data_1CPG # _entry.id 1CPG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.313 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1CPG WWPDB D_1000172455 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1CCP Native unspecified PDB 2CCP D235N unspecified PDB 3CCP W191F unspecified PDB 4CCP W51F unspecified PDB 1CPD . unspecified PDB 1CPE . unspecified PDB 1CPF . unspecified PDB 1BEJ . unspecified PDB 1BEM . unspecified PDB 1BEQ . unspecified PDB 1BES . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CPG _pdbx_database_status.recvd_initial_deposition_date 1994-08-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Miller, M.A.' 1 'Han, G.W.' 2 'Kraut, J.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'A cation binding motif stabilizes the compound I radical of cytochrome c peroxidase.' Proc.Natl.Acad.Sci.USA 91 11118 11122 1994 PNASA6 US 0027-8424 0040 ? 7972020 10.1073/pnas.91.23.11118 1 'X-Ray Structures of Recombinant Yeast Cytochrome C Peroxidase and Three Heme Cleft Mutants Prepared by Site-Directed Mutagenesis' Biochemistry 29 7160 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 2 ;Yeast Cytochrome C Peroxidase: Mutagenesis and Expression in Escherichia Coli Show Tryptophan-51 is not the Radical Site in Compound I ; Biochemistry 26 351 ? 1987 BICHAW US 0006-2960 0033 ? ? ? 3 'Crystal Structure of Yeast Cytochrome C Peroxidase Refined at 1.7 Angstroms Resolution' J.Biol.Chem. 259 13027 ? 1984 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Miller, M.A.' 1 ? primary 'Han, G.W.' 2 ? primary 'Kraut, J.' 3 ? 1 'Wang, J.' 4 ? 1 'Mauro, J.M.' 5 ? 1 'Edwards, S.L.' 6 ? 1 'Oatley, S.J.' 7 ? 1 'Fishel, L.A.' 8 ? 1 'Ashford, V.A.' 9 ? 1 'Xuong, N.-H.' 10 ? 1 'Kraut, J.' 11 ? 2 'Fishel, L.A.' 12 ? 2 'Villafranca, J.E.' 13 ? 2 'Mauro, J.M.' 14 ? 2 'Kraut, J.' 15 ? 3 'Finzel, B.C.' 16 ? 3 'Poulos, T.L.' 17 ? 3 'Kraut, J.' 18 ? # _cell.entry_id 1CPG _cell.length_a 105.170 _cell.length_b 74.180 _cell.length_c 45.220 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CPG _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME C PEROXIDASE' 33769.629 1 1.11.1.5 ? ? ? 2 non-polymer syn 'POTASSIUM ION' 39.098 1 ? ? ? ? 3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 4 water nat water 18.015 192 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIVEKLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFN DPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFF QRLNMNDREVVALMGAHALGKTHLKNSGYEGPQGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSL IQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL ; _entity_poly.pdbx_seq_one_letter_code_can ;MIVEKLVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFN DPSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGYVRTFF QRLNMNDREVVALMGAHALGKTHLKNSGYEGPQGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSL IQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 LYS n 1 6 LEU n 1 7 VAL n 1 8 HIS n 1 9 VAL n 1 10 ALA n 1 11 SER n 1 12 VAL n 1 13 GLU n 1 14 LYS n 1 15 GLY n 1 16 ARG n 1 17 SER n 1 18 TYR n 1 19 GLU n 1 20 ASP n 1 21 PHE n 1 22 GLN n 1 23 LYS n 1 24 VAL n 1 25 TYR n 1 26 ASN n 1 27 ALA n 1 28 ILE n 1 29 ALA n 1 30 LEU n 1 31 LYS n 1 32 LEU n 1 33 ARG n 1 34 GLU n 1 35 ASP n 1 36 ASP n 1 37 GLU n 1 38 TYR n 1 39 ASP n 1 40 ASN n 1 41 TYR n 1 42 ILE n 1 43 GLY n 1 44 TYR n 1 45 GLY n 1 46 PRO n 1 47 VAL n 1 48 LEU n 1 49 VAL n 1 50 ARG n 1 51 LEU n 1 52 ALA n 1 53 TRP n 1 54 HIS n 1 55 ILE n 1 56 SER n 1 57 GLY n 1 58 THR n 1 59 TRP n 1 60 ASP n 1 61 LYS n 1 62 HIS n 1 63 ASP n 1 64 ASN n 1 65 THR n 1 66 GLY n 1 67 GLY n 1 68 SER n 1 69 TYR n 1 70 GLY n 1 71 GLY n 1 72 THR n 1 73 TYR n 1 74 ARG n 1 75 PHE n 1 76 LYS n 1 77 LYS n 1 78 GLU n 1 79 PHE n 1 80 ASN n 1 81 ASP n 1 82 PRO n 1 83 SER n 1 84 ASN n 1 85 ALA n 1 86 GLY n 1 87 LEU n 1 88 GLN n 1 89 ASN n 1 90 GLY n 1 91 PHE n 1 92 LYS n 1 93 PHE n 1 94 LEU n 1 95 GLU n 1 96 PRO n 1 97 ILE n 1 98 HIS n 1 99 LYS n 1 100 GLU n 1 101 PHE n 1 102 PRO n 1 103 TRP n 1 104 ILE n 1 105 SER n 1 106 SER n 1 107 GLY n 1 108 ASP n 1 109 LEU n 1 110 PHE n 1 111 SER n 1 112 LEU n 1 113 GLY n 1 114 GLY n 1 115 VAL n 1 116 THR n 1 117 ALA n 1 118 VAL n 1 119 GLN n 1 120 GLU n 1 121 MET n 1 122 GLN n 1 123 GLY n 1 124 PRO n 1 125 LYS n 1 126 ILE n 1 127 PRO n 1 128 TRP n 1 129 ARG n 1 130 CYS n 1 131 GLY n 1 132 ARG n 1 133 VAL n 1 134 ASP n 1 135 THR n 1 136 PRO n 1 137 GLU n 1 138 ASP n 1 139 THR n 1 140 THR n 1 141 PRO n 1 142 ASP n 1 143 ASN n 1 144 GLY n 1 145 ARG n 1 146 LEU n 1 147 PRO n 1 148 ASP n 1 149 ALA n 1 150 ASP n 1 151 LYS n 1 152 ASP n 1 153 ALA n 1 154 GLY n 1 155 TYR n 1 156 VAL n 1 157 ARG n 1 158 THR n 1 159 PHE n 1 160 PHE n 1 161 GLN n 1 162 ARG n 1 163 LEU n 1 164 ASN n 1 165 MET n 1 166 ASN n 1 167 ASP n 1 168 ARG n 1 169 GLU n 1 170 VAL n 1 171 VAL n 1 172 ALA n 1 173 LEU n 1 174 MET n 1 175 GLY n 1 176 ALA n 1 177 HIS n 1 178 ALA n 1 179 LEU n 1 180 GLY n 1 181 LYS n 1 182 THR n 1 183 HIS n 1 184 LEU n 1 185 LYS n 1 186 ASN n 1 187 SER n 1 188 GLY n 1 189 TYR n 1 190 GLU n 1 191 GLY n 1 192 PRO n 1 193 GLN n 1 194 GLY n 1 195 ALA n 1 196 ALA n 1 197 ASN n 1 198 ASN n 1 199 VAL n 1 200 PHE n 1 201 THR n 1 202 ASN n 1 203 GLU n 1 204 PHE n 1 205 TYR n 1 206 LEU n 1 207 ASN n 1 208 LEU n 1 209 LEU n 1 210 ASN n 1 211 GLU n 1 212 ASP n 1 213 TRP n 1 214 LYS n 1 215 LEU n 1 216 GLU n 1 217 LYS n 1 218 ASN n 1 219 ASP n 1 220 ALA n 1 221 ASN n 1 222 ASN n 1 223 GLU n 1 224 GLN n 1 225 TRP n 1 226 ASP n 1 227 SER n 1 228 LYS n 1 229 SER n 1 230 GLY n 1 231 TYR n 1 232 MET n 1 233 MET n 1 234 LEU n 1 235 PRO n 1 236 THR n 1 237 ASP n 1 238 TYR n 1 239 SER n 1 240 LEU n 1 241 ILE n 1 242 GLN n 1 243 ASP n 1 244 PRO n 1 245 LYS n 1 246 TYR n 1 247 LEU n 1 248 SER n 1 249 ILE n 1 250 VAL n 1 251 LYS n 1 252 GLU n 1 253 TYR n 1 254 ALA n 1 255 ASN n 1 256 ASP n 1 257 GLN n 1 258 ASP n 1 259 LYS n 1 260 PHE n 1 261 PHE n 1 262 LYS n 1 263 ASP n 1 264 PHE n 1 265 SER n 1 266 LYS n 1 267 ALA n 1 268 PHE n 1 269 GLU n 1 270 LYS n 1 271 LEU n 1 272 LEU n 1 273 GLU n 1 274 ASN n 1 275 GLY n 1 276 ILE n 1 277 THR n 1 278 PHE n 1 279 PRO n 1 280 LYS n 1 281 ASP n 1 282 ALA n 1 283 PRO n 1 284 SER n 1 285 PRO n 1 286 PHE n 1 287 ILE n 1 288 PHE n 1 289 LYS n 1 290 THR n 1 291 LEU n 1 292 GLU n 1 293 GLU n 1 294 GLN n 1 295 GLY n 1 296 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCPR_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00431 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MTTAVRLLPSLGRTAHKRSLYLFSAAAAAAAAATFAYSQSQKRSSSSPGGGSNHGWNNWGKAAALASTTPLVHVASVEKG RSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLE PIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMG AHALGKTHLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEYAN DQDKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CPG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 296 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00431 _struct_ref_seq.db_align_beg 71 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 361 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 294 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1CPG ILE A 55 ? UNP P00431 THR 120 CONFLICT 53 1 1 1CPG GLY A 154 ? UNP P00431 ASP 219 CONFLICT 152 2 1 1CPG GLN A 193 ? UNP P00431 TRP 258 CONFLICT 191 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1CPG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.61 _exptl_crystal.density_percent_sol 52.88 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1CPG _refine.ls_number_reflns_obs 17021 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.2 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1640000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1640000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ;COORDINATES FOR RESIDUES -1, 0, AND 1 - 3 ARE NOT INCLUDED IN THIS ENTRY BECAUSE THESE RESIDUES COULD NOT BE RESOLVED IN THE FINAL ELECTRON DENSITY MAPS. WATER MOLECULES WITH B-FACTORS GREATER THAN 80 WERE NOT INCLUDED IN THE MODEL. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2345 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 44 _refine_hist.number_atoms_solvent 192 _refine_hist.number_atoms_total 2581 _refine_hist.d_res_high 2.2 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.7 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1CPG _struct.title 'A CATION BINDING MOTIF STABILIZES THE COMPOUND I RADICAL OF CYTOCHROME C PEROXIDASE' _struct.pdbx_descriptor 'CYTOCHROME C PEROXIDASE (E.C.1.11.1.5) MUTANT WITH MET ILE ADDED AT N-TERMINUS AND TRP 191 REPLACED BY GLN (MI,W191Q)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CPG _struct_keywords.pdbx_keywords 'OXIDOREDUCTASE(H2O2(A))' _struct_keywords.text 'OXIDOREDUCTASE(H2O2(A))' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A SER A 17 ? ASP A 35 ? SER A 15 ASP A 33 1 ? 19 HELX_P HELX_P2 B TYR A 44 ? SER A 56 ? TYR A 42 SER A 54 1 ? 13 HELX_P HELX_P3 B1 PHE A 75 ? ASN A 80 ? PHE A 73 ASN A 78 1 ? 6 HELX_P HELX_P4 C GLY A 86 ? PHE A 101 ? GLY A 84 PHE A 99 1 'BENT AT PRO 94' 16 HELX_P HELX_P5 D SER A 105 ? MET A 121 ? SER A 103 MET A 119 1 ? 17 HELX_P HELX_P6 E ASP A 152 ? PHE A 160 ? ASP A 150 PHE A 158 1 ? 9 HELX_P HELX_P7 F ASN A 166 ? LEU A 179 ? ASN A 164 LEU A 177 1 ? 14 HELX_P HELX_P8 F1 HIS A 183 ? GLY A 188 ? HIS A 181 GLY A 186 1 ? 6 HELX_P HELX_P9 G GLU A 203 ? GLU A 211 ? GLU A 201 GLU A 209 1 ? 9 HELX_P HELX_P10 H LEU A 234 ? GLN A 242 ? LEU A 232 GLN A 240 1 ? 9 HELX_P HELX_P11 I ASP A 243 ? ASN A 255 ? ASP A 241 ASN A 253 1 ? 13 HELX_P HELX_P12 J GLN A 257 ? ASN A 274 ? GLN A 255 ASN A 272 1 ? 18 HELX_P HELX_P13 J1 THR A 290 ? GLY A 295 ? THR A 288 GLY A 293 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 177 NE2 ? ? ? 1_555 C HEM . FE ? ? A HIS 175 A HEM 296 1_555 ? ? ? ? ? ? ? 2.036 ? metalc2 metalc ? ? C HEM . FE ? ? ? 1_555 D HOH . O ? ? A HEM 296 A HOH 595 1_555 ? ? ? ? ? ? ? 1.903 ? metalc3 metalc ? ? B K . K ? ? ? 1_555 A LEU 179 O ? ? A K 975 A LEU 177 1_555 ? ? ? ? ? ? ? 2.512 ? metalc4 metalc ? ? B K . K ? ? ? 1_555 A LYS 181 N ? ? A K 975 A LYS 179 1_555 ? ? ? ? ? ? ? 3.686 ? metalc5 metalc ? ? B K . K ? ? ? 1_555 D HOH . O ? ? A K 975 A HOH 979 1_555 ? ? ? ? ? ? ? 2.607 ? metalc6 metalc ? ? B K . K ? ? ? 1_555 A HIS 177 O ? ? A K 975 A HIS 175 1_555 ? ? ? ? ? ? ? 2.559 ? metalc7 metalc ? ? B K . K ? ? ? 1_555 A GLN 193 OE1 ? ? A K 975 A GLN 191 1_555 ? ? ? ? ? ? ? 2.457 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 181 ? THR A 182 ? LYS A 179 THR A 180 A 2 GLY A 191 ? PRO A 192 ? GLY A 189 PRO A 190 B 1 TRP A 213 ? LYS A 217 ? TRP A 211 LYS A 215 B 2 GLU A 223 ? SER A 227 ? GLU A 221 SER A 225 B 3 MET A 232 ? MET A 233 ? MET A 230 MET A 231 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 182 ? N THR A 180 O GLY A 191 ? O GLY A 189 B 1 2 N GLU A 216 ? N GLU A 214 O GLN A 224 ? O GLN A 222 B 2 3 O TRP A 225 ? O TRP A 223 N MET A 233 ? N MET A 231 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE K A 975' AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE HEM A 296' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HIS A 177 ? HIS A 175 . ? 1_555 ? 2 AC1 6 LEU A 179 ? LEU A 177 . ? 1_555 ? 3 AC1 6 GLY A 180 ? GLY A 178 . ? 1_555 ? 4 AC1 6 LYS A 181 ? LYS A 179 . ? 1_555 ? 5 AC1 6 GLN A 193 ? GLN A 191 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 979 . ? 1_555 ? 7 AC2 18 ARG A 50 ? ARG A 48 . ? 1_555 ? 8 AC2 18 TRP A 53 ? TRP A 51 . ? 1_555 ? 9 AC2 18 ASP A 148 ? ASP A 146 . ? 1_555 ? 10 AC2 18 LEU A 173 ? LEU A 171 . ? 1_555 ? 11 AC2 18 MET A 174 ? MET A 172 . ? 1_555 ? 12 AC2 18 ALA A 176 ? ALA A 174 . ? 1_555 ? 13 AC2 18 HIS A 177 ? HIS A 175 . ? 1_555 ? 14 AC2 18 LEU A 179 ? LEU A 177 . ? 1_555 ? 15 AC2 18 GLY A 180 ? GLY A 178 . ? 1_555 ? 16 AC2 18 LYS A 181 ? LYS A 179 . ? 1_555 ? 17 AC2 18 HIS A 183 ? HIS A 181 . ? 1_555 ? 18 AC2 18 ASN A 186 ? ASN A 184 . ? 1_555 ? 19 AC2 18 SER A 187 ? SER A 185 . ? 1_555 ? 20 AC2 18 HOH D . ? HOH A 348 . ? 1_555 ? 21 AC2 18 HOH D . ? HOH A 595 . ? 1_555 ? 22 AC2 18 HOH D . ? HOH A 895 . ? 1_555 ? 23 AC2 18 HOH D . ? HOH A 896 . ? 1_555 ? 24 AC2 18 HOH D . ? HOH A 979 . ? 1_555 ? # _database_PDB_matrix.entry_id 1CPG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CPG _atom_sites.fract_transf_matrix[1][1] 0.009508 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013481 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022114 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE K N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -1 ? ? ? A . n A 1 2 ILE 2 0 ? ? ? A . n A 1 3 VAL 3 1 ? ? ? A . n A 1 4 GLU 4 2 ? ? ? A . n A 1 5 LYS 5 3 ? ? ? A . n A 1 6 LEU 6 4 4 LEU LEU A . n A 1 7 VAL 7 5 5 VAL VAL A . n A 1 8 HIS 8 6 6 HIS HIS A . n A 1 9 VAL 9 7 7 VAL VAL A . n A 1 10 ALA 10 8 8 ALA ALA A . n A 1 11 SER 11 9 9 SER SER A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 GLU 13 11 11 GLU GLU A . n A 1 14 LYS 14 12 12 LYS LYS A . n A 1 15 GLY 15 13 13 GLY GLY A . n A 1 16 ARG 16 14 14 ARG ARG A . n A 1 17 SER 17 15 15 SER SER A . n A 1 18 TYR 18 16 16 TYR TYR A . n A 1 19 GLU 19 17 17 GLU GLU A . n A 1 20 ASP 20 18 18 ASP ASP A . n A 1 21 PHE 21 19 19 PHE PHE A . n A 1 22 GLN 22 20 20 GLN GLN A . n A 1 23 LYS 23 21 21 LYS LYS A . n A 1 24 VAL 24 22 22 VAL VAL A . n A 1 25 TYR 25 23 23 TYR TYR A . n A 1 26 ASN 26 24 24 ASN ASN A . n A 1 27 ALA 27 25 25 ALA ALA A . n A 1 28 ILE 28 26 26 ILE ILE A . n A 1 29 ALA 29 27 27 ALA ALA A . n A 1 30 LEU 30 28 28 LEU LEU A . n A 1 31 LYS 31 29 29 LYS LYS A . n A 1 32 LEU 32 30 30 LEU LEU A . n A 1 33 ARG 33 31 31 ARG ARG A . n A 1 34 GLU 34 32 32 GLU GLU A . n A 1 35 ASP 35 33 33 ASP ASP A . n A 1 36 ASP 36 34 34 ASP ASP A . n A 1 37 GLU 37 35 35 GLU GLU A . n A 1 38 TYR 38 36 36 TYR TYR A . n A 1 39 ASP 39 37 37 ASP ASP A . n A 1 40 ASN 40 38 38 ASN ASN A . n A 1 41 TYR 41 39 39 TYR TYR A . n A 1 42 ILE 42 40 40 ILE ILE A . n A 1 43 GLY 43 41 41 GLY GLY A . n A 1 44 TYR 44 42 42 TYR TYR A . n A 1 45 GLY 45 43 43 GLY GLY A . n A 1 46 PRO 46 44 44 PRO PRO A . n A 1 47 VAL 47 45 45 VAL VAL A . n A 1 48 LEU 48 46 46 LEU LEU A . n A 1 49 VAL 49 47 47 VAL VAL A . n A 1 50 ARG 50 48 48 ARG ARG A . n A 1 51 LEU 51 49 49 LEU LEU A . n A 1 52 ALA 52 50 50 ALA ALA A . n A 1 53 TRP 53 51 51 TRP TRP A . n A 1 54 HIS 54 52 52 HIS HIS A . n A 1 55 ILE 55 53 53 ILE ILE A . n A 1 56 SER 56 54 54 SER SER A . n A 1 57 GLY 57 55 55 GLY GLY A . n A 1 58 THR 58 56 56 THR THR A . n A 1 59 TRP 59 57 57 TRP TRP A . n A 1 60 ASP 60 58 58 ASP ASP A . n A 1 61 LYS 61 59 59 LYS LYS A . n A 1 62 HIS 62 60 60 HIS HIS A . n A 1 63 ASP 63 61 61 ASP ASP A . n A 1 64 ASN 64 62 62 ASN ASN A . n A 1 65 THR 65 63 63 THR THR A . n A 1 66 GLY 66 64 64 GLY GLY A . n A 1 67 GLY 67 65 65 GLY GLY A . n A 1 68 SER 68 66 66 SER SER A . n A 1 69 TYR 69 67 67 TYR TYR A . n A 1 70 GLY 70 68 68 GLY GLY A . n A 1 71 GLY 71 69 69 GLY GLY A . n A 1 72 THR 72 70 70 THR THR A . n A 1 73 TYR 73 71 71 TYR TYR A . n A 1 74 ARG 74 72 72 ARG ARG A . n A 1 75 PHE 75 73 73 PHE PHE A . n A 1 76 LYS 76 74 74 LYS LYS A . n A 1 77 LYS 77 75 75 LYS LYS A . n A 1 78 GLU 78 76 76 GLU GLU A . n A 1 79 PHE 79 77 77 PHE PHE A . n A 1 80 ASN 80 78 78 ASN ASN A . n A 1 81 ASP 81 79 79 ASP ASP A . n A 1 82 PRO 82 80 80 PRO PRO A . n A 1 83 SER 83 81 81 SER SER A . n A 1 84 ASN 84 82 82 ASN ASN A . n A 1 85 ALA 85 83 83 ALA ALA A . n A 1 86 GLY 86 84 84 GLY GLY A . n A 1 87 LEU 87 85 85 LEU LEU A . n A 1 88 GLN 88 86 86 GLN GLN A . n A 1 89 ASN 89 87 87 ASN ASN A . n A 1 90 GLY 90 88 88 GLY GLY A . n A 1 91 PHE 91 89 89 PHE PHE A . n A 1 92 LYS 92 90 90 LYS LYS A . n A 1 93 PHE 93 91 91 PHE PHE A . n A 1 94 LEU 94 92 92 LEU LEU A . n A 1 95 GLU 95 93 93 GLU GLU A . n A 1 96 PRO 96 94 94 PRO PRO A . n A 1 97 ILE 97 95 95 ILE ILE A . n A 1 98 HIS 98 96 96 HIS HIS A . n A 1 99 LYS 99 97 97 LYS LYS A . n A 1 100 GLU 100 98 98 GLU GLU A . n A 1 101 PHE 101 99 99 PHE PHE A . n A 1 102 PRO 102 100 100 PRO PRO A . n A 1 103 TRP 103 101 101 TRP TRP A . n A 1 104 ILE 104 102 102 ILE ILE A . n A 1 105 SER 105 103 103 SER SER A . n A 1 106 SER 106 104 104 SER SER A . n A 1 107 GLY 107 105 105 GLY GLY A . n A 1 108 ASP 108 106 106 ASP ASP A . n A 1 109 LEU 109 107 107 LEU LEU A . n A 1 110 PHE 110 108 108 PHE PHE A . n A 1 111 SER 111 109 109 SER SER A . n A 1 112 LEU 112 110 110 LEU LEU A . n A 1 113 GLY 113 111 111 GLY GLY A . n A 1 114 GLY 114 112 112 GLY GLY A . n A 1 115 VAL 115 113 113 VAL VAL A . n A 1 116 THR 116 114 114 THR THR A . n A 1 117 ALA 117 115 115 ALA ALA A . n A 1 118 VAL 118 116 116 VAL VAL A . n A 1 119 GLN 119 117 117 GLN GLN A . n A 1 120 GLU 120 118 118 GLU GLU A . n A 1 121 MET 121 119 119 MET MET A . n A 1 122 GLN 122 120 120 GLN GLN A . n A 1 123 GLY 123 121 121 GLY GLY A . n A 1 124 PRO 124 122 122 PRO PRO A . n A 1 125 LYS 125 123 123 LYS LYS A . n A 1 126 ILE 126 124 124 ILE ILE A . n A 1 127 PRO 127 125 125 PRO PRO A . n A 1 128 TRP 128 126 126 TRP TRP A . n A 1 129 ARG 129 127 127 ARG ARG A . n A 1 130 CYS 130 128 128 CYS CYS A . n A 1 131 GLY 131 129 129 GLY GLY A . n A 1 132 ARG 132 130 130 ARG ARG A . n A 1 133 VAL 133 131 131 VAL VAL A . n A 1 134 ASP 134 132 132 ASP ASP A . n A 1 135 THR 135 133 133 THR THR A . n A 1 136 PRO 136 134 134 PRO PRO A . n A 1 137 GLU 137 135 135 GLU GLU A . n A 1 138 ASP 138 136 136 ASP ASP A . n A 1 139 THR 139 137 137 THR THR A . n A 1 140 THR 140 138 138 THR THR A . n A 1 141 PRO 141 139 139 PRO PRO A . n A 1 142 ASP 142 140 140 ASP ASP A . n A 1 143 ASN 143 141 141 ASN ASN A . n A 1 144 GLY 144 142 142 GLY GLY A . n A 1 145 ARG 145 143 143 ARG ARG A . n A 1 146 LEU 146 144 144 LEU LEU A . n A 1 147 PRO 147 145 145 PRO PRO A . n A 1 148 ASP 148 146 146 ASP ASP A . n A 1 149 ALA 149 147 147 ALA ALA A . n A 1 150 ASP 150 148 148 ASP ASP A . n A 1 151 LYS 151 149 149 LYS LYS A . n A 1 152 ASP 152 150 150 ASP ASP A . n A 1 153 ALA 153 151 151 ALA ALA A . n A 1 154 GLY 154 152 152 GLY GLY A . n A 1 155 TYR 155 153 153 TYR TYR A . n A 1 156 VAL 156 154 154 VAL VAL A . n A 1 157 ARG 157 155 155 ARG ARG A . n A 1 158 THR 158 156 156 THR THR A . n A 1 159 PHE 159 157 157 PHE PHE A . n A 1 160 PHE 160 158 158 PHE PHE A . n A 1 161 GLN 161 159 159 GLN GLN A . n A 1 162 ARG 162 160 160 ARG ARG A . n A 1 163 LEU 163 161 161 LEU LEU A . n A 1 164 ASN 164 162 162 ASN ASN A . n A 1 165 MET 165 163 163 MET MET A . n A 1 166 ASN 166 164 164 ASN ASN A . n A 1 167 ASP 167 165 165 ASP ASP A . n A 1 168 ARG 168 166 166 ARG ARG A . n A 1 169 GLU 169 167 167 GLU GLU A . n A 1 170 VAL 170 168 168 VAL VAL A . n A 1 171 VAL 171 169 169 VAL VAL A . n A 1 172 ALA 172 170 170 ALA ALA A . n A 1 173 LEU 173 171 171 LEU LEU A . n A 1 174 MET 174 172 172 MET MET A . n A 1 175 GLY 175 173 173 GLY GLY A . n A 1 176 ALA 176 174 174 ALA ALA A . n A 1 177 HIS 177 175 175 HIS HIS A . n A 1 178 ALA 178 176 176 ALA ALA A . n A 1 179 LEU 179 177 177 LEU LEU A . n A 1 180 GLY 180 178 178 GLY GLY A . n A 1 181 LYS 181 179 179 LYS LYS A . n A 1 182 THR 182 180 180 THR THR A . n A 1 183 HIS 183 181 181 HIS HIS A . n A 1 184 LEU 184 182 182 LEU LEU A . n A 1 185 LYS 185 183 183 LYS LYS A . n A 1 186 ASN 186 184 184 ASN ASN A . n A 1 187 SER 187 185 185 SER SER A . n A 1 188 GLY 188 186 186 GLY GLY A . n A 1 189 TYR 189 187 187 TYR TYR A . n A 1 190 GLU 190 188 188 GLU GLU A . n A 1 191 GLY 191 189 189 GLY GLY A . n A 1 192 PRO 192 190 190 PRO PRO A . n A 1 193 GLN 193 191 191 GLN GLN A . n A 1 194 GLY 194 192 192 GLY GLY A . n A 1 195 ALA 195 193 193 ALA ALA A . n A 1 196 ALA 196 194 194 ALA ALA A . n A 1 197 ASN 197 195 195 ASN ASN A . n A 1 198 ASN 198 196 196 ASN ASN A . n A 1 199 VAL 199 197 197 VAL VAL A . n A 1 200 PHE 200 198 198 PHE PHE A . n A 1 201 THR 201 199 199 THR THR A . n A 1 202 ASN 202 200 200 ASN ASN A . n A 1 203 GLU 203 201 201 GLU GLU A . n A 1 204 PHE 204 202 202 PHE PHE A . n A 1 205 TYR 205 203 203 TYR TYR A . n A 1 206 LEU 206 204 204 LEU LEU A . n A 1 207 ASN 207 205 205 ASN ASN A . n A 1 208 LEU 208 206 206 LEU LEU A . n A 1 209 LEU 209 207 207 LEU LEU A . n A 1 210 ASN 210 208 208 ASN ASN A . n A 1 211 GLU 211 209 209 GLU GLU A . n A 1 212 ASP 212 210 210 ASP ASP A . n A 1 213 TRP 213 211 211 TRP TRP A . n A 1 214 LYS 214 212 212 LYS LYS A . n A 1 215 LEU 215 213 213 LEU LEU A . n A 1 216 GLU 216 214 214 GLU GLU A . n A 1 217 LYS 217 215 215 LYS LYS A . n A 1 218 ASN 218 216 216 ASN ASN A . n A 1 219 ASP 219 217 217 ASP ASP A . n A 1 220 ALA 220 218 218 ALA ALA A . n A 1 221 ASN 221 219 219 ASN ASN A . n A 1 222 ASN 222 220 220 ASN ASN A . n A 1 223 GLU 223 221 221 GLU GLU A . n A 1 224 GLN 224 222 222 GLN GLN A . n A 1 225 TRP 225 223 223 TRP TRP A . n A 1 226 ASP 226 224 224 ASP ASP A . n A 1 227 SER 227 225 225 SER SER A . n A 1 228 LYS 228 226 226 LYS LYS A . n A 1 229 SER 229 227 227 SER SER A . n A 1 230 GLY 230 228 228 GLY GLY A . n A 1 231 TYR 231 229 229 TYR TYR A . n A 1 232 MET 232 230 230 MET MET A . n A 1 233 MET 233 231 231 MET MET A . n A 1 234 LEU 234 232 232 LEU LEU A . n A 1 235 PRO 235 233 233 PRO PRO A . n A 1 236 THR 236 234 234 THR THR A . n A 1 237 ASP 237 235 235 ASP ASP A . n A 1 238 TYR 238 236 236 TYR TYR A . n A 1 239 SER 239 237 237 SER SER A . n A 1 240 LEU 240 238 238 LEU LEU A . n A 1 241 ILE 241 239 239 ILE ILE A . n A 1 242 GLN 242 240 240 GLN GLN A . n A 1 243 ASP 243 241 241 ASP ASP A . n A 1 244 PRO 244 242 242 PRO PRO A . n A 1 245 LYS 245 243 243 LYS LYS A . n A 1 246 TYR 246 244 244 TYR TYR A . n A 1 247 LEU 247 245 245 LEU LEU A . n A 1 248 SER 248 246 246 SER SER A . n A 1 249 ILE 249 247 247 ILE ILE A . n A 1 250 VAL 250 248 248 VAL VAL A . n A 1 251 LYS 251 249 249 LYS LYS A . n A 1 252 GLU 252 250 250 GLU GLU A . n A 1 253 TYR 253 251 251 TYR TYR A . n A 1 254 ALA 254 252 252 ALA ALA A . n A 1 255 ASN 255 253 253 ASN ASN A . n A 1 256 ASP 256 254 254 ASP ASP A . n A 1 257 GLN 257 255 255 GLN GLN A . n A 1 258 ASP 258 256 256 ASP ASP A . n A 1 259 LYS 259 257 257 LYS LYS A . n A 1 260 PHE 260 258 258 PHE PHE A . n A 1 261 PHE 261 259 259 PHE PHE A . n A 1 262 LYS 262 260 260 LYS LYS A . n A 1 263 ASP 263 261 261 ASP ASP A . n A 1 264 PHE 264 262 262 PHE PHE A . n A 1 265 SER 265 263 263 SER SER A . n A 1 266 LYS 266 264 264 LYS LYS A . n A 1 267 ALA 267 265 265 ALA ALA A . n A 1 268 PHE 268 266 266 PHE PHE A . n A 1 269 GLU 269 267 267 GLU GLU A . n A 1 270 LYS 270 268 268 LYS LYS A . n A 1 271 LEU 271 269 269 LEU LEU A . n A 1 272 LEU 272 270 270 LEU LEU A . n A 1 273 GLU 273 271 271 GLU GLU A . n A 1 274 ASN 274 272 272 ASN ASN A . n A 1 275 GLY 275 273 273 GLY GLY A . n A 1 276 ILE 276 274 274 ILE ILE A . n A 1 277 THR 277 275 275 THR THR A . n A 1 278 PHE 278 276 276 PHE PHE A . n A 1 279 PRO 279 277 277 PRO PRO A . n A 1 280 LYS 280 278 278 LYS LYS A . n A 1 281 ASP 281 279 279 ASP ASP A . n A 1 282 ALA 282 280 280 ALA ALA A . n A 1 283 PRO 283 281 281 PRO PRO A . n A 1 284 SER 284 282 282 SER SER A . n A 1 285 PRO 285 283 283 PRO PRO A . n A 1 286 PHE 286 284 284 PHE PHE A . n A 1 287 ILE 287 285 285 ILE ILE A . n A 1 288 PHE 288 286 286 PHE PHE A . n A 1 289 LYS 289 287 287 LYS LYS A . n A 1 290 THR 290 288 288 THR THR A . n A 1 291 LEU 291 289 289 LEU LEU A . n A 1 292 GLU 292 290 290 GLU GLU A . n A 1 293 GLU 293 291 291 GLU GLU A . n A 1 294 GLN 294 292 292 GLN GLN A . n A 1 295 GLY 295 293 293 GLY GLY A . n A 1 296 LEU 296 294 294 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 K 1 975 975 K K A . C 3 HEM 1 296 296 HEM HEM A . D 4 HOH 1 307 307 HOH HOH A . D 4 HOH 2 309 309 HOH HOH A . D 4 HOH 3 312 312 HOH HOH A . D 4 HOH 4 313 313 HOH HOH A . D 4 HOH 5 318 318 HOH HOH A . D 4 HOH 6 321 321 HOH HOH A . D 4 HOH 7 324 324 HOH HOH A . D 4 HOH 8 327 327 HOH HOH A . D 4 HOH 9 329 329 HOH HOH A . D 4 HOH 10 333 333 HOH HOH A . D 4 HOH 11 335 335 HOH HOH A . D 4 HOH 12 336 336 HOH HOH A . D 4 HOH 13 342 342 HOH HOH A . D 4 HOH 14 345 345 HOH HOH A . D 4 HOH 15 348 348 HOH HOH A . D 4 HOH 16 353 353 HOH HOH A . D 4 HOH 17 355 355 HOH HOH A . D 4 HOH 18 364 364 HOH HOH A . D 4 HOH 19 365 365 HOH HOH A . D 4 HOH 20 366 366 HOH HOH A . D 4 HOH 21 370 370 HOH HOH A . D 4 HOH 22 376 376 HOH HOH A . D 4 HOH 23 379 379 HOH HOH A . D 4 HOH 24 382 382 HOH HOH A . D 4 HOH 25 384 384 HOH HOH A . D 4 HOH 26 391 391 HOH HOH A . D 4 HOH 27 400 400 HOH HOH A . D 4 HOH 28 401 401 HOH HOH A . D 4 HOH 29 402 402 HOH HOH A . D 4 HOH 30 408 408 HOH HOH A . D 4 HOH 31 417 417 HOH HOH A . D 4 HOH 32 418 418 HOH HOH A . D 4 HOH 33 421 421 HOH HOH A . D 4 HOH 34 425 425 HOH HOH A . D 4 HOH 35 427 427 HOH HOH A . D 4 HOH 36 428 428 HOH HOH A . D 4 HOH 37 430 430 HOH HOH A . D 4 HOH 38 432 432 HOH HOH A . D 4 HOH 39 433 433 HOH HOH A . D 4 HOH 40 435 435 HOH HOH A . D 4 HOH 41 440 440 HOH HOH A . D 4 HOH 42 441 441 HOH HOH A . D 4 HOH 43 443 443 HOH HOH A . D 4 HOH 44 444 444 HOH HOH A . D 4 HOH 45 447 447 HOH HOH A . D 4 HOH 46 448 448 HOH HOH A . D 4 HOH 47 449 449 HOH HOH A . D 4 HOH 48 450 450 HOH HOH A . D 4 HOH 49 452 452 HOH HOH A . D 4 HOH 50 455 455 HOH HOH A . D 4 HOH 51 464 464 HOH HOH A . D 4 HOH 52 465 465 HOH HOH A . D 4 HOH 53 472 472 HOH HOH A . D 4 HOH 54 474 474 HOH HOH A . D 4 HOH 55 477 477 HOH HOH A . D 4 HOH 56 479 479 HOH HOH A . D 4 HOH 57 483 483 HOH HOH A . D 4 HOH 58 487 487 HOH HOH A . D 4 HOH 59 488 488 HOH HOH A . D 4 HOH 60 494 494 HOH HOH A . D 4 HOH 61 497 497 HOH HOH A . D 4 HOH 62 498 498 HOH HOH A . D 4 HOH 63 500 500 HOH HOH A . D 4 HOH 64 502 502 HOH HOH A . D 4 HOH 65 511 511 HOH HOH A . D 4 HOH 66 512 512 HOH HOH A . D 4 HOH 67 513 513 HOH HOH A . D 4 HOH 68 517 517 HOH HOH A . D 4 HOH 69 524 524 HOH HOH A . D 4 HOH 70 535 535 HOH HOH A . D 4 HOH 71 539 539 HOH HOH A . D 4 HOH 72 541 541 HOH HOH A . D 4 HOH 73 542 542 HOH HOH A . D 4 HOH 74 546 546 HOH HOH A . D 4 HOH 75 550 550 HOH HOH A . D 4 HOH 76 551 551 HOH HOH A . D 4 HOH 77 556 556 HOH HOH A . D 4 HOH 78 561 561 HOH HOH A . D 4 HOH 79 567 567 HOH HOH A . D 4 HOH 80 569 569 HOH HOH A . D 4 HOH 81 572 572 HOH HOH A . D 4 HOH 82 573 573 HOH HOH A . D 4 HOH 83 575 575 HOH HOH A . D 4 HOH 84 576 576 HOH HOH A . D 4 HOH 85 577 577 HOH HOH A . D 4 HOH 86 578 578 HOH HOH A . D 4 HOH 87 586 586 HOH HOH A . D 4 HOH 88 593 593 HOH HOH A . D 4 HOH 89 595 595 HOH HOH A . D 4 HOH 90 596 596 HOH HOH A . D 4 HOH 91 600 600 HOH HOH A . D 4 HOH 92 601 601 HOH HOH A . D 4 HOH 93 602 602 HOH HOH A . D 4 HOH 94 604 604 HOH HOH A . D 4 HOH 95 605 605 HOH HOH A . D 4 HOH 96 606 606 HOH HOH A . D 4 HOH 97 607 607 HOH HOH A . D 4 HOH 98 609 609 HOH HOH A . D 4 HOH 99 610 610 HOH HOH A . D 4 HOH 100 611 611 HOH HOH A . D 4 HOH 101 612 612 HOH HOH A . D 4 HOH 102 613 613 HOH HOH A . D 4 HOH 103 614 614 HOH HOH A . D 4 HOH 104 615 615 HOH HOH A . D 4 HOH 105 616 616 HOH HOH A . D 4 HOH 106 617 617 HOH HOH A . D 4 HOH 107 618 618 HOH HOH A . D 4 HOH 108 619 619 HOH HOH A . D 4 HOH 109 620 620 HOH HOH A . D 4 HOH 110 621 621 HOH HOH A . D 4 HOH 111 622 622 HOH HOH A . D 4 HOH 112 623 623 HOH HOH A . D 4 HOH 113 624 624 HOH HOH A . D 4 HOH 114 625 625 HOH HOH A . D 4 HOH 115 626 626 HOH HOH A . D 4 HOH 116 627 627 HOH HOH A . D 4 HOH 117 628 628 HOH HOH A . D 4 HOH 118 629 629 HOH HOH A . D 4 HOH 119 630 630 HOH HOH A . D 4 HOH 120 631 631 HOH HOH A . D 4 HOH 121 632 632 HOH HOH A . D 4 HOH 122 633 633 HOH HOH A . D 4 HOH 123 701 701 HOH HOH A . D 4 HOH 124 702 702 HOH HOH A . D 4 HOH 125 703 703 HOH HOH A . D 4 HOH 126 704 704 HOH HOH A . D 4 HOH 127 705 705 HOH HOH A . D 4 HOH 128 706 706 HOH HOH A . D 4 HOH 129 707 707 HOH HOH A . D 4 HOH 130 708 708 HOH HOH A . D 4 HOH 131 709 709 HOH HOH A . D 4 HOH 132 710 710 HOH HOH A . D 4 HOH 133 711 711 HOH HOH A . D 4 HOH 134 712 712 HOH HOH A . D 4 HOH 135 713 713 HOH HOH A . D 4 HOH 136 714 714 HOH HOH A . D 4 HOH 137 715 715 HOH HOH A . D 4 HOH 138 716 716 HOH HOH A . D 4 HOH 139 717 717 HOH HOH A . D 4 HOH 140 720 720 HOH HOH A . D 4 HOH 141 722 722 HOH HOH A . D 4 HOH 142 724 724 HOH HOH A . D 4 HOH 143 725 725 HOH HOH A . D 4 HOH 144 726 726 HOH HOH A . D 4 HOH 145 727 727 HOH HOH A . D 4 HOH 146 729 729 HOH HOH A . D 4 HOH 147 730 730 HOH HOH A . D 4 HOH 148 731 731 HOH HOH A . D 4 HOH 149 732 732 HOH HOH A . D 4 HOH 150 734 734 HOH HOH A . D 4 HOH 151 736 736 HOH HOH A . D 4 HOH 152 737 737 HOH HOH A . D 4 HOH 153 738 738 HOH HOH A . D 4 HOH 154 739 739 HOH HOH A . D 4 HOH 155 740 740 HOH HOH A . D 4 HOH 156 741 741 HOH HOH A . D 4 HOH 157 742 742 HOH HOH A . D 4 HOH 158 743 743 HOH HOH A . D 4 HOH 159 745 745 HOH HOH A . D 4 HOH 160 746 746 HOH HOH A . D 4 HOH 161 761 761 HOH HOH A . D 4 HOH 162 763 763 HOH HOH A . D 4 HOH 163 784 784 HOH HOH A . D 4 HOH 164 787 787 HOH HOH A . D 4 HOH 165 810 810 HOH HOH A . D 4 HOH 166 850 850 HOH HOH A . D 4 HOH 167 863 863 HOH HOH A . D 4 HOH 168 864 864 HOH HOH A . D 4 HOH 169 871 871 HOH HOH A . D 4 HOH 170 872 872 HOH HOH A . D 4 HOH 171 895 895 HOH HOH A . D 4 HOH 172 896 896 HOH HOH A . D 4 HOH 173 900 900 HOH HOH A . D 4 HOH 174 901 901 HOH HOH A . D 4 HOH 175 902 902 HOH HOH A . D 4 HOH 176 903 903 HOH HOH A . D 4 HOH 177 904 904 HOH HOH A . D 4 HOH 178 906 906 HOH HOH A . D 4 HOH 179 909 909 HOH HOH A . D 4 HOH 180 911 911 HOH HOH A . D 4 HOH 181 914 914 HOH HOH A . D 4 HOH 182 915 915 HOH HOH A . D 4 HOH 183 933 933 HOH HOH A . D 4 HOH 184 942 942 HOH HOH A . D 4 HOH 185 943 943 HOH HOH A . D 4 HOH 186 944 944 HOH HOH A . D 4 HOH 187 948 948 HOH HOH A . D 4 HOH 188 954 954 HOH HOH A . D 4 HOH 189 965 965 HOH HOH A . D 4 HOH 190 967 967 HOH HOH A . D 4 HOH 191 978 978 HOH HOH A . D 4 HOH 192 979 979 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 177 ? A HIS 175 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 NA ? C HEM . ? A HEM 296 ? 1_555 92.5 ? 2 NE2 ? A HIS 177 ? A HIS 175 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 NB ? C HEM . ? A HEM 296 ? 1_555 92.5 ? 3 NA ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 NB ? C HEM . ? A HEM 296 ? 1_555 90.4 ? 4 NE2 ? A HIS 177 ? A HIS 175 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 NC ? C HEM . ? A HEM 296 ? 1_555 84.1 ? 5 NA ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 NC ? C HEM . ? A HEM 296 ? 1_555 175.4 ? 6 NB ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 NC ? C HEM . ? A HEM 296 ? 1_555 86.6 ? 7 NE2 ? A HIS 177 ? A HIS 175 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 ND ? C HEM . ? A HEM 296 ? 1_555 93.2 ? 8 NA ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 ND ? C HEM . ? A HEM 296 ? 1_555 86.6 ? 9 NB ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 ND ? C HEM . ? A HEM 296 ? 1_555 173.7 ? 10 NC ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 ND ? C HEM . ? A HEM 296 ? 1_555 96.8 ? 11 NE2 ? A HIS 177 ? A HIS 175 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 O ? D HOH . ? A HOH 595 ? 1_555 172.8 ? 12 NA ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 O ? D HOH . ? A HOH 595 ? 1_555 82.2 ? 13 NB ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 O ? D HOH . ? A HOH 595 ? 1_555 82.8 ? 14 NC ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 O ? D HOH . ? A HOH 595 ? 1_555 100.9 ? 15 ND ? C HEM . ? A HEM 296 ? 1_555 FE ? C HEM . ? A HEM 296 ? 1_555 O ? D HOH . ? A HOH 595 ? 1_555 91.3 ? 16 O ? A LEU 179 ? A LEU 177 ? 1_555 K ? B K . ? A K 975 ? 1_555 N ? A LYS 181 ? A LYS 179 ? 1_555 67.3 ? 17 O ? A LEU 179 ? A LEU 177 ? 1_555 K ? B K . ? A K 975 ? 1_555 O ? D HOH . ? A HOH 979 ? 1_555 137.1 ? 18 N ? A LYS 181 ? A LYS 179 ? 1_555 K ? B K . ? A K 975 ? 1_555 O ? D HOH . ? A HOH 979 ? 1_555 110.7 ? 19 O ? A LEU 179 ? A LEU 177 ? 1_555 K ? B K . ? A K 975 ? 1_555 O ? A HIS 177 ? A HIS 175 ? 1_555 86.8 ? 20 N ? A LYS 181 ? A LYS 179 ? 1_555 K ? B K . ? A K 975 ? 1_555 O ? A HIS 177 ? A HIS 175 ? 1_555 136.7 ? 21 O ? D HOH . ? A HOH 979 ? 1_555 K ? B K . ? A K 975 ? 1_555 O ? A HIS 177 ? A HIS 175 ? 1_555 111.8 ? 22 O ? A LEU 179 ? A LEU 177 ? 1_555 K ? B K . ? A K 975 ? 1_555 OE1 ? A GLN 193 ? A GLN 191 ? 1_555 125.2 ? 23 N ? A LYS 181 ? A LYS 179 ? 1_555 K ? B K . ? A K 975 ? 1_555 OE1 ? A GLN 193 ? A GLN 191 ? 1_555 82.3 ? 24 O ? D HOH . ? A HOH 979 ? 1_555 K ? B K . ? A K 975 ? 1_555 OE1 ? A GLN 193 ? A GLN 191 ? 1_555 95.5 ? 25 O ? A HIS 177 ? A HIS 175 ? 1_555 K ? B K . ? A K 975 ? 1_555 OE1 ? A GLN 193 ? A GLN 191 ? 1_555 85.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-11-01 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 1 4 2019-07-17 6 'Structure model' 1 5 2019-08-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Refinement description' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type 4 5 'Structure model' software 5 6 'Structure model' software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_software.classification' 3 6 'Structure model' '_software.classification' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 TNT refinement . ? 2 X-PLOR refinement . ? 3 X-PLOR phasing . ? 4 # _pdbx_entry_details.entry_id 1CPG _pdbx_entry_details.compound_details ;THE TRP 191 TO GLN SUBSTITUTION CREATES A SMALL CAVITY WITHIN THE ENZYME. THIS STRUCTURE HAS A SINGLE POTASSIUM ION AND TWO WATER MOLECULES BOUND IN THE CAVITY. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THIS CYTOCHROME C PEROXIDASE DIFFERS FROM A PREVIOUSLY DEPOSITED STRUCTURE (PROTEIN DATA BANK ENTRY 2CYP) BY TWO STRAIN-RELATED SEQUENCE DIFFERENCES - THR 53 TO ILE AND ASP 152 TO GLY, AND THE ADDITION OF MET-ILE AT THE N-TERMINUS, HENCE CCP(MI). THE OVERALL STRUCTURE IS THE SAME AS THE PREVIOUSLY DEPOSITED ONE BUT IN A DIFFERENT SPACE GROUP. THE SEQUENCE DIFFERS FROM THAT REPORTED FOR 2CYP AT RESIDUE 272. IN THE PRESENT ENTRY, THIS RESIDUE IS REPORTED AS ASN. THIS CORRECTS AN ERROR INTRODUCED IN 2CYP, WHERE THE RESIDUE IS INCORRECTLY REPORTED TO BE ASP. RESIDUES ARE NUMBERED TO BE CONSISTENT WITH THE SEQUENCE OF THE NATIVE (2CYP) STRUCTURE. THUS THE FIRST TWO RESIDUES HAVE RESIDUE NUMBERS -1 AND 0, RESPECTIVELY. ; # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 214 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE1 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 214 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.319 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.067 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 18 ? ? CG A ASP 18 ? ? OD1 A ASP 18 ? ? 111.05 118.30 -7.25 0.90 N 2 1 CB A ASP 18 ? ? CG A ASP 18 ? ? OD2 A ASP 18 ? ? 125.06 118.30 6.76 0.90 N 3 1 CB A ASP 34 ? ? CG A ASP 34 ? ? OD1 A ASP 34 ? ? 126.89 118.30 8.59 0.90 N 4 1 CB A ASP 34 ? ? CG A ASP 34 ? ? OD2 A ASP 34 ? ? 110.70 118.30 -7.60 0.90 N 5 1 N A ASN 38 ? ? CA A ASN 38 ? ? CB A ASN 38 ? ? 123.10 110.60 12.50 1.80 N 6 1 CA A ASN 38 ? ? CB A ASN 38 ? ? CG A ASN 38 ? ? 99.52 113.40 -13.88 2.20 N 7 1 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 123.61 120.30 3.31 0.50 N 8 1 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH2 A ARG 48 ? ? 116.66 120.30 -3.64 0.50 N 9 1 CB A ASP 58 ? ? CG A ASP 58 ? ? OD1 A ASP 58 ? ? 124.34 118.30 6.04 0.90 N 10 1 CB A ASP 58 ? ? CG A ASP 58 ? ? OD2 A ASP 58 ? ? 110.30 118.30 -8.00 0.90 N 11 1 CB A ASP 106 ? ? CG A ASP 106 ? ? OD1 A ASP 106 ? ? 123.77 118.30 5.47 0.90 N 12 1 CB A ASP 106 ? ? CG A ASP 106 ? ? OD2 A ASP 106 ? ? 112.40 118.30 -5.90 0.90 N 13 1 CD A ARG 127 ? ? NE A ARG 127 ? ? CZ A ARG 127 ? ? 132.82 123.60 9.22 1.40 N 14 1 NE A ARG 127 ? ? CZ A ARG 127 ? ? NH1 A ARG 127 ? ? 126.65 120.30 6.35 0.50 N 15 1 NE A ARG 127 ? ? CZ A ARG 127 ? ? NH2 A ARG 127 ? ? 115.06 120.30 -5.24 0.50 N 16 1 NE A ARG 130 ? ? CZ A ARG 130 ? ? NH1 A ARG 130 ? ? 125.10 120.30 4.80 0.50 N 17 1 NE A ARG 130 ? ? CZ A ARG 130 ? ? NH2 A ARG 130 ? ? 116.61 120.30 -3.69 0.50 N 18 1 CB A ASP 132 ? ? CG A ASP 132 ? ? OD1 A ASP 132 ? ? 124.42 118.30 6.12 0.90 N 19 1 CB A ASP 132 ? ? CG A ASP 132 ? ? OD2 A ASP 132 ? ? 112.71 118.30 -5.59 0.90 N 20 1 CB A ASP 146 ? ? CG A ASP 146 ? ? OD1 A ASP 146 ? ? 111.05 118.30 -7.25 0.90 N 21 1 CB A ASP 146 ? ? CG A ASP 146 ? ? OD2 A ASP 146 ? ? 124.02 118.30 5.72 0.90 N 22 1 CB A ASP 148 ? ? CG A ASP 148 ? ? OD1 A ASP 148 ? ? 124.98 118.30 6.68 0.90 N 23 1 CB A ASP 148 ? ? CG A ASP 148 ? ? OD2 A ASP 148 ? ? 112.41 118.30 -5.89 0.90 N 24 1 CB A ASP 150 ? ? CG A ASP 150 ? ? OD1 A ASP 150 ? ? 125.90 118.30 7.60 0.90 N 25 1 CB A ASP 150 ? ? CG A ASP 150 ? ? OD2 A ASP 150 ? ? 112.07 118.30 -6.23 0.90 N 26 1 NE A ARG 160 ? ? CZ A ARG 160 ? ? NH1 A ARG 160 ? ? 123.89 120.30 3.59 0.50 N 27 1 CB A ASP 165 ? ? CG A ASP 165 ? ? OD1 A ASP 165 ? ? 124.71 118.30 6.41 0.90 N 28 1 CB A ASP 165 ? ? CG A ASP 165 ? ? OD2 A ASP 165 ? ? 110.88 118.30 -7.42 0.90 N 29 1 NE A ARG 166 ? ? CZ A ARG 166 ? ? NH1 A ARG 166 ? ? 124.28 120.30 3.98 0.50 N 30 1 CB A ASP 254 ? ? CG A ASP 254 ? ? OD1 A ASP 254 ? ? 124.23 118.30 5.93 0.90 N 31 1 CB A ASP 254 ? ? CG A ASP 254 ? ? OD2 A ASP 254 ? ? 111.60 118.30 -6.70 0.90 N 32 1 CB A ASP 256 ? ? CG A ASP 256 ? ? OD1 A ASP 256 ? ? 123.72 118.30 5.42 0.90 N 33 1 CB A ASP 256 ? ? CG A ASP 256 ? ? OD2 A ASP 256 ? ? 111.60 118.30 -6.70 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 148 ? ? -92.55 31.82 2 1 LYS A 149 ? ? -113.00 -168.74 3 1 ASN A 196 ? ? -143.20 22.75 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ASN _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 38 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.084 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id ASN _pdbx_validate_chiral.auth_seq_id 38 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -1 ? A MET 1 2 1 Y 1 A ILE 0 ? A ILE 2 3 1 Y 1 A VAL 1 ? A VAL 3 4 1 Y 1 A GLU 2 ? A GLU 4 5 1 Y 1 A LYS 3 ? A LYS 5 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'POTASSIUM ION' K 3 'PROTOPORPHYRIN IX CONTAINING FE' HEM 4 water HOH #