 36 ? ? 116.68 109.00 7.68 0.90 N 8 1 NE1 A TRP 36 ? ? CE2 A TRP 36 ? ? CZ2 A TRP 36 ? ? 137.82 130.40 7.42 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 3 ? ? -106.85 63.63 2 1 ALA A 5 ? ? -44.83 161.30 3 1 ARG A 7 ? ? -2.18 67.74 4 1 CYS A 8 ? ? -10.25 101.09 5 1 PRO A 9 ? ? -49.10 -2.70 6 1 LEU A 12 ? ? 64.85 60.55 7 1 ASP A 14 ? ? 67.85 104.81 8 1 PRO A 15 ? ? -84.28 46.35 9 1 SER A 16 ? ? -22.43 -69.17 10 1 PRO A 23 ? ? -80.02 37.39 11 1 LEU A 25 ? ? 3.25 59.87 12 1 VAL A 31 ? ? 25.36 37.93 13 1 PRO A 41 ? ? -53.08 -161.22 14 1 THR A 42 ? ? 47.55 79.26 15 1 CYS A 43 ? ? -9.79 129.28 16 1 LYS A 47 ? ? 19.78 57.22 17 1 VAL A 50 ? ? -24.63 146.04 18 1 SER A 59 ? ? 4.22 75.75 19 1 SER A 61 ? ? 137.09 83.10 20 1 PHE A 63 ? ? 64.39 179.12 21 1 ASP A 65 ? ? -118.36 -142.84 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 7 ? ? 0.309 'SIDE CHAIN' 2 1 ARG A 35 ? ? 0.278 'SIDE CHAIN' 3 1 ARG A 38 ? ? 0.316 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #