data_1CR0 # _entry.id 1CR0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1CR0 RCSB RCSB009505 WWPDB D_1000009505 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1CR1 'T7 HELICASE DOMAIN: COMPLEX WITH DTTP' unspecified PDB 1CR2 'T7 HELICASE DOMAIN: COMPLEX WITH DATP' unspecified PDB 1CR4 'T7 HELICASE DOMAIN: COMPLEX WITH DTDP' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CR0 _pdbx_database_status.recvd_initial_deposition_date 1999-08-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sawaya, M.R.' 1 'Guo, S.' 2 'Tabor, S.' 3 'Richardson, C.C.' 4 'Ellenberger, T.' 5 # _citation.id primary _citation.title 'Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.' _citation.journal_abbrev 'Cell(Cambridge,Mass.)' _citation.journal_volume 99 _citation.page_first 167 _citation.page_last 177 _citation.year 1999 _citation.journal_id_ASTM CELLB5 _citation.country US _citation.journal_id_ISSN 0092-8674 _citation.journal_id_CSD 0998 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10535735 _citation.pdbx_database_id_DOI '10.1016/S0092-8674(00)81648-7' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Sawaya, M.R.' 1 primary 'Guo, S.' 2 primary 'Tabor, S.' 3 primary 'Richardson, C.C.' 4 primary 'Ellenberger, T.' 5 # _cell.entry_id 1CR0 _cell.length_a 80.600 _cell.length_b 80.600 _cell.length_c 85.610 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CR0 _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA PRIMASE/HELICASE' 32831.977 1 2.7.7.- ? 'HELICASE DOMAIN' ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 27 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA EDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVV SASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDM PNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSGEEESHSESTDWSNDTDF ; _entity_poly.pdbx_seq_one_letter_code_can ;MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETA EDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVV SASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGDM PNLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSYSGEEESHSESTDWSNDTDF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLU n 1 4 ARG n 1 5 ILE n 1 6 ARG n 1 7 GLU n 1 8 HIS n 1 9 LEU n 1 10 SER n 1 11 SER n 1 12 GLU n 1 13 GLU n 1 14 SER n 1 15 VAL n 1 16 GLY n 1 17 LEU n 1 18 LEU n 1 19 PHE n 1 20 SER n 1 21 GLY n 1 22 CYS n 1 23 THR n 1 24 GLY n 1 25 ILE n 1 26 ASN n 1 27 ASP n 1 28 LYS n 1 29 THR n 1 30 LEU n 1 31 GLY n 1 32 ALA n 1 33 ARG n 1 34 GLY n 1 35 GLY n 1 36 GLU n 1 37 VAL n 1 38 ILE n 1 39 MET n 1 40 VAL n 1 41 THR n 1 42 SER n 1 43 GLY n 1 44 SER n 1 45 GLY n 1 46 MET n 1 47 GLY n 1 48 LYS n 1 49 SER n 1 50 THR n 1 51 PHE n 1 52 VAL n 1 53 ARG n 1 54 GLN n 1 55 GLN n 1 56 ALA n 1 57 LEU n 1 58 GLN n 1 59 TRP n 1 60 GLY n 1 61 THR n 1 62 ALA n 1 63 MET n 1 64 GLY n 1 65 LYS n 1 66 LYS n 1 67 VAL n 1 68 GLY n 1 69 LEU n 1 70 ALA n 1 71 MET n 1 72 LEU n 1 73 GLU n 1 74 GLU n 1 75 SER n 1 76 VAL n 1 77 GLU n 1 78 GLU n 1 79 THR n 1 80 ALA n 1 81 GLU n 1 82 ASP n 1 83 LEU n 1 84 ILE n 1 85 GLY n 1 86 LEU n 1 87 HIS n 1 88 ASN n 1 89 ARG n 1 90 VAL n 1 91 ARG n 1 92 LEU n 1 93 ARG n 1 94 GLN n 1 95 SER n 1 96 ASP n 1 97 SER n 1 98 LEU n 1 99 LYS n 1 100 ARG n 1 101 GLU n 1 102 ILE n 1 103 ILE n 1 104 GLU n 1 105 ASN n 1 106 GLY n 1 107 LYS n 1 108 PHE n 1 109 ASP n 1 110 GLN n 1 111 TRP n 1 112 PHE n 1 113 ASP n 1 114 GLU n 1 115 LEU n 1 116 PHE n 1 117 GLY n 1 118 ASN n 1 119 ASP n 1 120 THR n 1 121 PHE n 1 122 HIS n 1 123 LEU n 1 124 TYR n 1 125 ASP n 1 126 SER n 1 127 PHE n 1 128 ALA n 1 129 GLU n 1 130 ALA n 1 131 GLU n 1 132 THR n 1 133 ASP n 1 134 ARG n 1 135 LEU n 1 136 LEU n 1 137 ALA n 1 138 LYS n 1 139 LEU n 1 140 ALA n 1 141 TYR n 1 142 MET n 1 143 ARG n 1 144 SER n 1 145 GLY n 1 146 LEU n 1 147 GLY n 1 148 CYS n 1 149 ASP n 1 150 VAL n 1 151 ILE n 1 152 ILE n 1 153 LEU n 1 154 ASP n 1 155 HIS n 1 156 ILE n 1 157 SER n 1 158 ILE n 1 159 VAL n 1 160 VAL n 1 161 SER n 1 162 ALA n 1 163 SER n 1 164 GLY n 1 165 GLU n 1 166 SER n 1 167 ASP n 1 168 GLU n 1 169 ARG n 1 170 LYS n 1 171 MET n 1 172 ILE n 1 173 ASP n 1 174 ASN n 1 175 LEU n 1 176 MET n 1 177 THR n 1 178 LYS n 1 179 LEU n 1 180 LYS n 1 181 GLY n 1 182 PHE n 1 183 ALA n 1 184 LYS n 1 185 SER n 1 186 THR n 1 187 GLY n 1 188 VAL n 1 189 VAL n 1 190 LEU n 1 191 VAL n 1 192 VAL n 1 193 ILE n 1 194 CYS n 1 195 HIS n 1 196 LEU n 1 197 LYS n 1 198 ASN n 1 199 PRO n 1 200 ASP n 1 201 LYS n 1 202 GLY n 1 203 LYS n 1 204 ALA n 1 205 HIS n 1 206 GLU n 1 207 GLU n 1 208 GLY n 1 209 ARG n 1 210 PRO n 1 211 VAL n 1 212 SER n 1 213 ILE n 1 214 THR n 1 215 ASP n 1 216 LEU n 1 217 ARG n 1 218 GLY n 1 219 SER n 1 220 GLY n 1 221 ALA n 1 222 LEU n 1 223 ARG n 1 224 GLN n 1 225 LEU n 1 226 SER n 1 227 ASP n 1 228 THR n 1 229 ILE n 1 230 ILE n 1 231 ALA n 1 232 LEU n 1 233 GLU n 1 234 ARG n 1 235 ASN n 1 236 GLN n 1 237 GLN n 1 238 GLY n 1 239 ASP n 1 240 MET n 1 241 PRO n 1 242 ASN n 1 243 LEU n 1 244 VAL n 1 245 LEU n 1 246 VAL n 1 247 ARG n 1 248 ILE n 1 249 LEU n 1 250 LYS n 1 251 CYS n 1 252 ARG n 1 253 PHE n 1 254 THR n 1 255 GLY n 1 256 ASP n 1 257 THR n 1 258 GLY n 1 259 ILE n 1 260 ALA n 1 261 GLY n 1 262 TYR n 1 263 MET n 1 264 GLU n 1 265 TYR n 1 266 ASN n 1 267 LYS n 1 268 GLU n 1 269 THR n 1 270 GLY n 1 271 TRP n 1 272 LEU n 1 273 GLU n 1 274 PRO n 1 275 SER n 1 276 SER n 1 277 TYR n 1 278 SER n 1 279 GLY n 1 280 GLU n 1 281 GLU n 1 282 GLU n 1 283 SER n 1 284 HIS n 1 285 SER n 1 286 GLU n 1 287 SER n 1 288 THR n 1 289 ASP n 1 290 TRP n 1 291 SER n 1 292 ASN n 1 293 ASP n 1 294 THR n 1 295 ASP n 1 296 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus 'T7-like viruses' _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage T7' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10760 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET17B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRIM_BPT7 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03692 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CR0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 296 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03692 _struct_ref_seq.db_align_beg 271 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 566 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 271 _struct_ref_seq.pdbx_auth_seq_align_end 566 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1CR0 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P03692 _struct_ref_seq_dif.db_mon_id LEU _struct_ref_seq_dif.pdbx_seq_db_seq_num 271 _struct_ref_seq_dif.details ENGINEERED _struct_ref_seq_dif.pdbx_auth_seq_num 271 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1CR0 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.44 _exptl_crystal.density_percent_sol 49.69 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 9.00 _exptl_crystal_grow.pdbx_details 'AMMONIUM SULFATE, ACES, pH 9.00, VAPOR DIFFUSION, SITTING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 113 ? 1 2 113 ? 1 # loop_ _diffrn_detector.diffrn_id _diffrn_detector.detector _diffrn_detector.type _diffrn_detector.pdbx_collection_date _diffrn_detector.details 1 CCD ADSC 1999-01-08 ? 2 'IMAGE PLATE' MARRESEARCH 1998-12-20 ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M ? 'SINGLE WAVELENGTH' x-ray 2 1 M ? 'SINGLE WAVELENGTH' x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9350 1.0 2 1.5418 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'CHESS BEAMLINE F1' CHESS F1 0.9350 ? 2 'ROTATING ANODE' 'ELLIOTT GX-13' ? ? 1.5418 ? # _reflns.entry_id 1CR0 _reflns.observed_criterion_sigma_I 0.000 _reflns.observed_criterion_sigma_F 0.00 _reflns.d_resolution_low 20.000 _reflns.d_resolution_high 2.300 _reflns.number_obs 13523 _reflns.number_all 13523 _reflns.percent_possible_obs 97.8 _reflns.pdbx_Rmerge_I_obs 0.0730000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 26.0000 _reflns.B_iso_Wilson_estimate 70.5 _reflns.pdbx_redundancy 10.60 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1,2 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.40 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.3990000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 7.00 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1CR0 _refine.ls_number_reflns_obs 13523 _refine.ls_number_reflns_all 13523 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.2540000 _refine.ls_R_factor_all 0.2540000 _refine.ls_R_factor_R_work 0.2470000 _refine.ls_R_factor_R_free 0.2980000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.000 _refine.ls_number_reflns_R_free 1352 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'POWELL MINIMIZATION WITH BIN SCALING' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENHGH & HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1823 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 1860 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d .013 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.9 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1CR0 _struct.title 'CRYSTAL STRUCTURE OF THE HELICASE DOMAIN OF THE GENE4 PROTEIN OF BACTERIOPHAGE T7' _struct.pdbx_descriptor 'DNA PRIMASE/HELICASE (E.C.2.7.7.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CR0 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'RECA-TYPE PROTEIN FOLD, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ;The filament may be constructred by applying the crystallographic 6 sub 1 screw operators. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 1 ? GLU A 12 ? MET A 271 GLU A 282 1 ? 12 HELX_P HELX_P2 2 GLY A 24 ? LEU A 30 ? GLY A 294 LEU A 300 1 ? 7 HELX_P HELX_P3 3 GLY A 47 ? ALA A 62 ? GLY A 317 ALA A 332 1 ? 16 HELX_P HELX_P4 4 SER A 75 ? ASN A 88 ? SER A 345 ASN A 358 1 ? 14 HELX_P HELX_P5 5 ARG A 91 ? GLN A 94 ? ARG A 361 GLN A 364 5 ? 4 HELX_P HELX_P6 6 SER A 95 ? GLY A 106 ? SER A 365 GLY A 376 1 ? 12 HELX_P HELX_P7 7 GLY A 106 ? GLY A 117 ? GLY A 376 GLY A 387 1 ? 12 HELX_P HELX_P8 8 GLU A 131 ? GLY A 145 ? GLU A 401 GLY A 415 1 ? 15 HELX_P HELX_P9 9 ARG A 169 ? GLY A 187 ? ARG A 439 GLY A 457 1 ? 19 HELX_P HELX_P10 10 ALA A 221 ? SER A 226 ? ALA A 491 SER A 496 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 154 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 424 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 155 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 425 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.39 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 121 ? TYR A 124 ? PHE A 391 TYR A 394 A 2 VAL A 67 ? MET A 71 ? VAL A 337 MET A 341 A 3 VAL A 150 ? SER A 157 ? VAL A 420 SER A 427 A 4 VAL A 189 ? HIS A 195 ? VAL A 459 HIS A 465 A 5 VAL A 37 ? SER A 42 ? VAL A 307 SER A 312 A 6 THR A 228 ? ARG A 234 ? THR A 498 ARG A 504 A 7 VAL A 244 ? CYS A 251 ? VAL A 514 CYS A 521 A 8 GLY A 258 ? TYR A 265 ? GLY A 528 TYR A 535 A 9 LEU A 272 ? PRO A 274 ? LEU A 542 PRO A 544 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 122 ? N HIS A 392 O VAL A 67 ? O VAL A 337 A 2 3 N GLY A 68 ? N GLY A 338 O VAL A 150 ? O VAL A 420 A 3 4 N ILE A 151 ? N ILE A 421 O VAL A 189 ? O VAL A 459 A 4 5 N VAL A 192 ? N VAL A 462 O ILE A 38 ? O ILE A 308 A 5 6 N MET A 39 ? N MET A 309 O THR A 228 ? O THR A 498 A 6 7 O GLU A 233 ? O GLU A 503 N LEU A 245 ? N LEU A 515 A 7 8 N ILE A 248 ? N ILE A 518 O GLY A 258 ? O GLY A 528 A 8 9 N GLU A 264 ? N GLU A 534 O GLU A 273 ? O GLU A 543 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 600' AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 GLY A 43 ? GLY A 313 . ? 1_555 ? 2 AC1 7 GLY A 45 ? GLY A 315 . ? 1_555 ? 3 AC1 7 MET A 46 ? MET A 316 . ? 1_555 ? 4 AC1 7 GLY A 47 ? GLY A 317 . ? 1_555 ? 5 AC1 7 LYS A 48 ? LYS A 318 . ? 1_555 ? 6 AC1 7 SER A 49 ? SER A 319 . ? 1_555 ? 7 AC1 7 HOH D . ? HOH A 623 . ? 1_555 ? 8 AC2 7 THR A 23 ? THR A 293 . ? 3_564 ? 9 AC2 7 GLY A 24 ? GLY A 294 . ? 3_564 ? 10 AC2 7 ILE A 25 ? ILE A 295 . ? 3_564 ? 11 AC2 7 ASN A 26 ? ASN A 296 . ? 3_564 ? 12 AC2 7 ASP A 27 ? ASP A 297 . ? 3_564 ? 13 AC2 7 ARG A 134 ? ARG A 404 . ? 1_555 ? 14 AC2 7 LYS A 138 ? LYS A 408 . ? 1_555 ? # _database_PDB_matrix.entry_id 1CR0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CR0 _atom_sites.fract_transf_matrix[1][1] 0.012407 _atom_sites.fract_transf_matrix[1][2] 0.007163 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014326 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011681 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 271 271 MET MET A . n A 1 2 ARG 2 272 272 ARG ARG A . n A 1 3 GLU 3 273 273 GLU GLU A . n A 1 4 ARG 4 274 274 ARG ARG A . n A 1 5 ILE 5 275 275 ILE ILE A . n A 1 6 ARG 6 276 276 ARG ARG A . n A 1 7 GLU 7 277 277 GLU GLU A . n A 1 8 HIS 8 278 278 HIS HIS A . n A 1 9 LEU 9 279 279 LEU LEU A . n A 1 10 SER 10 280 280 SER SER A . n A 1 11 SER 11 281 281 SER SER A . n A 1 12 GLU 12 282 282 GLU GLU A . n A 1 13 GLU 13 283 283 GLU GLU A . n A 1 14 SER 14 284 284 SER SER A . n A 1 15 VAL 15 285 285 VAL VAL A . n A 1 16 GLY 16 286 286 GLY GLY A . n A 1 17 LEU 17 287 287 LEU LEU A . n A 1 18 LEU 18 288 288 LEU LEU A . n A 1 19 PHE 19 289 289 PHE PHE A . n A 1 20 SER 20 290 290 SER SER A . n A 1 21 GLY 21 291 291 GLY GLY A . n A 1 22 CYS 22 292 292 CYS CYS A . n A 1 23 THR 23 293 293 THR THR A . n A 1 24 GLY 24 294 294 GLY GLY A . n A 1 25 ILE 25 295 295 ILE ILE A . n A 1 26 ASN 26 296 296 ASN ASN A . n A 1 27 ASP 27 297 297 ASP ASP A . n A 1 28 LYS 28 298 298 LYS LYS A . n A 1 29 THR 29 299 299 THR THR A . n A 1 30 LEU 30 300 300 LEU LEU A . n A 1 31 GLY 31 301 301 GLY GLY A . n A 1 32 ALA 32 302 302 ALA ALA A . n A 1 33 ARG 33 303 303 ARG ARG A . n A 1 34 GLY 34 304 304 GLY GLY A . n A 1 35 GLY 35 305 305 GLY GLY A . n A 1 36 GLU 36 306 306 GLU GLU A . n A 1 37 VAL 37 307 307 VAL VAL A . n A 1 38 ILE 38 308 308 ILE ILE A . n A 1 39 MET 39 309 309 MET MET A . n A 1 40 VAL 40 310 310 VAL VAL A . n A 1 41 THR 41 311 311 THR THR A . n A 1 42 SER 42 312 312 SER SER A . n A 1 43 GLY 43 313 313 GLY GLY A . n A 1 44 SER 44 314 314 SER SER A . n A 1 45 GLY 45 315 315 GLY GLY A . n A 1 46 MET 46 316 316 MET MET A . n A 1 47 GLY 47 317 317 GLY GLY A . n A 1 48 LYS 48 318 318 LYS LYS A . n A 1 49 SER 49 319 319 SER SER A . n A 1 50 THR 50 320 320 THR THR A . n A 1 51 PHE 51 321 321 PHE PHE A . n A 1 52 VAL 52 322 322 VAL VAL A . n A 1 53 ARG 53 323 323 ARG ARG A . n A 1 54 GLN 54 324 324 GLN GLN A . n A 1 55 GLN 55 325 325 GLN GLN A . n A 1 56 ALA 56 326 326 ALA ALA A . n A 1 57 LEU 57 327 327 LEU LEU A . n A 1 58 GLN 58 328 328 GLN GLN A . n A 1 59 TRP 59 329 329 TRP TRP A . n A 1 60 GLY 60 330 330 GLY GLY A . n A 1 61 THR 61 331 331 THR THR A . n A 1 62 ALA 62 332 332 ALA ALA A . n A 1 63 MET 63 333 333 MET MET A . n A 1 64 GLY 64 334 334 GLY GLY A . n A 1 65 LYS 65 335 335 LYS LYS A . n A 1 66 LYS 66 336 336 LYS LYS A . n A 1 67 VAL 67 337 337 VAL VAL A . n A 1 68 GLY 68 338 338 GLY GLY A . n A 1 69 LEU 69 339 339 LEU LEU A . n A 1 70 ALA 70 340 340 ALA ALA A . n A 1 71 MET 71 341 341 MET MET A . n A 1 72 LEU 72 342 342 LEU LEU A . n A 1 73 GLU 73 343 343 GLU GLU A . n A 1 74 GLU 74 344 344 GLU GLU A . n A 1 75 SER 75 345 345 SER SER A . n A 1 76 VAL 76 346 346 VAL VAL A . n A 1 77 GLU 77 347 347 GLU GLU A . n A 1 78 GLU 78 348 348 GLU GLU A . n A 1 79 THR 79 349 349 THR THR A . n A 1 80 ALA 80 350 350 ALA ALA A . n A 1 81 GLU 81 351 351 GLU GLU A . n A 1 82 ASP 82 352 352 ASP ASP A . n A 1 83 LEU 83 353 353 LEU LEU A . n A 1 84 ILE 84 354 354 ILE ILE A . n A 1 85 GLY 85 355 355 GLY GLY A . n A 1 86 LEU 86 356 356 LEU LEU A . n A 1 87 HIS 87 357 357 HIS HIS A . n A 1 88 ASN 88 358 358 ASN ASN A . n A 1 89 ARG 89 359 359 ARG ARG A . n A 1 90 VAL 90 360 360 VAL VAL A . n A 1 91 ARG 91 361 361 ARG ARG A . n A 1 92 LEU 92 362 362 LEU LEU A . n A 1 93 ARG 93 363 363 ARG ARG A . n A 1 94 GLN 94 364 364 GLN GLN A . n A 1 95 SER 95 365 365 SER SER A . n A 1 96 ASP 96 366 366 ASP ASP A . n A 1 97 SER 97 367 367 SER SER A . n A 1 98 LEU 98 368 368 LEU LEU A . n A 1 99 LYS 99 369 369 LYS LYS A . n A 1 100 ARG 100 370 370 ARG ARG A . n A 1 101 GLU 101 371 371 GLU GLU A . n A 1 102 ILE 102 372 372 ILE ILE A . n A 1 103 ILE 103 373 373 ILE ILE A . n A 1 104 GLU 104 374 374 GLU GLU A . n A 1 105 ASN 105 375 375 ASN ASN A . n A 1 106 GLY 106 376 376 GLY GLY A . n A 1 107 LYS 107 377 377 LYS LYS A . n A 1 108 PHE 108 378 378 PHE PHE A . n A 1 109 ASP 109 379 379 ASP ASP A . n A 1 110 GLN 110 380 380 GLN GLN A . n A 1 111 TRP 111 381 381 TRP TRP A . n A 1 112 PHE 112 382 382 PHE PHE A . n A 1 113 ASP 113 383 383 ASP ASP A . n A 1 114 GLU 114 384 384 GLU GLU A . n A 1 115 LEU 115 385 385 LEU LEU A . n A 1 116 PHE 116 386 386 PHE PHE A . n A 1 117 GLY 117 387 387 GLY GLY A . n A 1 118 ASN 118 388 388 ASN ASN A . n A 1 119 ASP 119 389 389 ASP ASP A . n A 1 120 THR 120 390 390 THR THR A . n A 1 121 PHE 121 391 391 PHE PHE A . n A 1 122 HIS 122 392 392 HIS HIS A . n A 1 123 LEU 123 393 393 LEU LEU A . n A 1 124 TYR 124 394 394 TYR TYR A . n A 1 125 ASP 125 395 395 ASP ASP A . n A 1 126 SER 126 396 396 SER SER A . n A 1 127 PHE 127 397 397 PHE PHE A . n A 1 128 ALA 128 398 398 ALA ALA A . n A 1 129 GLU 129 399 399 GLU GLU A . n A 1 130 ALA 130 400 400 ALA ALA A . n A 1 131 GLU 131 401 401 GLU GLU A . n A 1 132 THR 132 402 402 THR THR A . n A 1 133 ASP 133 403 403 ASP ASP A . n A 1 134 ARG 134 404 404 ARG ARG A . n A 1 135 LEU 135 405 405 LEU LEU A . n A 1 136 LEU 136 406 406 LEU LEU A . n A 1 137 ALA 137 407 407 ALA ALA A . n A 1 138 LYS 138 408 408 LYS LYS A . n A 1 139 LEU 139 409 409 LEU LEU A . n A 1 140 ALA 140 410 410 ALA ALA A . n A 1 141 TYR 141 411 411 TYR TYR A . n A 1 142 MET 142 412 412 MET MET A . n A 1 143 ARG 143 413 413 ARG ARG A . n A 1 144 SER 144 414 414 SER SER A . n A 1 145 GLY 145 415 415 GLY GLY A . n A 1 146 LEU 146 416 416 LEU LEU A . n A 1 147 GLY 147 417 417 GLY GLY A . n A 1 148 CYS 148 418 418 CYS CYS A . n A 1 149 ASP 149 419 419 ASP ASP A . n A 1 150 VAL 150 420 420 VAL VAL A . n A 1 151 ILE 151 421 421 ILE ILE A . n A 1 152 ILE 152 422 422 ILE ILE A . n A 1 153 LEU 153 423 423 LEU LEU A . n A 1 154 ASP 154 424 424 ASP ASP A . n A 1 155 HIS 155 425 425 HIS HIS A . n A 1 156 ILE 156 426 426 ILE ILE A . n A 1 157 SER 157 427 427 SER SER A . n A 1 158 ILE 158 428 428 ILE ILE A . n A 1 159 VAL 159 429 ? ? ? A . n A 1 160 VAL 160 430 ? ? ? A . n A 1 161 SER 161 431 ? ? ? A . n A 1 162 ALA 162 432 ? ? ? A . n A 1 163 SER 163 433 ? ? ? A . n A 1 164 GLY 164 434 ? ? ? A . n A 1 165 GLU 165 435 ? ? ? A . n A 1 166 SER 166 436 ? ? ? A . n A 1 167 ASP 167 437 ? ? ? A . n A 1 168 GLU 168 438 ? ? ? A . n A 1 169 ARG 169 439 439 ARG ARG A . n A 1 170 LYS 170 440 440 LYS LYS A . n A 1 171 MET 171 441 441 MET MET A . n A 1 172 ILE 172 442 442 ILE ILE A . n A 1 173 ASP 173 443 443 ASP ASP A . n A 1 174 ASN 174 444 444 ASN ASN A . n A 1 175 LEU 175 445 445 LEU LEU A . n A 1 176 MET 176 446 446 MET MET A . n A 1 177 THR 177 447 447 THR THR A . n A 1 178 LYS 178 448 448 LYS LYS A . n A 1 179 LEU 179 449 449 LEU LEU A . n A 1 180 LYS 180 450 450 LYS LYS A . n A 1 181 GLY 181 451 451 GLY GLY A . n A 1 182 PHE 182 452 452 PHE PHE A . n A 1 183 ALA 183 453 453 ALA ALA A . n A 1 184 LYS 184 454 454 LYS LYS A . n A 1 185 SER 185 455 455 SER SER A . n A 1 186 THR 186 456 456 THR THR A . n A 1 187 GLY 187 457 457 GLY GLY A . n A 1 188 VAL 188 458 458 VAL VAL A . n A 1 189 VAL 189 459 459 VAL VAL A . n A 1 190 LEU 190 460 460 LEU LEU A . n A 1 191 VAL 191 461 461 VAL VAL A . n A 1 192 VAL 192 462 462 VAL VAL A . n A 1 193 ILE 193 463 463 ILE ILE A . n A 1 194 CYS 194 464 464 CYS CYS A . n A 1 195 HIS 195 465 465 HIS HIS A . n A 1 196 LEU 196 466 466 LEU LEU A . n A 1 197 LYS 197 467 467 LYS LYS A . n A 1 198 ASN 198 468 ? ? ? A . n A 1 199 PRO 199 469 ? ? ? A . n A 1 200 ASP 200 470 ? ? ? A . n A 1 201 LYS 201 471 ? ? ? A . n A 1 202 GLY 202 472 ? ? ? A . n A 1 203 LYS 203 473 ? ? ? A . n A 1 204 ALA 204 474 ? ? ? A . n A 1 205 HIS 205 475 ? ? ? A . n A 1 206 GLU 206 476 ? ? ? A . n A 1 207 GLU 207 477 ? ? ? A . n A 1 208 GLY 208 478 ? ? ? A . n A 1 209 ARG 209 479 ? ? ? A . n A 1 210 PRO 210 480 ? ? ? A . n A 1 211 VAL 211 481 ? ? ? A . n A 1 212 SER 212 482 ? ? ? A . n A 1 213 ILE 213 483 ? ? ? A . n A 1 214 THR 214 484 ? ? ? A . n A 1 215 ASP 215 485 485 ASP ASP A . n A 1 216 LEU 216 486 486 LEU LEU A . n A 1 217 ARG 217 487 487 ARG ARG A . n A 1 218 GLY 218 488 ? ? ? A . n A 1 219 SER 219 489 ? ? ? A . n A 1 220 GLY 220 490 490 GLY GLY A . n A 1 221 ALA 221 491 491 ALA ALA A . n A 1 222 LEU 222 492 492 LEU LEU A . n A 1 223 ARG 223 493 493 ARG ARG A . n A 1 224 GLN 224 494 494 GLN GLN A . n A 1 225 LEU 225 495 495 LEU LEU A . n A 1 226 SER 226 496 496 SER SER A . n A 1 227 ASP 227 497 497 ASP ASP A . n A 1 228 THR 228 498 498 THR THR A . n A 1 229 ILE 229 499 499 ILE ILE A . n A 1 230 ILE 230 500 500 ILE ILE A . n A 1 231 ALA 231 501 501 ALA ALA A . n A 1 232 LEU 232 502 502 LEU LEU A . n A 1 233 GLU 233 503 503 GLU GLU A . n A 1 234 ARG 234 504 504 ARG ARG A . n A 1 235 ASN 235 505 505 ASN ASN A . n A 1 236 GLN 236 506 506 GLN GLN A . n A 1 237 GLN 237 507 ? ? ? A . n A 1 238 GLY 238 508 ? ? ? A . n A 1 239 ASP 239 509 ? ? ? A . n A 1 240 MET 240 510 ? ? ? A . n A 1 241 PRO 241 511 ? ? ? A . n A 1 242 ASN 242 512 ? ? ? A . n A 1 243 LEU 243 513 513 LEU LEU A . n A 1 244 VAL 244 514 514 VAL VAL A . n A 1 245 LEU 245 515 515 LEU LEU A . n A 1 246 VAL 246 516 516 VAL VAL A . n A 1 247 ARG 247 517 517 ARG ARG A . n A 1 248 ILE 248 518 518 ILE ILE A . n A 1 249 LEU 249 519 519 LEU LEU A . n A 1 250 LYS 250 520 520 LYS LYS A . n A 1 251 CYS 251 521 521 CYS CYS A . n A 1 252 ARG 252 522 522 ARG ARG A . n A 1 253 PHE 253 523 523 PHE PHE A . n A 1 254 THR 254 524 524 THR THR A . n A 1 255 GLY 255 525 525 GLY GLY A . n A 1 256 ASP 256 526 526 ASP ASP A . n A 1 257 THR 257 527 527 THR THR A . n A 1 258 GLY 258 528 528 GLY GLY A . n A 1 259 ILE 259 529 529 ILE ILE A . n A 1 260 ALA 260 530 530 ALA ALA A . n A 1 261 GLY 261 531 531 GLY GLY A . n A 1 262 TYR 262 532 532 TYR TYR A . n A 1 263 MET 263 533 533 MET MET A . n A 1 264 GLU 264 534 534 GLU GLU A . n A 1 265 TYR 265 535 535 TYR TYR A . n A 1 266 ASN 266 536 536 ASN ASN A . n A 1 267 LYS 267 537 537 LYS LYS A . n A 1 268 GLU 268 538 538 GLU GLU A . n A 1 269 THR 269 539 539 THR THR A . n A 1 270 GLY 270 540 540 GLY GLY A . n A 1 271 TRP 271 541 541 TRP TRP A . n A 1 272 LEU 272 542 542 LEU LEU A . n A 1 273 GLU 273 543 543 GLU GLU A . n A 1 274 PRO 274 544 544 PRO PRO A . n A 1 275 SER 275 545 545 SER SER A . n A 1 276 SER 276 546 546 SER SER A . n A 1 277 TYR 277 547 547 TYR TYR A . n A 1 278 SER 278 548 ? ? ? A . n A 1 279 GLY 279 549 ? ? ? A . n A 1 280 GLU 280 550 ? ? ? A . n A 1 281 GLU 281 551 ? ? ? A . n A 1 282 GLU 282 552 ? ? ? A . n A 1 283 SER 283 553 ? ? ? A . n A 1 284 HIS 284 554 ? ? ? A . n A 1 285 SER 285 555 ? ? ? A . n A 1 286 GLU 286 556 ? ? ? A . n A 1 287 SER 287 557 ? ? ? A . n A 1 288 THR 288 558 ? ? ? A . n A 1 289 ASP 289 559 ? ? ? A . n A 1 290 TRP 290 560 ? ? ? A . n A 1 291 SER 291 561 ? ? ? A . n A 1 292 ASN 292 562 ? ? ? A . n A 1 293 ASP 293 563 ? ? ? A . n A 1 294 THR 294 564 ? ? ? A . n A 1 295 ASP 295 565 ? ? ? A . n A 1 296 PHE 296 566 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 28.5366666667 3 'crystal symmetry operation' 3_555 -x+y,-x,z+2/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 57.0733333333 4 'crystal symmetry operation' 4_555 -x,-y,z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 42.8050000000 5 'crystal symmetry operation' 5_555 y,-x+y,z+5/6 0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 71.3416666667 6 'crystal symmetry operation' 6_555 x-y,x,z+1/6 0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 14.2683333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-11-10 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MLPHARE phasing . ? 1 X-PLOR refinement 3.851 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 312 ? ? 166.92 -173.30 2 1 GLU A 343 ? ? -90.31 -62.97 3 1 LEU A 385 ? ? -121.97 -50.93 4 1 ASP A 395 ? ? -122.90 -163.40 5 1 ASN A 505 ? ? 43.93 -9.63 6 1 LYS A 520 ? ? -171.44 139.27 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 323 ? ? 0.095 'SIDE CHAIN' 2 1 ARG A 504 ? ? 0.088 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 276 ? CG ? A ARG 6 CG 2 1 Y 1 A ARG 276 ? CD ? A ARG 6 CD 3 1 Y 1 A ARG 276 ? NE ? A ARG 6 NE 4 1 Y 1 A ARG 276 ? CZ ? A ARG 6 CZ 5 1 Y 1 A ARG 276 ? NH1 ? A ARG 6 NH1 6 1 Y 1 A ARG 276 ? NH2 ? A ARG 6 NH2 7 1 Y 1 A LYS 298 ? CG ? A LYS 28 CG 8 1 Y 1 A LYS 298 ? CD ? A LYS 28 CD 9 1 Y 1 A LYS 298 ? CE ? A LYS 28 CE 10 1 Y 1 A LYS 298 ? NZ ? A LYS 28 NZ 11 1 Y 1 A GLU 343 ? CG ? A GLU 73 CG 12 1 Y 1 A GLU 343 ? CD ? A GLU 73 CD 13 1 Y 1 A GLU 343 ? OE1 ? A GLU 73 OE1 14 1 Y 1 A GLU 343 ? OE2 ? A GLU 73 OE2 15 1 Y 1 A ARG 370 ? CG ? A ARG 100 CG 16 1 Y 1 A ARG 370 ? CD ? A ARG 100 CD 17 1 Y 1 A ARG 370 ? NE ? A ARG 100 NE 18 1 Y 1 A ARG 370 ? CZ ? A ARG 100 CZ 19 1 Y 1 A ARG 370 ? NH1 ? A ARG 100 NH1 20 1 Y 1 A ARG 370 ? NH2 ? A ARG 100 NH2 21 1 Y 1 A GLN 380 ? CD ? A GLN 110 CD 22 1 Y 1 A GLN 380 ? OE1 ? A GLN 110 OE1 23 1 Y 1 A GLN 380 ? NE2 ? A GLN 110 NE2 24 1 Y 1 A ASP 389 ? OD1 ? A ASP 119 OD1 25 1 Y 1 A ASP 389 ? OD2 ? A ASP 119 OD2 26 1 Y 1 A ILE 428 ? C ? A ILE 158 C 27 1 Y 1 A ILE 428 ? O ? A ILE 158 O 28 1 Y 1 A ARG 439 ? CG ? A ARG 169 CG 29 1 Y 1 A ARG 439 ? CD ? A ARG 169 CD 30 1 Y 1 A ARG 439 ? NE ? A ARG 169 NE 31 1 Y 1 A ARG 439 ? CZ ? A ARG 169 CZ 32 1 Y 1 A ARG 439 ? NH1 ? A ARG 169 NH1 33 1 Y 1 A ARG 439 ? NH2 ? A ARG 169 NH2 34 1 Y 1 A ILE 442 ? CG1 ? A ILE 172 CG1 35 1 Y 1 A ILE 442 ? CG2 ? A ILE 172 CG2 36 1 Y 1 A ILE 442 ? CD1 ? A ILE 172 CD1 37 1 Y 1 A LYS 454 ? CE ? A LYS 184 CE 38 1 Y 1 A LYS 454 ? NZ ? A LYS 184 NZ 39 1 Y 1 A ASP 485 ? CG ? A ASP 215 CG 40 1 Y 1 A ASP 485 ? OD1 ? A ASP 215 OD1 41 1 Y 1 A ASP 485 ? OD2 ? A ASP 215 OD2 42 1 Y 1 A LEU 486 ? CG ? A LEU 216 CG 43 1 Y 1 A LEU 486 ? CD1 ? A LEU 216 CD1 44 1 Y 1 A LEU 486 ? CD2 ? A LEU 216 CD2 45 1 Y 1 A ARG 487 ? CG ? A ARG 217 CG 46 1 Y 1 A ARG 487 ? CD ? A ARG 217 CD 47 1 Y 1 A ARG 487 ? NE ? A ARG 217 NE 48 1 Y 1 A ARG 487 ? CZ ? A ARG 217 CZ 49 1 Y 1 A ARG 487 ? NH1 ? A ARG 217 NH1 50 1 Y 1 A ARG 487 ? NH2 ? A ARG 217 NH2 51 1 Y 1 A GLY 490 ? N ? A GLY 220 N 52 1 Y 1 A GLY 490 ? CA ? A GLY 220 CA 53 1 Y 1 A ARG 493 ? CD ? A ARG 223 CD 54 1 Y 1 A ARG 493 ? NE ? A ARG 223 NE 55 1 Y 1 A ARG 493 ? CZ ? A ARG 223 CZ 56 1 Y 1 A ARG 493 ? NH1 ? A ARG 223 NH1 57 1 Y 1 A ARG 493 ? NH2 ? A ARG 223 NH2 58 1 Y 1 A GLN 494 ? CG ? A GLN 224 CG 59 1 Y 1 A GLN 494 ? CD ? A GLN 224 CD 60 1 Y 1 A GLN 494 ? OE1 ? A GLN 224 OE1 61 1 Y 1 A GLN 494 ? NE2 ? A GLN 224 NE2 62 1 Y 1 A GLN 506 ? C ? A GLN 236 C 63 1 Y 1 A GLN 506 ? O ? A GLN 236 O 64 1 Y 1 A ARG 522 ? CG ? A ARG 252 CG 65 1 Y 1 A ARG 522 ? CD ? A ARG 252 CD 66 1 Y 1 A ARG 522 ? NE ? A ARG 252 NE 67 1 Y 1 A ARG 522 ? CZ ? A ARG 252 CZ 68 1 Y 1 A ARG 522 ? NH1 ? A ARG 252 NH1 69 1 Y 1 A ARG 522 ? NH2 ? A ARG 252 NH2 70 1 Y 1 A GLU 538 ? CG ? A GLU 268 CG 71 1 Y 1 A GLU 538 ? CD ? A GLU 268 CD 72 1 Y 1 A GLU 538 ? OE1 ? A GLU 268 OE1 73 1 Y 1 A GLU 538 ? OE2 ? A GLU 268 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 429 ? A VAL 159 2 1 Y 1 A VAL 430 ? A VAL 160 3 1 Y 1 A SER 431 ? A SER 161 4 1 Y 1 A ALA 432 ? A ALA 162 5 1 Y 1 A SER 433 ? A SER 163 6 1 Y 1 A GLY 434 ? A GLY 164 7 1 Y 1 A GLU 435 ? A GLU 165 8 1 Y 1 A SER 436 ? A SER 166 9 1 Y 1 A ASP 437 ? A ASP 167 10 1 Y 1 A GLU 438 ? A GLU 168 11 1 Y 1 A ASN 468 ? A ASN 198 12 1 Y 1 A PRO 469 ? A PRO 199 13 1 Y 1 A ASP 470 ? A ASP 200 14 1 Y 1 A LYS 471 ? A LYS 201 15 1 Y 1 A GLY 472 ? A GLY 202 16 1 Y 1 A LYS 473 ? A LYS 203 17 1 Y 1 A ALA 474 ? A ALA 204 18 1 Y 1 A HIS 475 ? A HIS 205 19 1 Y 1 A GLU 476 ? A GLU 206 20 1 Y 1 A GLU 477 ? A GLU 207 21 1 Y 1 A GLY 478 ? A GLY 208 22 1 Y 1 A ARG 479 ? A ARG 209 23 1 Y 1 A PRO 480 ? A PRO 210 24 1 Y 1 A VAL 481 ? A VAL 211 25 1 Y 1 A SER 482 ? A SER 212 26 1 Y 1 A ILE 483 ? A ILE 213 27 1 Y 1 A THR 484 ? A THR 214 28 1 Y 1 A GLY 488 ? A GLY 218 29 1 Y 1 A SER 489 ? A SER 219 30 1 Y 1 A GLN 507 ? A GLN 237 31 1 Y 1 A GLY 508 ? A GLY 238 32 1 Y 1 A ASP 509 ? A ASP 239 33 1 Y 1 A MET 510 ? A MET 240 34 1 Y 1 A PRO 511 ? A PRO 241 35 1 Y 1 A ASN 512 ? A ASN 242 36 1 Y 1 A SER 548 ? A SER 278 37 1 Y 1 A GLY 549 ? A GLY 279 38 1 Y 1 A GLU 550 ? A GLU 280 39 1 Y 1 A GLU 551 ? A GLU 281 40 1 Y 1 A GLU 552 ? A GLU 282 41 1 Y 1 A SER 553 ? A SER 283 42 1 Y 1 A HIS 554 ? A HIS 284 43 1 Y 1 A SER 555 ? A SER 285 44 1 Y 1 A GLU 556 ? A GLU 286 45 1 Y 1 A SER 557 ? A SER 287 46 1 Y 1 A THR 558 ? A THR 288 47 1 Y 1 A ASP 559 ? A ASP 289 48 1 Y 1 A TRP 560 ? A TRP 290 49 1 Y 1 A SER 561 ? A SER 291 50 1 Y 1 A ASN 562 ? A ASN 292 51 1 Y 1 A ASP 563 ? A ASP 293 52 1 Y 1 A THR 564 ? A THR 294 53 1 Y 1 A ASP 565 ? A ASP 295 54 1 Y 1 A PHE 566 ? A PHE 296 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 600 600 SO4 SO4 A . C 2 SO4 1 601 601 SO4 SO4 A . D 3 HOH 1 602 602 HOH HOH A . D 3 HOH 2 603 603 HOH HOH A . D 3 HOH 3 605 605 HOH HOH A . D 3 HOH 4 606 606 HOH HOH A . D 3 HOH 5 607 607 HOH HOH A . D 3 HOH 6 609 609 HOH HOH A . D 3 HOH 7 610 610 HOH HOH A . D 3 HOH 8 611 611 HOH HOH A . D 3 HOH 9 612 612 HOH HOH A . D 3 HOH 10 614 614 HOH HOH A . D 3 HOH 11 616 616 HOH HOH A . D 3 HOH 12 617 617 HOH HOH A . D 3 HOH 13 618 618 HOH HOH A . D 3 HOH 14 619 619 HOH HOH A . D 3 HOH 15 620 620 HOH HOH A . D 3 HOH 16 621 621 HOH HOH A . D 3 HOH 17 622 622 HOH HOH A . D 3 HOH 18 623 623 HOH HOH A . D 3 HOH 19 625 625 HOH HOH A . D 3 HOH 20 627 627 HOH HOH A . D 3 HOH 21 629 629 HOH HOH A . D 3 HOH 22 630 630 HOH HOH A . D 3 HOH 23 631 631 HOH HOH A . D 3 HOH 24 632 632 HOH HOH A . D 3 HOH 25 633 633 HOH HOH A . D 3 HOH 26 634 634 HOH HOH A . D 3 HOH 27 635 635 HOH HOH A . #