data_1CTO # _entry.id 1CTO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.290 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1CTO WWPDB D_1000172525 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CTO _pdbx_database_status.recvd_initial_deposition_date 1996-09-25 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yamasaki, K.' 1 'Naito, S.' 2 'Anaguchi, H.' 3 'Ohkubo, T.' 4 'Ota, Y.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure of an extracellular domain containing the WSxWS motif of the granulocyte colony-stimulating factor receptor and its interaction with ligand. ; Nat.Struct.Biol. 4 498 504 1997 NSBIEW US 1072-8368 2024 ? 9187659 10.1038/nsb0697-498 1 ;Ligand Binding Characteristics of the Carboxyl-Terminal Domain of the Cytokine Receptor Homologous Region of the Granulocyte Colony-Stimulating Factor Receptor ; J.Biol.Chem. 270 27845 ? 1995 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yamasaki, K.' 1 primary 'Naito, S.' 2 primary 'Anaguchi, H.' 3 primary 'Ohkubo, T.' 4 primary 'Ota, Y.' 5 1 'Anaguchi, H.' 6 1 'Hiraoka, O.' 7 1 'Yamasaki, K.' 8 1 'Naito, S.' 9 1 'Ota, Y.' 10 # _cell.entry_id 1CTO _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CTO _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR' _entity.formula_weight 12536.452 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'INS(G1,S2,S3)' _entity.pdbx_fragment 'C-TERMINAL DOMAIN OF THE LIGAND-BINDING REGION' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSLEPPMLQALDIGPDVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVY TLQMRCIRSSLPGFWSPWSPGLQLRPTMK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSLEPPMLQALDIGPDVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVY TLQMRCIRSSLPGFWSPWSPGLQLRPTMK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 LEU n 1 5 GLU n 1 6 PRO n 1 7 PRO n 1 8 MET n 1 9 LEU n 1 10 GLN n 1 11 ALA n 1 12 LEU n 1 13 ASP n 1 14 ILE n 1 15 GLY n 1 16 PRO n 1 17 ASP n 1 18 VAL n 1 19 VAL n 1 20 SER n 1 21 HIS n 1 22 GLN n 1 23 PRO n 1 24 GLY n 1 25 CYS n 1 26 LEU n 1 27 TRP n 1 28 LEU n 1 29 SER n 1 30 TRP n 1 31 LYS n 1 32 PRO n 1 33 TRP n 1 34 LYS n 1 35 PRO n 1 36 SER n 1 37 GLU n 1 38 TYR n 1 39 MET n 1 40 GLU n 1 41 GLN n 1 42 GLU n 1 43 CYS n 1 44 GLU n 1 45 LEU n 1 46 ARG n 1 47 TYR n 1 48 GLN n 1 49 PRO n 1 50 GLN n 1 51 LEU n 1 52 LYS n 1 53 GLY n 1 54 ALA n 1 55 ASN n 1 56 TRP n 1 57 THR n 1 58 LEU n 1 59 VAL n 1 60 PHE n 1 61 HIS n 1 62 LEU n 1 63 PRO n 1 64 SER n 1 65 SER n 1 66 LYS n 1 67 ASP n 1 68 GLN n 1 69 PHE n 1 70 GLU n 1 71 LEU n 1 72 CYS n 1 73 GLY n 1 74 LEU n 1 75 HIS n 1 76 GLN n 1 77 ALA n 1 78 PRO n 1 79 VAL n 1 80 TYR n 1 81 THR n 1 82 LEU n 1 83 GLN n 1 84 MET n 1 85 ARG n 1 86 CYS n 1 87 ILE n 1 88 ARG n 1 89 SER n 1 90 SER n 1 91 LEU n 1 92 PRO n 1 93 GLY n 1 94 PHE n 1 95 TRP n 1 96 SER n 1 97 PRO n 1 98 TRP n 1 99 SER n 1 100 PRO n 1 101 GLY n 1 102 LEU n 1 103 GLN n 1 104 LEU n 1 105 ARG n 1 106 PRO n 1 107 THR n 1 108 MET n 1 109 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PMAL-P _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'EXPRESSED AS A FUSION PROTEIN WITH MALTOSE BINDING PROTEIN' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CSF3R_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P40223 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MVGLGACTLTGVTLIFLLLPRSLESCGHIEISPPVVRLGDPVLASCTISPNCSKLDQQAKILWRLQDEPIQPGDRQHHLP DGTQESLITLPHLNYTQAFLFCLVPWEDSVQLLDQAELHAGYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILK SFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIGP DVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWS PWSPGLQLRPTMKAPTIRLDTWCQKKQLDPGTVSVQLFWKPTPLQEDSGQIQGYLLSWNSPDHQGQDIHLCNTTQLSCIF LLPSEAQNVTLVAYNKAGTSSPTTVVFLENEGPAVTGLHAMAQDLNTIWVDWEAPSLLPQGYLIEWEMSSPSYNNSYKSW MIEPNGNITGILLKDNINPFQLYRITVAPLYPGIVGPPVNVYTFAGERAPPHAPALHLKHVGTTWAQLEWVPEAPRLGMI PLTHYTIFWADAGDHSFSVTLNISLHDFVLKHLEPASLYHVYLMATSRAGSTNSTGLTLRTLDPSDLNIFLGILCLVLLS TTCVVTWLCCKRRGKTSFWSDVPDPAHSSLSSWLPTIMTEETFQLPSFWDSSVPSITKITELEEDKKPTHWDSESSGNGS LPALVQAYVLQGDPREISNQSQPPSRTGDQVLYGQVLESPTSPGVMQYIRSDSTQPLLGGPTPSPKSYENIWFHSRPQET FVPQPPNQEDDCVFGPPFDFPLFQGLQVHGVEEQGGF ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CTO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P40223 _struct_ref_seq.db_align_beg 211 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 333 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1CTO ? A ? ? UNP P40223 GLU 214 DELETION ? 1 1 1CTO ? A ? ? UNP P40223 SER 215 DELETION ? 2 1 1CTO ? A ? ? UNP P40223 PRO 216 DELETION ? 3 1 1CTO ? A ? ? UNP P40223 LYS 217 DELETION ? 4 1 1CTO ? A ? ? UNP P40223 LEU 218 DELETION ? 5 1 1CTO ? A ? ? UNP P40223 CYS 219 DELETION ? 6 1 1CTO ? A ? ? UNP P40223 LEU 220 DELETION ? 7 1 1CTO ? A ? ? UNP P40223 ASP 221 DELETION ? 8 1 1CTO ? A ? ? UNP P40223 PRO 222 DELETION ? 9 1 1CTO ? A ? ? UNP P40223 MET 223 DELETION ? 10 1 1CTO ? A ? ? UNP P40223 ASP 224 DELETION ? 11 1 1CTO ? A ? ? UNP P40223 VAL 225 DELETION ? 12 1 1CTO ? A ? ? UNP P40223 VAL 226 DELETION ? 13 1 1CTO ? A ? ? UNP P40223 LYS 227 DELETION ? 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 'TRIPLE RESONANCE 2D' 1 2 1 '3D NMR' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1CTO _pdbx_nmr_refine.method 'RANDOM.INP/DGSA.INP/ REFINE.INP' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1CTO _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'MINIMIZED AVERAGE' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR 3.1 BRUNGER 2 # _exptl.entry_id 1CTO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1CTO _struct.title ;NMR STRUCTURE OF THE C-TERMINAL DOMAIN OF THE LIGAND-BINDING REGION OF MURINE GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR, MINIMIZED AVERAGE STRUCTURE ; _struct.pdbx_descriptor 'GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CTO _struct_keywords.pdbx_keywords 'BINDING PROTEIN' _struct_keywords.text 'BINDING PROTEIN, CYTOKINE RECEPTOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 72 SG ? ? A CYS 25 A CYS 72 1_555 ? ? ? ? ? ? ? 2.020 ? disulf2 disulf ? ? A CYS 43 SG ? ? ? 1_555 A CYS 86 SG ? ? A CYS 43 A CYS 86 1_555 ? ? ? ? ? ? ? 2.020 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details 1 ? 3 ? 2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense 1 1 2 ? anti-parallel 1 2 3 ? anti-parallel 2 1 2 ? anti-parallel 2 2 3 ? anti-parallel 2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id 1 1 MET A 8 ? ALA A 11 ? MET A 8 ALA A 11 1 2 CYS A 25 ? LYS A 31 ? CYS A 25 LYS A 31 1 3 PHE A 69 ? CYS A 72 ? PHE A 69 CYS A 72 2 1 TRP A 56 ? PHE A 60 ? TRP A 56 PHE A 60 2 2 CYS A 43 ? PRO A 49 ? CYS A 43 PRO A 49 2 3 VAL A 79 ? CYS A 86 ? VAL A 79 CYS A 86 2 4 LEU A 102 ? ARG A 105 ? LEU A 102 ARG A 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id 1 1 2 O GLN A 10 ? O GLN A 10 H SER A 29 ? H SER A 29 1 2 3 O LEU A 26 ? O LEU A 26 H LEU A 71 ? H LEU A 71 2 1 2 O VAL A 59 ? O VAL A 59 H LEU A 45 ? H LEU A 45 2 2 3 O GLU A 44 ? O GLU A 44 H ARG A 85 ? H ARG A 85 2 3 4 O LEU A 82 ? O LEU A 82 H LEU A 102 ? H LEU A 102 # _database_PDB_matrix.entry_id 1CTO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CTO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 TRP 95 95 95 TRP TRP A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 LYS 109 109 109 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8010 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-10-22 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-03-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_assembly_prop 6 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_pdbx_nmr_software.authors' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_software.version' 5 4 'Structure model' '_pdbx_nmr_spectrometer.field_strength' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 52.77 -144.20 2 1 SER A 3 ? ? -53.40 -171.00 3 1 GLU A 5 ? ? 56.16 102.89 4 1 ASP A 13 ? ? -69.29 95.57 5 1 VAL A 18 ? ? -108.47 44.27 6 1 VAL A 19 ? ? 64.22 -87.45 7 1 SER A 20 ? ? -85.77 -93.03 8 1 HIS A 21 ? ? 161.01 49.75 9 1 SER A 29 ? ? 170.61 128.64 10 1 LYS A 31 ? ? -179.30 136.94 11 1 PRO A 32 ? ? -77.80 -162.16 12 1 LYS A 34 ? ? 43.73 165.01 13 1 SER A 36 ? ? 36.56 -156.57 14 1 GLU A 37 ? ? -133.02 -92.61 15 1 TYR A 38 ? ? -83.44 -129.22 16 1 MET A 39 ? ? 176.30 -140.68 17 1 GLU A 40 ? ? 71.90 54.36 18 1 GLU A 42 ? ? 112.47 134.45 19 1 TYR A 47 ? ? -163.11 116.42 20 1 LEU A 51 ? ? -160.94 -155.92 21 1 ALA A 54 ? ? 163.83 159.16 22 1 TRP A 56 ? ? 63.18 119.08 23 1 PHE A 60 ? ? -110.48 -166.65 24 1 CYS A 72 ? ? -170.30 128.62 25 1 GLN A 76 ? ? 179.77 -36.84 26 1 ILE A 87 ? ? -158.68 -142.52 27 1 LEU A 91 ? ? -175.65 62.94 28 1 SER A 96 ? ? 52.57 172.04 29 1 TRP A 98 ? ? -49.09 96.22 30 1 LEU A 102 ? ? -170.10 -174.52 31 1 PRO A 106 ? ? -77.67 -159.27 32 1 THR A 107 ? ? -40.19 150.06 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 46 ? ? 0.310 'SIDE CHAIN' 2 1 ARG A 85 ? ? 0.201 'SIDE CHAIN' #