data_1CHL # _entry.id 1CHL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1CHL pdb_00001chl 10.2210/pdb1chl/pdb WWPDB D_1000172330 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-02-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CHL _pdbx_database_status.recvd_initial_deposition_date 1994-11-09 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lippens, G.' 1 'Najib, J.' 2 'Wodak, S.J.' 3 'Tartar, A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR sequential assignments and solution structure of chlorotoxin, a small scorpion toxin that blocks chloride channels.' Biochemistry 34 13 21 1995 BICHAW US 0006-2960 0033 ? 7819188 10.1021/bi00001a003 1 ;Purification and Characterization of Chloraphyllin, a Chloride Channel Ligand from the Venom of the Scorpion Leiurus Quinquestriatus Quinquestriatus ; Am.J.Physiol. 264 C361 ? 1993 AJPHAP US 0002-9513 2054 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lippens, G.' 1 ? primary 'Najib, J.' 2 ? primary 'Wodak, S.J.' 3 ? primary 'Tartar, A.' 4 ? 1 'Debin, J.A.' 5 ? 1 'Maggio, J.E.' 6 ? 1 'Strichartz, G.R.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description CHLOROTOXIN _entity.formula_weight 4011.813 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR _entity_poly.pdbx_seq_one_letter_code_can MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 CYS n 1 3 MET n 1 4 PRO n 1 5 CYS n 1 6 PHE n 1 7 THR n 1 8 THR n 1 9 ASP n 1 10 HIS n 1 11 GLN n 1 12 MET n 1 13 ALA n 1 14 ARG n 1 15 LYS n 1 16 CYS n 1 17 ASP n 1 18 ASP n 1 19 CYS n 1 20 CYS n 1 21 GLY n 1 22 GLY n 1 23 LYS n 1 24 GLY n 1 25 ARG n 1 26 GLY n 1 27 LYS n 1 28 CYS n 1 29 TYR n 1 30 GLY n 1 31 PRO n 1 32 GLN n 1 33 CYS n 1 34 LEU n 1 35 CYS n 1 36 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Egyptian scorpion' _entity_src_gen.gene_src_genus Leiurus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Leiurus quinquestriatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6883 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 ARG 36 36 36 ARG ARG A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1CHL _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CHL _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1CHL _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1CHL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1CHL _struct.title 'NMR SEQUENTIAL ASSIGNMENTS AND SOLUTION STRUCTURE OF CHLOROTOXIN, A SMALL SCORPION TOXIN THAT BLOCKS CHLORIDE CHANNELS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CHL _struct_keywords.pdbx_keywords NEUROTOXIN _struct_keywords.text NEUROTOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCXL_LEIQU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P45639 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CHL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P45639 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 36 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 36 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 11 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 21 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 11 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 21 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 2 A CYS 19 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 5 A CYS 28 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 16 A CYS 33 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf4 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 20 A CYS 35 1_555 ? ? ? ? ? ? ? 2.018 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 2 ? CYS A 19 ? CYS A 2 ? 1_555 CYS A 19 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 5 ? CYS A 28 ? CYS A 5 ? 1_555 CYS A 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 16 ? CYS A 33 ? CYS A 16 ? 1_555 CYS A 33 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 20 ? CYS A 35 ? CYS A 20 ? 1_555 CYS A 35 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 MET A 1 ? PRO A 4 ? MET A 1 PRO A 4 S1 2 GLN A 32 ? ARG A 36 ? GLN A 32 ARG A 36 S1 3 GLY A 26 ? TYR A 29 ? GLY A 26 TYR A 29 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 N CYS A 2 ? N CYS A 2 O CYS A 33 ? O CYS A 33 S1 2 3 N LEU A 34 ? N LEU A 34 O LYS A 27 ? O LYS A 27 # _pdbx_entry_details.entry_id 1CHL _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 4 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 MET _pdbx_validate_rmsd_angle.auth_seq_id_1 3 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 4 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 4 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 114.36 _pdbx_validate_rmsd_angle.angle_target_value 128.40 _pdbx_validate_rmsd_angle.angle_deviation -14.04 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.10 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 3 ? ? -44.77 155.45 2 1 PRO A 4 ? ? -57.53 -162.59 3 1 PHE A 6 ? ? -150.85 40.85 4 1 THR A 8 ? ? 49.91 -160.91 5 1 ASP A 9 ? ? -157.00 -44.35 6 1 GLN A 11 ? ? -154.96 58.06 7 1 PRO A 31 ? ? -97.80 40.44 8 2 MET A 3 ? ? -177.00 -172.30 9 2 THR A 8 ? ? 67.30 171.98 10 2 MET A 12 ? ? -120.45 -58.30 11 2 ARG A 25 ? ? -148.65 37.09 12 2 LYS A 27 ? ? 171.44 -169.82 13 2 GLN A 32 ? ? -145.24 -159.39 14 3 CYS A 2 ? ? -112.23 -120.02 15 3 MET A 3 ? ? -102.52 -154.77 16 3 PRO A 4 ? ? -109.07 -160.72 17 3 PHE A 6 ? ? -112.43 -164.62 18 3 ASP A 9 ? ? 72.22 160.75 19 3 ARG A 25 ? ? -149.19 38.36 20 3 PRO A 31 ? ? -87.39 35.37 21 3 LEU A 34 ? ? -122.90 -164.71 22 4 MET A 3 ? ? 60.14 168.93 23 4 CYS A 5 ? ? -50.53 177.82 24 4 PHE A 6 ? ? 53.26 -174.24 25 4 THR A 8 ? ? 178.15 175.66 26 4 ASP A 9 ? ? -167.26 75.39 27 4 HIS A 10 ? ? -159.89 56.98 28 4 GLN A 11 ? ? 76.28 65.25 29 4 MET A 12 ? ? -127.68 -56.55 30 4 LYS A 23 ? ? -44.25 98.50 31 4 ARG A 25 ? ? -146.99 40.39 32 4 LEU A 34 ? ? -123.25 -161.30 33 5 MET A 3 ? ? 56.61 163.78 34 5 PRO A 4 ? ? -109.98 -159.91 35 5 THR A 7 ? ? 37.98 -132.10 36 5 THR A 8 ? ? 48.87 -94.33 37 5 ASP A 9 ? ? 73.62 73.69 38 5 HIS A 10 ? ? -139.56 -54.91 39 5 GLN A 11 ? ? -145.14 14.70 40 5 LYS A 23 ? ? 67.98 -83.84 41 5 LYS A 27 ? ? -151.68 -159.21 42 5 LEU A 34 ? ? -113.67 -166.84 43 5 CYS A 35 ? ? -117.25 -166.69 44 6 MET A 3 ? ? 84.47 178.65 45 6 PHE A 6 ? ? -151.64 84.12 46 6 THR A 7 ? ? -126.91 -78.13 47 6 HIS A 10 ? ? -153.76 59.46 48 6 ARG A 25 ? ? -146.90 39.96 49 7 CYS A 2 ? ? -104.66 -65.95 50 7 PHE A 6 ? ? -156.80 62.19 51 7 THR A 7 ? ? -140.39 -69.81 52 7 HIS A 10 ? ? 49.10 23.31 53 7 GLN A 11 ? ? -169.81 42.63 54 7 LYS A 27 ? ? -178.23 143.20 55 7 CYS A 28 ? ? -59.11 87.56 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 14 ? ? 0.309 'SIDE CHAIN' 2 1 ARG A 25 ? ? 0.250 'SIDE CHAIN' 3 1 ARG A 36 ? ? 0.317 'SIDE CHAIN' 4 2 ARG A 14 ? ? 0.293 'SIDE CHAIN' 5 2 ARG A 25 ? ? 0.181 'SIDE CHAIN' 6 2 ARG A 36 ? ? 0.304 'SIDE CHAIN' 7 3 ARG A 14 ? ? 0.315 'SIDE CHAIN' 8 3 ARG A 25 ? ? 0.231 'SIDE CHAIN' 9 3 ARG A 36 ? ? 0.234 'SIDE CHAIN' 10 4 ARG A 14 ? ? 0.217 'SIDE CHAIN' 11 4 ARG A 25 ? ? 0.250 'SIDE CHAIN' 12 4 ARG A 36 ? ? 0.111 'SIDE CHAIN' 13 5 ARG A 14 ? ? 0.185 'SIDE CHAIN' 14 5 ARG A 25 ? ? 0.296 'SIDE CHAIN' 15 5 ARG A 36 ? ? 0.164 'SIDE CHAIN' 16 6 ARG A 14 ? ? 0.293 'SIDE CHAIN' 17 6 ARG A 25 ? ? 0.305 'SIDE CHAIN' 18 6 ARG A 36 ? ? 0.208 'SIDE CHAIN' 19 7 ARG A 14 ? ? 0.307 'SIDE CHAIN' 20 7 ARG A 25 ? ? 0.197 'SIDE CHAIN' 21 7 ARG A 36 ? ? 0.262 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1CHL _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 7 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLY N N N N 91 GLY CA C N N 92 GLY C C N N 93 GLY O O N N 94 GLY OXT O N N 95 GLY H H N N 96 GLY H2 H N N 97 GLY HA2 H N N 98 GLY HA3 H N N 99 GLY HXT H N N 100 HIS N N N N 101 HIS CA C N S 102 HIS C C N N 103 HIS O O N N 104 HIS CB C N N 105 HIS CG C Y N 106 HIS ND1 N Y N 107 HIS CD2 C Y N 108 HIS CE1 C Y N 109 HIS NE2 N Y N 110 HIS OXT O N N 111 HIS H H N N 112 HIS H2 H N N 113 HIS HA H N N 114 HIS HB2 H N N 115 HIS HB3 H N N 116 HIS HD1 H N N 117 HIS HD2 H N N 118 HIS HE1 H N N 119 HIS HE2 H N N 120 HIS HXT H N N 121 LEU N N N N 122 LEU CA C N S 123 LEU C C N N 124 LEU O O N N 125 LEU CB C N N 126 LEU CG C N N 127 LEU CD1 C N N 128 LEU CD2 C N N 129 LEU OXT O N N 130 LEU H H N N 131 LEU H2 H N N 132 LEU HA H N N 133 LEU HB2 H N N 134 LEU HB3 H N N 135 LEU HG H N N 136 LEU HD11 H N N 137 LEU HD12 H N N 138 LEU HD13 H N N 139 LEU HD21 H N N 140 LEU HD22 H N N 141 LEU HD23 H N N 142 LEU HXT H N N 143 LYS N N N N 144 LYS CA C N S 145 LYS C C N N 146 LYS O O N N 147 LYS CB C N N 148 LYS CG C N N 149 LYS CD C N N 150 LYS CE C N N 151 LYS NZ N N N 152 LYS OXT O N N 153 LYS H H N N 154 LYS H2 H N N 155 LYS HA H N N 156 LYS HB2 H N N 157 LYS HB3 H N N 158 LYS HG2 H N N 159 LYS HG3 H N N 160 LYS HD2 H N N 161 LYS HD3 H N N 162 LYS HE2 H N N 163 LYS HE3 H N N 164 LYS HZ1 H N N 165 LYS HZ2 H N N 166 LYS HZ3 H N N 167 LYS HXT H N N 168 MET N N N N 169 MET CA C N S 170 MET C C N N 171 MET O O N N 172 MET CB C N N 173 MET CG C N N 174 MET SD S N N 175 MET CE C N N 176 MET OXT O N N 177 MET H H N N 178 MET H2 H N N 179 MET HA H N N 180 MET HB2 H N N 181 MET HB3 H N N 182 MET HG2 H N N 183 MET HG3 H N N 184 MET HE1 H N N 185 MET HE2 H N N 186 MET HE3 H N N 187 MET HXT H N N 188 PHE N N N N 189 PHE CA C N S 190 PHE C C N N 191 PHE O O N N 192 PHE CB C N N 193 PHE CG C Y N 194 PHE CD1 C Y N 195 PHE CD2 C Y N 196 PHE CE1 C Y N 197 PHE CE2 C Y N 198 PHE CZ C Y N 199 PHE OXT O N N 200 PHE H H N N 201 PHE H2 H N N 202 PHE HA H N N 203 PHE HB2 H N N 204 PHE HB3 H N N 205 PHE HD1 H N N 206 PHE HD2 H N N 207 PHE HE1 H N N 208 PHE HE2 H N N 209 PHE HZ H N N 210 PHE HXT H N N 211 PRO N N N N 212 PRO CA C N S 213 PRO C C N N 214 PRO O O N N 215 PRO CB C N N 216 PRO CG C N N 217 PRO CD C N N 218 PRO OXT O N N 219 PRO H H N N 220 PRO HA H N N 221 PRO HB2 H N N 222 PRO HB3 H N N 223 PRO HG2 H N N 224 PRO HG3 H N N 225 PRO HD2 H N N 226 PRO HD3 H N N 227 PRO HXT H N N 228 THR N N N N 229 THR CA C N S 230 THR C C N N 231 THR O O N N 232 THR CB C N R 233 THR OG1 O N N 234 THR CG2 C N N 235 THR OXT O N N 236 THR H H N N 237 THR H2 H N N 238 THR HA H N N 239 THR HB H N N 240 THR HG1 H N N 241 THR HG21 H N N 242 THR HG22 H N N 243 THR HG23 H N N 244 THR HXT H N N 245 TYR N N N N 246 TYR CA C N S 247 TYR C C N N 248 TYR O O N N 249 TYR CB C N N 250 TYR CG C Y N 251 TYR CD1 C Y N 252 TYR CD2 C Y N 253 TYR CE1 C Y N 254 TYR CE2 C Y N 255 TYR CZ C Y N 256 TYR OH O N N 257 TYR OXT O N N 258 TYR H H N N 259 TYR H2 H N N 260 TYR HA H N N 261 TYR HB2 H N N 262 TYR HB3 H N N 263 TYR HD1 H N N 264 TYR HD2 H N N 265 TYR HE1 H N N 266 TYR HE2 H N N 267 TYR HH H N N 268 TYR HXT H N N 269 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLY N CA sing N N 86 GLY N H sing N N 87 GLY N H2 sing N N 88 GLY CA C sing N N 89 GLY CA HA2 sing N N 90 GLY CA HA3 sing N N 91 GLY C O doub N N 92 GLY C OXT sing N N 93 GLY OXT HXT sing N N 94 HIS N CA sing N N 95 HIS N H sing N N 96 HIS N H2 sing N N 97 HIS CA C sing N N 98 HIS CA CB sing N N 99 HIS CA HA sing N N 100 HIS C O doub N N 101 HIS C OXT sing N N 102 HIS CB CG sing N N 103 HIS CB HB2 sing N N 104 HIS CB HB3 sing N N 105 HIS CG ND1 sing Y N 106 HIS CG CD2 doub Y N 107 HIS ND1 CE1 doub Y N 108 HIS ND1 HD1 sing N N 109 HIS CD2 NE2 sing Y N 110 HIS CD2 HD2 sing N N 111 HIS CE1 NE2 sing Y N 112 HIS CE1 HE1 sing N N 113 HIS NE2 HE2 sing N N 114 HIS OXT HXT sing N N 115 LEU N CA sing N N 116 LEU N H sing N N 117 LEU N H2 sing N N 118 LEU CA C sing N N 119 LEU CA CB sing N N 120 LEU CA HA sing N N 121 LEU C O doub N N 122 LEU C OXT sing N N 123 LEU CB CG sing N N 124 LEU CB HB2 sing N N 125 LEU CB HB3 sing N N 126 LEU CG CD1 sing N N 127 LEU CG CD2 sing N N 128 LEU CG HG sing N N 129 LEU CD1 HD11 sing N N 130 LEU CD1 HD12 sing N N 131 LEU CD1 HD13 sing N N 132 LEU CD2 HD21 sing N N 133 LEU CD2 HD22 sing N N 134 LEU CD2 HD23 sing N N 135 LEU OXT HXT sing N N 136 LYS N CA sing N N 137 LYS N H sing N N 138 LYS N H2 sing N N 139 LYS CA C sing N N 140 LYS CA CB sing N N 141 LYS CA HA sing N N 142 LYS C O doub N N 143 LYS C OXT sing N N 144 LYS CB CG sing N N 145 LYS CB HB2 sing N N 146 LYS CB HB3 sing N N 147 LYS CG CD sing N N 148 LYS CG HG2 sing N N 149 LYS CG HG3 sing N N 150 LYS CD CE sing N N 151 LYS CD HD2 sing N N 152 LYS CD HD3 sing N N 153 LYS CE NZ sing N N 154 LYS CE HE2 sing N N 155 LYS CE HE3 sing N N 156 LYS NZ HZ1 sing N N 157 LYS NZ HZ2 sing N N 158 LYS NZ HZ3 sing N N 159 LYS OXT HXT sing N N 160 MET N CA sing N N 161 MET N H sing N N 162 MET N H2 sing N N 163 MET CA C sing N N 164 MET CA CB sing N N 165 MET CA HA sing N N 166 MET C O doub N N 167 MET C OXT sing N N 168 MET CB CG sing N N 169 MET CB HB2 sing N N 170 MET CB HB3 sing N N 171 MET CG SD sing N N 172 MET CG HG2 sing N N 173 MET CG HG3 sing N N 174 MET SD CE sing N N 175 MET CE HE1 sing N N 176 MET CE HE2 sing N N 177 MET CE HE3 sing N N 178 MET OXT HXT sing N N 179 PHE N CA sing N N 180 PHE N H sing N N 181 PHE N H2 sing N N 182 PHE CA C sing N N 183 PHE CA CB sing N N 184 PHE CA HA sing N N 185 PHE C O doub N N 186 PHE C OXT sing N N 187 PHE CB CG sing N N 188 PHE CB HB2 sing N N 189 PHE CB HB3 sing N N 190 PHE CG CD1 doub Y N 191 PHE CG CD2 sing Y N 192 PHE CD1 CE1 sing Y N 193 PHE CD1 HD1 sing N N 194 PHE CD2 CE2 doub Y N 195 PHE CD2 HD2 sing N N 196 PHE CE1 CZ doub Y N 197 PHE CE1 HE1 sing N N 198 PHE CE2 CZ sing Y N 199 PHE CE2 HE2 sing N N 200 PHE CZ HZ sing N N 201 PHE OXT HXT sing N N 202 PRO N CA sing N N 203 PRO N CD sing N N 204 PRO N H sing N N 205 PRO CA C sing N N 206 PRO CA CB sing N N 207 PRO CA HA sing N N 208 PRO C O doub N N 209 PRO C OXT sing N N 210 PRO CB CG sing N N 211 PRO CB HB2 sing N N 212 PRO CB HB3 sing N N 213 PRO CG CD sing N N 214 PRO CG HG2 sing N N 215 PRO CG HG3 sing N N 216 PRO CD HD2 sing N N 217 PRO CD HD3 sing N N 218 PRO OXT HXT sing N N 219 THR N CA sing N N 220 THR N H sing N N 221 THR N H2 sing N N 222 THR CA C sing N N 223 THR CA CB sing N N 224 THR CA HA sing N N 225 THR C O doub N N 226 THR C OXT sing N N 227 THR CB OG1 sing N N 228 THR CB CG2 sing N N 229 THR CB HB sing N N 230 THR OG1 HG1 sing N N 231 THR CG2 HG21 sing N N 232 THR CG2 HG22 sing N N 233 THR CG2 HG23 sing N N 234 THR OXT HXT sing N N 235 TYR N CA sing N N 236 TYR N H sing N N 237 TYR N H2 sing N N 238 TYR CA C sing N N 239 TYR CA CB sing N N 240 TYR CA HA sing N N 241 TYR C O doub N N 242 TYR C OXT sing N N 243 TYR CB CG sing N N 244 TYR CB HB2 sing N N 245 TYR CB HB3 sing N N 246 TYR CG CD1 doub Y N 247 TYR CG CD2 sing Y N 248 TYR CD1 CE1 sing Y N 249 TYR CD1 HD1 sing N N 250 TYR CD2 CE2 doub Y N 251 TYR CD2 HD2 sing N N 252 TYR CE1 CZ doub Y N 253 TYR CE1 HE1 sing N N 254 TYR CE2 CZ sing Y N 255 TYR CE2 HE2 sing N N 256 TYR CZ OH sing N N 257 TYR OH HH sing N N 258 TYR OXT HXT sing N N 259 # _atom_sites.entry_id 1CHL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #