data_1CIR # _entry.id 1CIR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1CIR pdb_00001cir 10.2210/pdb1cir/pdb WWPDB D_1000172349 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-01-29 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CIR _pdbx_database_status.recvd_initial_deposition_date 1995-10-02 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Davis, B.J.' 1 'Fersht, A.R.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Towards the complete structural characterization of a protein folding pathway: the structures of the denatured, transition and native states for the association/folding of two complementary fragments of cleaved chymotrypsin inhibitor 2. Direct evidence for a nucleation-condensation mechanism ; 'Structure Fold.Des.' 1 189 208 1996 FODEFH UK 0969-2126 1263 ? 9079381 '10.1016/S1359-0278(96)00031-4' 1 ;The Structure of the Transition State for the Association of Two Fragments of the Barley Chymotrypsin Inhibitor-2 to Generate Native-Like Protein: Implications for Mechanisms of Protein Folding ; Proc.Natl.Acad.Sci.USA 91 10943 ? 1994 PNASA6 US 0027-8424 0040 ? ? ? 2 ;Generation of a Family of Protein Fragments for Structure-Folding Studies. 1. Folding Complementation of Two Fragments of Chymotrypsin Inhibitor-2 Formed by Cleavage at its Unique Methionine Residue ; Biochemistry 33 7957 ? 1994 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Neira, J.L.' 1 ? primary 'Davis, B.' 2 ? primary 'Ladurner, A.G.' 3 ? primary 'Buckle, A.M.' 4 ? primary 'Gay Gde, P.' 5 ? primary 'Fersht, A.R.' 6 ? 1 'De Prat Gay, G.' 7 ? 1 'Ruiz-Sanz, J.' 8 ? 1 'Davis, B.' 9 ? 1 'Fersht, A.R.' 10 ? 2 'De Prat Gay, G.' 11 ? 2 'Fersht, A.R.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CHYMOTRYPSIN INHIBITOR 2' 4424.221 1 ? ? ? 'CLEAVED BETWEEN RESIDUES 40 AND 41' 2 polymer man 'CHYMOTRYPSIN INHIBITOR 2' 2877.325 1 ? ? ? 'CLEAVED BETWEEN RESIDUES 40 AND 41' # loop_ _entity_name_com.entity_id _entity_name_com.name 1 CI2 2 CI2 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes 'MKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVT(HSE)' MKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTS A ? 2 'polypeptide(L)' no no EYRIDRVRLFVDKLDNIAQVPRVG EYRIDRVRLFVDKLDNIAQVPRVG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 GLU n 1 5 TRP n 1 6 PRO n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 GLY n 1 11 LYS n 1 12 SER n 1 13 VAL n 1 14 GLU n 1 15 GLU n 1 16 ALA n 1 17 LYS n 1 18 LYS n 1 19 VAL n 1 20 ILE n 1 21 LEU n 1 22 GLN n 1 23 ASP n 1 24 LYS n 1 25 PRO n 1 26 GLU n 1 27 ALA n 1 28 GLN n 1 29 ILE n 1 30 ILE n 1 31 VAL n 1 32 LEU n 1 33 PRO n 1 34 VAL n 1 35 GLY n 1 36 THR n 1 37 ILE n 1 38 VAL n 1 39 THR n 1 40 HSE n 2 1 GLU n 2 2 TYR n 2 3 ARG n 2 4 ILE n 2 5 ASP n 2 6 ARG n 2 7 VAL n 2 8 ARG n 2 9 LEU n 2 10 PHE n 2 11 VAL n 2 12 ASP n 2 13 LYS n 2 14 LEU n 2 15 ASP n 2 16 ASN n 2 17 ILE n 2 18 ALA n 2 19 GLN n 2 20 VAL n 2 21 PRO n 2 22 ARG n 2 23 VAL n 2 24 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? ? Hordeum ? ? HIPROLY ? ? ? ? 'Hordeum vulgare' 4513 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? PTZ18U ? ? 2 1 sample ? ? ? ? Hordeum ? ? HIPROLY ? ? ? ? 'Hordeum vulgare' 4513 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? PTZ18U ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HSE 'L-peptide linking' n L-HOMOSERINE ? 'C4 H9 N O3' 119.119 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 HSE 40 40 ? ? ? A . n B 2 1 GLU 1 41 41 GLU GLU B . n B 2 2 TYR 2 42 42 TYR TYR B . n B 2 3 ARG 3 43 43 ARG ARG B . n B 2 4 ILE 4 44 44 ILE ILE B . n B 2 5 ASP 5 45 45 ASP ASP B . n B 2 6 ARG 6 46 46 ARG ARG B . n B 2 7 VAL 7 47 47 VAL VAL B . n B 2 8 ARG 8 48 48 ARG ARG B . n B 2 9 LEU 9 49 49 LEU LEU B . n B 2 10 PHE 10 50 50 PHE PHE B . n B 2 11 VAL 11 51 51 VAL VAL B . n B 2 12 ASP 12 52 52 ASP ASP B . n B 2 13 LYS 13 53 53 LYS LYS B . n B 2 14 LEU 14 54 54 LEU LEU B . n B 2 15 ASP 15 55 55 ASP ASP B . n B 2 16 ASN 16 56 56 ASN ASN B . n B 2 17 ILE 17 57 57 ILE ILE B . n B 2 18 ALA 18 58 58 ALA ALA B . n B 2 19 GLN 19 59 59 GLN GLN B . n B 2 20 VAL 20 60 60 VAL VAL B . n B 2 21 PRO 21 61 61 PRO PRO B . n B 2 22 ARG 22 62 62 ARG ARG B . n B 2 23 VAL 23 63 63 VAL VAL B . n B 2 24 GLY 24 64 64 GLY GLY B . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # _cell.entry_id 1CIR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CIR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1CIR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1CIR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1CIR _struct.title 'COMPLEX OF TWO FRAGMENTS OF CI2 [(1-40)(DOT)(41-64)]' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CIR _struct_keywords.pdbx_keywords 'SERINE PROTEASE INHIBITOR' _struct_keywords.text 'SERINE PROTEASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code 1 UNP ICI2_HORVU P01053 1 21 ? ? 2 UNP ICI2_HORVU P01053 2 60 ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1CIR A 2 ? 39 ? P01053 21 ? 58 ? 2 39 2 2 1CIR B 1 ? 24 ? P01053 60 ? 83 ? 41 64 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 6 ? LEU A 8 ? PRO A 6 LEU A 8 5 ? 3 HELX_P HELX_P2 2 VAL A 13 ? ILE A 20 ? VAL A 13 ILE A 20 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 30 ? LEU A 32 ? ILE A 30 LEU A 32 A 2 ARG B 8 ? PHE B 10 ? ARG B 48 PHE B 50 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 30 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 30 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 9 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 49 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 4 ? ? -131.53 -30.76 2 1 LYS A 11 ? ? -91.49 -144.28 3 1 GLU A 14 ? ? -44.60 -75.52 4 1 ALA A 16 ? ? -62.45 -80.66 5 1 LYS A 18 ? ? -51.53 -81.20 6 1 LEU A 21 ? ? -38.84 -23.82 7 1 GLN A 22 ? ? -135.37 -81.22 8 1 ASP A 23 ? ? 37.77 -94.82 9 1 LYS A 24 ? ? -58.48 -163.76 10 1 VAL A 34 ? ? 50.38 -91.85 11 1 THR A 36 ? ? -76.15 -167.12 12 1 ILE A 37 ? ? -112.40 65.33 13 1 VAL A 38 ? ? 58.53 81.53 14 1 TYR B 42 ? ? -136.18 -148.12 15 1 ASP B 45 ? ? -107.66 46.43 16 1 ARG B 48 ? ? -53.35 87.95 17 1 ASP B 52 ? ? -93.52 -151.34 18 1 ILE B 57 ? ? -31.94 87.09 19 1 ARG B 62 ? ? -140.58 -49.15 20 1 VAL B 63 ? ? 76.04 -3.14 21 2 LYS A 2 ? ? -52.81 98.87 22 2 GLU A 4 ? ? -148.45 -44.20 23 2 LYS A 11 ? ? -94.54 -146.88 24 2 GLU A 14 ? ? -44.07 -73.75 25 2 ALA A 16 ? ? -61.39 -83.40 26 2 LYS A 18 ? ? -44.57 -77.37 27 2 LYS A 24 ? ? -68.23 -153.87 28 2 GLU A 26 ? ? -166.34 52.33 29 2 TYR B 42 ? ? -75.31 -148.72 30 2 ARG B 43 ? ? -104.59 62.66 31 2 ILE B 44 ? ? -44.88 160.13 32 2 ASP B 52 ? ? -124.86 -154.30 33 2 LEU B 54 ? ? -99.58 44.58 34 2 ILE B 57 ? ? -34.34 86.98 35 3 GLU A 4 ? ? -125.50 -57.75 36 3 TRP A 5 ? ? 70.30 39.78 37 3 LYS A 11 ? ? -154.30 78.14 38 3 SER A 12 ? ? -153.18 46.73 39 3 VAL A 13 ? ? -77.28 -73.03 40 3 ALA A 16 ? ? -62.69 -71.62 41 3 LYS A 18 ? ? -62.17 -90.29 42 3 LEU A 21 ? ? -35.13 -29.99 43 3 LYS A 24 ? ? 69.86 -147.00 44 3 GLU A 26 ? ? -161.06 64.66 45 3 VAL A 34 ? ? 81.24 -71.37 46 3 THR A 36 ? ? -33.14 120.68 47 3 VAL A 38 ? ? -57.86 -175.80 48 3 TYR B 42 ? ? -127.36 -145.39 49 3 ARG B 43 ? ? -114.91 67.33 50 3 ASP B 45 ? ? -105.86 43.05 51 3 ARG B 48 ? ? -101.59 66.51 52 3 LEU B 49 ? ? -61.49 89.94 53 3 ASP B 52 ? ? -126.48 -162.84 54 3 LEU B 54 ? ? -95.38 52.28 55 3 ILE B 57 ? ? -60.69 89.00 56 4 TRP A 5 ? ? -150.78 47.30 57 4 LYS A 11 ? ? -96.12 -144.59 58 4 GLU A 14 ? ? -43.80 -72.10 59 4 ALA A 16 ? ? -63.44 -84.10 60 4 LYS A 18 ? ? -55.98 -82.10 61 4 GLN A 22 ? ? -143.61 54.58 62 4 LYS A 24 ? ? -130.72 -83.45 63 4 PRO A 25 ? ? -88.68 -84.93 64 4 GLU A 26 ? ? -162.06 56.30 65 4 VAL A 34 ? ? 77.33 -70.04 66 4 THR A 36 ? ? -46.15 -91.73 67 4 ILE A 37 ? ? 40.44 87.50 68 4 VAL A 38 ? ? 71.00 -99.80 69 4 TYR B 42 ? ? -59.15 -157.92 70 4 ASP B 45 ? ? -89.62 48.30 71 4 ASP B 52 ? ? -107.89 -151.72 72 4 LEU B 54 ? ? -98.99 38.19 73 4 ILE B 57 ? ? -46.88 87.68 74 5 LYS A 11 ? ? -91.10 -145.63 75 5 GLU A 14 ? ? -43.05 -74.06 76 5 ALA A 16 ? ? -59.44 -80.87 77 5 LYS A 18 ? ? -58.86 -85.09 78 5 GLN A 22 ? ? -140.38 40.88 79 5 LYS A 24 ? ? -130.75 -78.69 80 5 PRO A 25 ? ? -87.57 -80.79 81 5 GLU A 26 ? ? -161.96 62.08 82 5 VAL A 34 ? ? 44.16 -93.14 83 5 TYR B 42 ? ? -121.43 -158.13 84 5 ARG B 43 ? ? -91.60 57.02 85 5 ASP B 45 ? ? -102.10 48.67 86 5 ASP B 52 ? ? -94.66 -153.04 87 5 LEU B 54 ? ? -95.83 39.69 88 5 ILE B 57 ? ? -39.68 87.72 89 6 LYS A 11 ? ? -93.55 -142.56 90 6 GLU A 14 ? ? -44.84 -73.88 91 6 ALA A 16 ? ? -62.82 -85.25 92 6 LYS A 18 ? ? -42.37 -76.13 93 6 ILE A 20 ? ? -37.98 -34.72 94 6 LYS A 24 ? ? -101.05 -105.77 95 6 PRO A 25 ? ? -80.16 -70.98 96 6 GLU A 26 ? ? -162.76 70.20 97 6 PRO A 33 ? ? -78.90 -93.67 98 6 VAL A 34 ? ? -171.94 -35.07 99 6 THR A 36 ? ? -48.65 104.20 100 6 ILE A 37 ? ? 50.16 -94.10 101 6 TYR B 42 ? ? -100.58 -153.53 102 6 ARG B 43 ? ? -109.57 66.83 103 6 ASP B 45 ? ? -102.39 44.43 104 6 VAL B 51 ? ? -107.21 -151.57 105 6 ASP B 52 ? ? -141.92 -157.47 106 6 LEU B 54 ? ? -96.20 42.82 107 6 ILE B 57 ? ? -42.06 89.17 108 7 LYS A 11 ? ? -94.65 -145.43 109 7 GLU A 14 ? ? -44.41 -75.28 110 7 ALA A 16 ? ? -62.58 -85.16 111 7 LYS A 18 ? ? -56.78 -77.95 112 7 LEU A 21 ? ? -36.04 -35.84 113 7 GLN A 22 ? ? -141.91 56.87 114 7 LYS A 24 ? ? -133.84 -97.85 115 7 GLU A 26 ? ? -163.84 72.26 116 7 PRO A 33 ? ? -75.58 -96.58 117 7 VAL A 34 ? ? -158.98 13.55 118 7 VAL A 38 ? ? 39.80 -97.04 119 7 ASP B 45 ? ? -90.13 38.65 120 7 LEU B 54 ? ? -88.96 38.08 121 7 ILE B 57 ? ? -51.90 91.32 122 8 LYS A 2 ? ? -50.60 87.70 123 8 TRP A 5 ? ? -145.61 46.75 124 8 LYS A 11 ? ? -93.55 -154.78 125 8 GLU A 14 ? ? -41.88 -71.07 126 8 ALA A 16 ? ? -62.21 -81.36 127 8 LYS A 18 ? ? -62.33 -84.96 128 8 LEU A 21 ? ? -35.66 -33.97 129 8 GLN A 22 ? ? -150.48 50.25 130 8 LYS A 24 ? ? -102.38 -92.38 131 8 PRO A 25 ? ? -87.05 -74.14 132 8 GLU A 26 ? ? -162.47 56.94 133 8 PRO A 33 ? ? -81.27 42.22 134 8 VAL A 34 ? ? 42.23 100.86 135 8 THR A 36 ? ? -69.39 -78.65 136 8 ILE A 37 ? ? 86.33 122.46 137 8 VAL A 38 ? ? 57.23 106.87 138 8 TYR B 42 ? ? -129.53 -158.85 139 8 ASP B 45 ? ? -103.41 44.57 140 8 ARG B 48 ? ? -111.89 79.80 141 8 LEU B 49 ? ? -62.18 94.74 142 8 ASP B 52 ? ? -116.24 -151.07 143 8 LEU B 54 ? ? -100.07 44.60 144 8 ILE B 57 ? ? -30.06 86.79 145 9 TRP A 5 ? ? -150.10 45.05 146 9 LYS A 11 ? ? -95.76 -143.50 147 9 GLU A 14 ? ? -42.52 -75.75 148 9 ALA A 16 ? ? -62.18 -85.20 149 9 LYS A 18 ? ? -56.41 -83.35 150 9 LYS A 24 ? ? -94.60 -116.05 151 9 GLU A 26 ? ? -161.29 60.45 152 9 VAL A 34 ? ? 81.34 -71.72 153 9 TYR B 42 ? ? 61.80 157.22 154 9 ASP B 45 ? ? -95.35 45.75 155 9 ARG B 48 ? ? -112.15 69.05 156 9 LEU B 49 ? ? -56.49 94.18 157 9 ASP B 52 ? ? -126.91 -154.76 158 9 LEU B 54 ? ? -98.48 44.07 159 9 ILE B 57 ? ? -44.27 91.65 160 10 LYS A 2 ? ? -67.14 99.14 161 10 THR A 3 ? ? -140.98 -41.12 162 10 LYS A 11 ? ? -93.41 -149.44 163 10 ALA A 16 ? ? -62.11 -82.85 164 10 LYS A 18 ? ? -47.48 -78.18 165 10 ILE A 20 ? ? -39.53 -34.82 166 10 ASP A 23 ? ? 38.78 -92.81 167 10 LYS A 24 ? ? -64.27 -131.72 168 10 GLU A 26 ? ? -162.17 70.49 169 10 ILE A 37 ? ? -117.03 -87.49 170 10 TYR B 42 ? ? -71.18 -110.14 171 10 ASP B 45 ? ? -102.51 47.01 172 10 LEU B 49 ? ? -60.79 90.11 173 10 ASP B 52 ? ? -109.22 -154.95 174 10 LEU B 54 ? ? -95.88 42.90 175 10 ILE B 57 ? ? -39.61 90.77 176 11 TRP A 5 ? ? -141.09 46.00 177 11 VAL A 9 ? ? -48.81 154.14 178 11 LYS A 11 ? ? -93.69 -143.70 179 11 ALA A 16 ? ? -64.90 -84.05 180 11 LYS A 18 ? ? -55.02 -75.53 181 11 LEU A 21 ? ? -39.40 -28.08 182 11 GLN A 22 ? ? -149.90 26.82 183 11 LYS A 24 ? ? -80.47 -117.58 184 11 GLU A 26 ? ? -159.97 60.97 185 11 VAL A 34 ? ? 45.75 -90.90 186 11 THR A 36 ? ? -94.31 -148.02 187 11 ILE A 37 ? ? -59.76 -172.57 188 11 TYR B 42 ? ? -127.51 -162.58 189 11 ASP B 52 ? ? -116.70 -146.43 190 11 ASP B 55 ? ? 91.43 47.87 191 11 ILE B 57 ? ? -37.28 88.27 192 12 LYS A 2 ? ? -90.94 34.64 193 12 LYS A 11 ? ? -93.92 -141.26 194 12 GLU A 14 ? ? -45.87 -77.94 195 12 ALA A 16 ? ? -62.02 -85.44 196 12 LYS A 18 ? ? -57.60 -82.13 197 12 LEU A 21 ? ? -36.88 -29.76 198 12 GLN A 22 ? ? -148.74 52.53 199 12 PRO A 25 ? ? -91.25 -82.10 200 12 GLU A 26 ? ? -161.45 65.46 201 12 PRO A 33 ? ? -77.93 25.18 202 12 VAL A 34 ? ? 79.72 -11.78 203 12 THR A 36 ? ? -45.91 169.83 204 12 TYR B 42 ? ? -111.16 -147.40 205 12 ARG B 43 ? ? -107.03 55.91 206 12 ASP B 45 ? ? -99.40 44.86 207 12 ASP B 52 ? ? -129.72 -168.13 208 12 LEU B 54 ? ? -89.96 47.20 209 12 ILE B 57 ? ? -42.79 91.36 210 13 LYS A 2 ? ? -90.01 43.22 211 13 LYS A 11 ? ? -99.63 -154.71 212 13 ALA A 16 ? ? -67.54 -82.18 213 13 LYS A 18 ? ? -49.92 -72.10 214 13 LYS A 24 ? ? -107.24 -106.62 215 13 GLU A 26 ? ? -162.02 64.09 216 13 VAL A 34 ? ? 41.34 -96.71 217 13 THR A 36 ? ? -36.74 86.68 218 13 ILE A 37 ? ? 33.36 74.78 219 13 VAL A 38 ? ? -95.30 -68.11 220 13 TYR B 42 ? ? -57.32 -158.63 221 13 ASP B 52 ? ? -120.00 -154.80 222 13 LEU B 54 ? ? -97.12 41.87 223 13 ILE B 57 ? ? -37.45 89.59 224 14 LYS A 11 ? ? -96.16 -151.76 225 14 GLU A 14 ? ? -44.05 -74.76 226 14 ALA A 16 ? ? -59.02 -83.15 227 14 LYS A 18 ? ? -63.35 -83.82 228 14 LEU A 21 ? ? -34.98 -36.45 229 14 GLN A 22 ? ? -147.36 41.40 230 14 LYS A 24 ? ? -120.71 -88.49 231 14 PRO A 25 ? ? -84.07 -81.47 232 14 GLU A 26 ? ? -158.79 57.83 233 14 PRO A 33 ? ? -79.75 21.99 234 14 VAL A 34 ? ? 78.52 -6.35 235 14 THR A 36 ? ? -69.55 93.97 236 14 ILE A 37 ? ? -157.77 24.21 237 14 TYR B 42 ? ? -118.65 -154.82 238 14 ASP B 45 ? ? -97.12 45.64 239 14 ASP B 52 ? ? -135.94 -158.71 240 14 LEU B 54 ? ? -97.23 52.81 241 14 ILE B 57 ? ? -35.51 88.74 242 14 ARG B 62 ? ? -138.97 -43.98 243 14 VAL B 63 ? ? 77.59 -4.68 244 15 LYS A 11 ? ? -96.51 -141.81 245 15 GLU A 14 ? ? -45.46 -75.41 246 15 ALA A 16 ? ? -64.88 -88.04 247 15 LYS A 18 ? ? -61.81 -82.89 248 15 LEU A 21 ? ? -37.74 -33.24 249 15 GLN A 22 ? ? -149.51 50.47 250 15 LYS A 24 ? ? -124.01 -88.53 251 15 PRO A 25 ? ? -81.34 -79.66 252 15 GLU A 26 ? ? -160.99 66.00 253 15 PRO A 33 ? ? -81.18 45.67 254 15 VAL A 34 ? ? 59.87 -90.37 255 15 VAL A 38 ? ? -96.43 -153.64 256 15 TYR B 42 ? ? -98.72 -123.03 257 15 ASP B 52 ? ? -126.28 -149.72 258 15 ASP B 55 ? ? 91.71 48.97 259 15 ILE B 57 ? ? -54.97 88.93 260 16 TRP A 5 ? ? -161.65 48.85 261 16 LYS A 11 ? ? -106.89 -143.87 262 16 GLU A 14 ? ? -45.27 -71.29 263 16 ALA A 16 ? ? -57.87 -79.36 264 16 LYS A 18 ? ? -56.31 -82.50 265 16 LEU A 21 ? ? -35.45 -32.20 266 16 GLN A 22 ? ? -145.77 56.88 267 16 LYS A 24 ? ? -110.07 -80.95 268 16 PRO A 25 ? ? -87.92 -71.87 269 16 GLU A 26 ? ? -165.02 62.30 270 16 PRO A 33 ? ? -74.03 -85.18 271 16 VAL A 34 ? ? -175.13 -34.67 272 16 TYR B 42 ? ? -98.49 -122.29 273 16 ASP B 45 ? ? -93.19 45.32 274 16 PHE B 50 ? ? -66.05 -159.86 275 16 ASP B 52 ? ? -122.66 -153.14 276 16 LEU B 54 ? ? -96.09 48.11 277 16 ILE B 57 ? ? -32.41 86.94 278 17 LYS A 2 ? ? -89.98 48.21 279 17 GLU A 4 ? ? -135.33 -40.58 280 17 LYS A 11 ? ? -93.13 -145.36 281 17 GLU A 14 ? ? -47.02 -74.46 282 17 ALA A 16 ? ? -66.60 -81.12 283 17 LYS A 18 ? ? -63.46 -81.44 284 17 LEU A 21 ? ? -29.56 -37.74 285 17 GLN A 22 ? ? -133.43 -72.67 286 17 ASP A 23 ? ? 42.48 -94.84 287 17 LYS A 24 ? ? -66.62 -118.14 288 17 PRO A 25 ? ? -79.77 -75.53 289 17 GLU A 26 ? ? -156.84 59.88 290 17 PRO A 33 ? ? -75.91 -94.84 291 17 VAL A 34 ? ? -164.74 103.94 292 17 TYR B 42 ? ? 40.66 -151.72 293 17 ASP B 45 ? ? -106.34 45.70 294 17 ARG B 48 ? ? -119.40 72.25 295 17 LEU B 49 ? ? -69.21 97.74 296 17 ASP B 52 ? ? -127.44 -71.90 297 17 LYS B 53 ? ? -93.21 -75.21 298 17 ASP B 55 ? ? 91.33 23.00 299 17 ILE B 57 ? ? -38.49 89.03 300 18 LYS A 2 ? ? -90.00 45.90 301 18 LYS A 11 ? ? -94.56 -143.52 302 18 GLU A 14 ? ? -41.38 -71.64 303 18 ALA A 16 ? ? -58.72 -83.85 304 18 LYS A 18 ? ? -61.35 -86.24 305 18 LEU A 21 ? ? -39.25 -23.41 306 18 GLN A 22 ? ? -142.10 13.33 307 18 ASP A 23 ? ? -49.29 150.72 308 18 LYS A 24 ? ? 52.81 -131.03 309 18 PRO A 25 ? ? -78.17 -83.03 310 18 PRO A 33 ? ? -81.77 34.87 311 18 VAL A 34 ? ? 56.91 3.31 312 18 TYR B 42 ? ? -124.98 -140.63 313 18 ASP B 45 ? ? -98.92 48.34 314 18 ARG B 48 ? ? -118.17 71.02 315 18 LEU B 49 ? ? -54.61 103.09 316 18 ASP B 52 ? ? -129.16 -161.97 317 18 LEU B 54 ? ? -89.57 48.98 318 18 ILE B 57 ? ? -59.46 90.55 319 19 LYS A 2 ? ? -86.05 45.61 320 19 THR A 3 ? ? -89.65 33.94 321 19 GLU A 4 ? ? -135.42 -47.73 322 19 LYS A 11 ? ? -99.78 -138.93 323 19 GLU A 14 ? ? -48.91 -74.27 324 19 ALA A 16 ? ? -61.08 -86.74 325 19 LYS A 18 ? ? -49.46 -78.82 326 19 LYS A 24 ? ? -117.42 -99.51 327 19 PRO A 25 ? ? -82.15 -76.14 328 19 GLU A 26 ? ? -160.77 56.35 329 19 PRO A 33 ? ? -78.63 35.50 330 19 VAL A 34 ? ? 73.47 -78.80 331 19 THR A 36 ? ? -88.69 39.22 332 19 ILE A 37 ? ? 65.95 144.69 333 19 TYR B 42 ? ? -131.63 -152.22 334 19 ARG B 43 ? ? -92.72 52.94 335 19 ASP B 45 ? ? -106.10 46.44 336 19 PHE B 50 ? ? -66.98 -162.88 337 19 ASP B 52 ? ? -112.37 -70.61 338 19 LYS B 53 ? ? -92.50 -75.91 339 19 ASP B 55 ? ? 91.51 24.13 340 19 ILE B 57 ? ? -37.33 89.03 341 20 LYS A 11 ? ? -95.44 -147.11 342 20 GLU A 14 ? ? -44.81 -76.90 343 20 ALA A 16 ? ? -63.46 -83.46 344 20 LYS A 18 ? ? -67.46 -86.28 345 20 LEU A 21 ? ? -39.15 -25.82 346 20 GLN A 22 ? ? -144.30 -67.99 347 20 ASP A 23 ? ? 39.54 -94.51 348 20 LYS A 24 ? ? -64.89 -118.95 349 20 PRO A 25 ? ? -80.56 -73.21 350 20 GLU A 26 ? ? -159.29 60.63 351 20 PRO A 33 ? ? -80.73 39.97 352 20 VAL A 34 ? ? 50.06 -92.12 353 20 THR A 36 ? ? -91.20 -101.03 354 20 ILE A 37 ? ? 67.95 173.24 355 20 VAL A 38 ? ? 78.86 -7.14 356 20 TYR B 42 ? ? -120.87 -155.72 357 20 ASP B 45 ? ? -96.54 50.21 358 20 ASP B 52 ? ? -126.77 -148.89 359 20 ILE B 57 ? ? -40.67 88.62 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG B 43 ? ? 0.222 'SIDE CHAIN' 2 1 ARG B 46 ? ? 0.277 'SIDE CHAIN' 3 1 ARG B 48 ? ? 0.317 'SIDE CHAIN' 4 1 ARG B 62 ? ? 0.317 'SIDE CHAIN' 5 2 ARG B 43 ? ? 0.264 'SIDE CHAIN' 6 2 ARG B 46 ? ? 0.313 'SIDE CHAIN' 7 2 ARG B 48 ? ? 0.315 'SIDE CHAIN' 8 2 ARG B 62 ? ? 0.317 'SIDE CHAIN' 9 3 ARG B 43 ? ? 0.308 'SIDE CHAIN' 10 3 ARG B 46 ? ? 0.235 'SIDE CHAIN' 11 3 ARG B 48 ? ? 0.238 'SIDE CHAIN' 12 3 ARG B 62 ? ? 0.239 'SIDE CHAIN' 13 4 ARG B 43 ? ? 0.216 'SIDE CHAIN' 14 4 ARG B 46 ? ? 0.314 'SIDE CHAIN' 15 4 ARG B 48 ? ? 0.313 'SIDE CHAIN' 16 4 ARG B 62 ? ? 0.224 'SIDE CHAIN' 17 5 ARG B 43 ? ? 0.194 'SIDE CHAIN' 18 5 ARG B 46 ? ? 0.232 'SIDE CHAIN' 19 5 ARG B 62 ? ? 0.318 'SIDE CHAIN' 20 6 ARG B 43 ? ? 0.199 'SIDE CHAIN' 21 6 ARG B 46 ? ? 0.145 'SIDE CHAIN' 22 6 ARG B 48 ? ? 0.124 'SIDE CHAIN' 23 6 ARG B 62 ? ? 0.202 'SIDE CHAIN' 24 7 ARG B 43 ? ? 0.314 'SIDE CHAIN' 25 7 ARG B 46 ? ? 0.279 'SIDE CHAIN' 26 7 ARG B 48 ? ? 0.292 'SIDE CHAIN' 27 7 ARG B 62 ? ? 0.191 'SIDE CHAIN' 28 8 ARG B 43 ? ? 0.232 'SIDE CHAIN' 29 8 ARG B 46 ? ? 0.143 'SIDE CHAIN' 30 8 ARG B 48 ? ? 0.298 'SIDE CHAIN' 31 9 ARG B 43 ? ? 0.300 'SIDE CHAIN' 32 9 ARG B 46 ? ? 0.261 'SIDE CHAIN' 33 9 ARG B 48 ? ? 0.317 'SIDE CHAIN' 34 9 ARG B 62 ? ? 0.289 'SIDE CHAIN' 35 10 ARG B 43 ? ? 0.314 'SIDE CHAIN' 36 10 ARG B 46 ? ? 0.112 'SIDE CHAIN' 37 10 ARG B 48 ? ? 0.316 'SIDE CHAIN' 38 10 ARG B 62 ? ? 0.289 'SIDE CHAIN' 39 11 ARG B 43 ? ? 0.274 'SIDE CHAIN' 40 11 ARG B 46 ? ? 0.115 'SIDE CHAIN' 41 11 ARG B 48 ? ? 0.165 'SIDE CHAIN' 42 11 ARG B 62 ? ? 0.171 'SIDE CHAIN' 43 12 ARG B 43 ? ? 0.190 'SIDE CHAIN' 44 12 ARG B 46 ? ? 0.232 'SIDE CHAIN' 45 12 ARG B 48 ? ? 0.309 'SIDE CHAIN' 46 13 ARG B 43 ? ? 0.276 'SIDE CHAIN' 47 13 ARG B 46 ? ? 0.190 'SIDE CHAIN' 48 13 ARG B 48 ? ? 0.292 'SIDE CHAIN' 49 13 ARG B 62 ? ? 0.303 'SIDE CHAIN' 50 14 ARG B 43 ? ? 0.264 'SIDE CHAIN' 51 14 ARG B 46 ? ? 0.216 'SIDE CHAIN' 52 14 ARG B 48 ? ? 0.206 'SIDE CHAIN' 53 14 ARG B 62 ? ? 0.283 'SIDE CHAIN' 54 15 ARG B 43 ? ? 0.317 'SIDE CHAIN' 55 15 ARG B 48 ? ? 0.217 'SIDE CHAIN' 56 15 ARG B 62 ? ? 0.186 'SIDE CHAIN' 57 16 ARG B 43 ? ? 0.095 'SIDE CHAIN' 58 16 ARG B 46 ? ? 0.112 'SIDE CHAIN' 59 16 ARG B 48 ? ? 0.275 'SIDE CHAIN' 60 16 ARG B 62 ? ? 0.208 'SIDE CHAIN' 61 17 ARG B 43 ? ? 0.313 'SIDE CHAIN' 62 17 ARG B 46 ? ? 0.317 'SIDE CHAIN' 63 17 ARG B 48 ? ? 0.184 'SIDE CHAIN' 64 17 ARG B 62 ? ? 0.317 'SIDE CHAIN' 65 18 ARG B 43 ? ? 0.207 'SIDE CHAIN' 66 18 ARG B 46 ? ? 0.190 'SIDE CHAIN' 67 18 ARG B 48 ? ? 0.317 'SIDE CHAIN' 68 18 ARG B 62 ? ? 0.312 'SIDE CHAIN' 69 19 ARG B 43 ? ? 0.284 'SIDE CHAIN' 70 19 ARG B 46 ? ? 0.165 'SIDE CHAIN' 71 19 ARG B 48 ? ? 0.285 'SIDE CHAIN' 72 19 ARG B 62 ? ? 0.316 'SIDE CHAIN' 73 20 ARG B 43 ? ? 0.211 'SIDE CHAIN' 74 20 ARG B 46 ? ? 0.296 'SIDE CHAIN' 75 20 ARG B 48 ? ? 0.304 'SIDE CHAIN' 76 20 ARG B 62 ? ? 0.268 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1CIR _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HSE 40 ? A HSE 40 2 2 Y 1 A HSE 40 ? A HSE 40 3 3 Y 1 A HSE 40 ? A HSE 40 4 4 Y 1 A HSE 40 ? A HSE 40 5 5 Y 1 A HSE 40 ? A HSE 40 6 6 Y 1 A HSE 40 ? A HSE 40 7 7 Y 1 A HSE 40 ? A HSE 40 8 8 Y 1 A HSE 40 ? A HSE 40 9 9 Y 1 A HSE 40 ? A HSE 40 10 10 Y 1 A HSE 40 ? A HSE 40 11 11 Y 1 A HSE 40 ? A HSE 40 12 12 Y 1 A HSE 40 ? A HSE 40 13 13 Y 1 A HSE 40 ? A HSE 40 14 14 Y 1 A HSE 40 ? A HSE 40 15 15 Y 1 A HSE 40 ? A HSE 40 16 16 Y 1 A HSE 40 ? A HSE 40 17 17 Y 1 A HSE 40 ? A HSE 40 18 18 Y 1 A HSE 40 ? A HSE 40 19 19 Y 1 A HSE 40 ? A HSE 40 20 20 Y 1 A HSE 40 ? A HSE 40 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HSE N N N N 123 HSE CA C N S 124 HSE C C N N 125 HSE C3 C N N 126 HSE O O N N 127 HSE OXT O N N 128 HSE C4 C N N 129 HSE O3 O N N 130 HSE H H N N 131 HSE H2 H N N 132 HSE HA H N N 133 HSE H31 H N N 134 HSE H32 H N N 135 HSE HXT H N N 136 HSE H41 H N N 137 HSE H42 H N N 138 HSE HO3 H N N 139 ILE N N N N 140 ILE CA C N S 141 ILE C C N N 142 ILE O O N N 143 ILE CB C N S 144 ILE CG1 C N N 145 ILE CG2 C N N 146 ILE CD1 C N N 147 ILE OXT O N N 148 ILE H H N N 149 ILE H2 H N N 150 ILE HA H N N 151 ILE HB H N N 152 ILE HG12 H N N 153 ILE HG13 H N N 154 ILE HG21 H N N 155 ILE HG22 H N N 156 ILE HG23 H N N 157 ILE HD11 H N N 158 ILE HD12 H N N 159 ILE HD13 H N N 160 ILE HXT H N N 161 LEU N N N N 162 LEU CA C N S 163 LEU C C N N 164 LEU O O N N 165 LEU CB C N N 166 LEU CG C N N 167 LEU CD1 C N N 168 LEU CD2 C N N 169 LEU OXT O N N 170 LEU H H N N 171 LEU H2 H N N 172 LEU HA H N N 173 LEU HB2 H N N 174 LEU HB3 H N N 175 LEU HG H N N 176 LEU HD11 H N N 177 LEU HD12 H N N 178 LEU HD13 H N N 179 LEU HD21 H N N 180 LEU HD22 H N N 181 LEU HD23 H N N 182 LEU HXT H N N 183 LYS N N N N 184 LYS CA C N S 185 LYS C C N N 186 LYS O O N N 187 LYS CB C N N 188 LYS CG C N N 189 LYS CD C N N 190 LYS CE C N N 191 LYS NZ N N N 192 LYS OXT O N N 193 LYS H H N N 194 LYS H2 H N N 195 LYS HA H N N 196 LYS HB2 H N N 197 LYS HB3 H N N 198 LYS HG2 H N N 199 LYS HG3 H N N 200 LYS HD2 H N N 201 LYS HD3 H N N 202 LYS HE2 H N N 203 LYS HE3 H N N 204 LYS HZ1 H N N 205 LYS HZ2 H N N 206 LYS HZ3 H N N 207 LYS HXT H N N 208 MET N N N N 209 MET CA C N S 210 MET C C N N 211 MET O O N N 212 MET CB C N N 213 MET CG C N N 214 MET SD S N N 215 MET CE C N N 216 MET OXT O N N 217 MET H H N N 218 MET H2 H N N 219 MET HA H N N 220 MET HB2 H N N 221 MET HB3 H N N 222 MET HG2 H N N 223 MET HG3 H N N 224 MET HE1 H N N 225 MET HE2 H N N 226 MET HE3 H N N 227 MET HXT H N N 228 PHE N N N N 229 PHE CA C N S 230 PHE C C N N 231 PHE O O N N 232 PHE CB C N N 233 PHE CG C Y N 234 PHE CD1 C Y N 235 PHE CD2 C Y N 236 PHE CE1 C Y N 237 PHE CE2 C Y N 238 PHE CZ C Y N 239 PHE OXT O N N 240 PHE H H N N 241 PHE H2 H N N 242 PHE HA H N N 243 PHE HB2 H N N 244 PHE HB3 H N N 245 PHE HD1 H N N 246 PHE HD2 H N N 247 PHE HE1 H N N 248 PHE HE2 H N N 249 PHE HZ H N N 250 PHE HXT H N N 251 PRO N N N N 252 PRO CA C N S 253 PRO C C N N 254 PRO O O N N 255 PRO CB C N N 256 PRO CG C N N 257 PRO CD C N N 258 PRO OXT O N N 259 PRO H H N N 260 PRO HA H N N 261 PRO HB2 H N N 262 PRO HB3 H N N 263 PRO HG2 H N N 264 PRO HG3 H N N 265 PRO HD2 H N N 266 PRO HD3 H N N 267 PRO HXT H N N 268 SER N N N N 269 SER CA C N S 270 SER C C N N 271 SER O O N N 272 SER CB C N N 273 SER OG O N N 274 SER OXT O N N 275 SER H H N N 276 SER H2 H N N 277 SER HA H N N 278 SER HB2 H N N 279 SER HB3 H N N 280 SER HG H N N 281 SER HXT H N N 282 THR N N N N 283 THR CA C N S 284 THR C C N N 285 THR O O N N 286 THR CB C N R 287 THR OG1 O N N 288 THR CG2 C N N 289 THR OXT O N N 290 THR H H N N 291 THR H2 H N N 292 THR HA H N N 293 THR HB H N N 294 THR HG1 H N N 295 THR HG21 H N N 296 THR HG22 H N N 297 THR HG23 H N N 298 THR HXT H N N 299 TRP N N N N 300 TRP CA C N S 301 TRP C C N N 302 TRP O O N N 303 TRP CB C N N 304 TRP CG C Y N 305 TRP CD1 C Y N 306 TRP CD2 C Y N 307 TRP NE1 N Y N 308 TRP CE2 C Y N 309 TRP CE3 C Y N 310 TRP CZ2 C Y N 311 TRP CZ3 C Y N 312 TRP CH2 C Y N 313 TRP OXT O N N 314 TRP H H N N 315 TRP H2 H N N 316 TRP HA H N N 317 TRP HB2 H N N 318 TRP HB3 H N N 319 TRP HD1 H N N 320 TRP HE1 H N N 321 TRP HE3 H N N 322 TRP HZ2 H N N 323 TRP HZ3 H N N 324 TRP HH2 H N N 325 TRP HXT H N N 326 TYR N N N N 327 TYR CA C N S 328 TYR C C N N 329 TYR O O N N 330 TYR CB C N N 331 TYR CG C Y N 332 TYR CD1 C Y N 333 TYR CD2 C Y N 334 TYR CE1 C Y N 335 TYR CE2 C Y N 336 TYR CZ C Y N 337 TYR OH O N N 338 TYR OXT O N N 339 TYR H H N N 340 TYR H2 H N N 341 TYR HA H N N 342 TYR HB2 H N N 343 TYR HB3 H N N 344 TYR HD1 H N N 345 TYR HD2 H N N 346 TYR HE1 H N N 347 TYR HE2 H N N 348 TYR HH H N N 349 TYR HXT H N N 350 VAL N N N N 351 VAL CA C N S 352 VAL C C N N 353 VAL O O N N 354 VAL CB C N N 355 VAL CG1 C N N 356 VAL CG2 C N N 357 VAL OXT O N N 358 VAL H H N N 359 VAL H2 H N N 360 VAL HA H N N 361 VAL HB H N N 362 VAL HG11 H N N 363 VAL HG12 H N N 364 VAL HG13 H N N 365 VAL HG21 H N N 366 VAL HG22 H N N 367 VAL HG23 H N N 368 VAL HXT H N N 369 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HSE N CA sing N N 116 HSE N H sing N N 117 HSE N H2 sing N N 118 HSE CA C sing N N 119 HSE CA C3 sing N N 120 HSE CA HA sing N N 121 HSE C O doub N N 122 HSE C OXT sing N N 123 HSE C3 C4 sing N N 124 HSE C3 H31 sing N N 125 HSE C3 H32 sing N N 126 HSE OXT HXT sing N N 127 HSE C4 O3 sing N N 128 HSE C4 H41 sing N N 129 HSE C4 H42 sing N N 130 HSE O3 HO3 sing N N 131 ILE N CA sing N N 132 ILE N H sing N N 133 ILE N H2 sing N N 134 ILE CA C sing N N 135 ILE CA CB sing N N 136 ILE CA HA sing N N 137 ILE C O doub N N 138 ILE C OXT sing N N 139 ILE CB CG1 sing N N 140 ILE CB CG2 sing N N 141 ILE CB HB sing N N 142 ILE CG1 CD1 sing N N 143 ILE CG1 HG12 sing N N 144 ILE CG1 HG13 sing N N 145 ILE CG2 HG21 sing N N 146 ILE CG2 HG22 sing N N 147 ILE CG2 HG23 sing N N 148 ILE CD1 HD11 sing N N 149 ILE CD1 HD12 sing N N 150 ILE CD1 HD13 sing N N 151 ILE OXT HXT sing N N 152 LEU N CA sing N N 153 LEU N H sing N N 154 LEU N H2 sing N N 155 LEU CA C sing N N 156 LEU CA CB sing N N 157 LEU CA HA sing N N 158 LEU C O doub N N 159 LEU C OXT sing N N 160 LEU CB CG sing N N 161 LEU CB HB2 sing N N 162 LEU CB HB3 sing N N 163 LEU CG CD1 sing N N 164 LEU CG CD2 sing N N 165 LEU CG HG sing N N 166 LEU CD1 HD11 sing N N 167 LEU CD1 HD12 sing N N 168 LEU CD1 HD13 sing N N 169 LEU CD2 HD21 sing N N 170 LEU CD2 HD22 sing N N 171 LEU CD2 HD23 sing N N 172 LEU OXT HXT sing N N 173 LYS N CA sing N N 174 LYS N H sing N N 175 LYS N H2 sing N N 176 LYS CA C sing N N 177 LYS CA CB sing N N 178 LYS CA HA sing N N 179 LYS C O doub N N 180 LYS C OXT sing N N 181 LYS CB CG sing N N 182 LYS CB HB2 sing N N 183 LYS CB HB3 sing N N 184 LYS CG CD sing N N 185 LYS CG HG2 sing N N 186 LYS CG HG3 sing N N 187 LYS CD CE sing N N 188 LYS CD HD2 sing N N 189 LYS CD HD3 sing N N 190 LYS CE NZ sing N N 191 LYS CE HE2 sing N N 192 LYS CE HE3 sing N N 193 LYS NZ HZ1 sing N N 194 LYS NZ HZ2 sing N N 195 LYS NZ HZ3 sing N N 196 LYS OXT HXT sing N N 197 MET N CA sing N N 198 MET N H sing N N 199 MET N H2 sing N N 200 MET CA C sing N N 201 MET CA CB sing N N 202 MET CA HA sing N N 203 MET C O doub N N 204 MET C OXT sing N N 205 MET CB CG sing N N 206 MET CB HB2 sing N N 207 MET CB HB3 sing N N 208 MET CG SD sing N N 209 MET CG HG2 sing N N 210 MET CG HG3 sing N N 211 MET SD CE sing N N 212 MET CE HE1 sing N N 213 MET CE HE2 sing N N 214 MET CE HE3 sing N N 215 MET OXT HXT sing N N 216 PHE N CA sing N N 217 PHE N H sing N N 218 PHE N H2 sing N N 219 PHE CA C sing N N 220 PHE CA CB sing N N 221 PHE CA HA sing N N 222 PHE C O doub N N 223 PHE C OXT sing N N 224 PHE CB CG sing N N 225 PHE CB HB2 sing N N 226 PHE CB HB3 sing N N 227 PHE CG CD1 doub Y N 228 PHE CG CD2 sing Y N 229 PHE CD1 CE1 sing Y N 230 PHE CD1 HD1 sing N N 231 PHE CD2 CE2 doub Y N 232 PHE CD2 HD2 sing N N 233 PHE CE1 CZ doub Y N 234 PHE CE1 HE1 sing N N 235 PHE CE2 CZ sing Y N 236 PHE CE2 HE2 sing N N 237 PHE CZ HZ sing N N 238 PHE OXT HXT sing N N 239 PRO N CA sing N N 240 PRO N CD sing N N 241 PRO N H sing N N 242 PRO CA C sing N N 243 PRO CA CB sing N N 244 PRO CA HA sing N N 245 PRO C O doub N N 246 PRO C OXT sing N N 247 PRO CB CG sing N N 248 PRO CB HB2 sing N N 249 PRO CB HB3 sing N N 250 PRO CG CD sing N N 251 PRO CG HG2 sing N N 252 PRO CG HG3 sing N N 253 PRO CD HD2 sing N N 254 PRO CD HD3 sing N N 255 PRO OXT HXT sing N N 256 SER N CA sing N N 257 SER N H sing N N 258 SER N H2 sing N N 259 SER CA C sing N N 260 SER CA CB sing N N 261 SER CA HA sing N N 262 SER C O doub N N 263 SER C OXT sing N N 264 SER CB OG sing N N 265 SER CB HB2 sing N N 266 SER CB HB3 sing N N 267 SER OG HG sing N N 268 SER OXT HXT sing N N 269 THR N CA sing N N 270 THR N H sing N N 271 THR N H2 sing N N 272 THR CA C sing N N 273 THR CA CB sing N N 274 THR CA HA sing N N 275 THR C O doub N N 276 THR C OXT sing N N 277 THR CB OG1 sing N N 278 THR CB CG2 sing N N 279 THR CB HB sing N N 280 THR OG1 HG1 sing N N 281 THR CG2 HG21 sing N N 282 THR CG2 HG22 sing N N 283 THR CG2 HG23 sing N N 284 THR OXT HXT sing N N 285 TRP N CA sing N N 286 TRP N H sing N N 287 TRP N H2 sing N N 288 TRP CA C sing N N 289 TRP CA CB sing N N 290 TRP CA HA sing N N 291 TRP C O doub N N 292 TRP C OXT sing N N 293 TRP CB CG sing N N 294 TRP CB HB2 sing N N 295 TRP CB HB3 sing N N 296 TRP CG CD1 doub Y N 297 TRP CG CD2 sing Y N 298 TRP CD1 NE1 sing Y N 299 TRP CD1 HD1 sing N N 300 TRP CD2 CE2 doub Y N 301 TRP CD2 CE3 sing Y N 302 TRP NE1 CE2 sing Y N 303 TRP NE1 HE1 sing N N 304 TRP CE2 CZ2 sing Y N 305 TRP CE3 CZ3 doub Y N 306 TRP CE3 HE3 sing N N 307 TRP CZ2 CH2 doub Y N 308 TRP CZ2 HZ2 sing N N 309 TRP CZ3 CH2 sing Y N 310 TRP CZ3 HZ3 sing N N 311 TRP CH2 HH2 sing N N 312 TRP OXT HXT sing N N 313 TYR N CA sing N N 314 TYR N H sing N N 315 TYR N H2 sing N N 316 TYR CA C sing N N 317 TYR CA CB sing N N 318 TYR CA HA sing N N 319 TYR C O doub N N 320 TYR C OXT sing N N 321 TYR CB CG sing N N 322 TYR CB HB2 sing N N 323 TYR CB HB3 sing N N 324 TYR CG CD1 doub Y N 325 TYR CG CD2 sing Y N 326 TYR CD1 CE1 sing Y N 327 TYR CD1 HD1 sing N N 328 TYR CD2 CE2 doub Y N 329 TYR CD2 HD2 sing N N 330 TYR CE1 CZ doub Y N 331 TYR CE1 HE1 sing N N 332 TYR CE2 CZ sing Y N 333 TYR CE2 HE2 sing N N 334 TYR CZ OH sing N N 335 TYR OH HH sing N N 336 TYR OXT HXT sing N N 337 VAL N CA sing N N 338 VAL N H sing N N 339 VAL N H2 sing N N 340 VAL CA C sing N N 341 VAL CA CB sing N N 342 VAL CA HA sing N N 343 VAL C O doub N N 344 VAL C OXT sing N N 345 VAL CB CG1 sing N N 346 VAL CB CG2 sing N N 347 VAL CB HB sing N N 348 VAL CG1 HG11 sing N N 349 VAL CG1 HG12 sing N N 350 VAL CG1 HG13 sing N N 351 VAL CG2 HG21 sing N N 352 VAL CG2 HG22 sing N N 353 VAL CG2 HG23 sing N N 354 VAL OXT HXT sing N N 355 # _atom_sites.entry_id 1CIR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_