data_1CWC # _entry.id 1CWC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1CWC WWPDB D_1000172567 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1BCK unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN C' PDB 1C5F unspecified 'CRYSTAL STRUCTURE OF THE CYCLOPHILIN-LIKE DOMAIN FROM BRUGIA MALAYI COMPLEXED WITH CYCLOSPORIN A' PDB 1CSA unspecified 'SOLUTION STRUCTURE OF E.COLI CYCLOPHILIN (F112W) COMPLEXED WITH CYCLOSPORIN A' PDB 1CWA unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A' PDB 1CWB unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 5' PDB 1CWF unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN D' PDB 1CWH unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A MODIFIED AT POSITION 7' PDB 1CWI unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN D AT POSITION 7' PDB 1CWJ unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN D AT POSITIONS 5 AND 7.' PDB 1CWK unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN D AT POSITIONS 5 AND 7.' PDB 1CWL unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 8' PDB 1CWM unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 8' PDB 1CWO unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH NODIFIED CYCLOSPORIN C AT POSITIONS 1, AND 9' PDB 1CYA unspecified 'SOLUTION STRUCTURE OF HUMAN CYCLOPHILIN COMPLEXED WIYH CYCLOSPORIN A' PDB 1CYB unspecified 'SOLUTION STRUCTURE OF HUMAN CYCLOPHILIN COMPLEXED WITH CYCLOSPORIN A' PDB 1CYN unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN B COMPLEXED WITH MODIFIED CYCLOSPORIN A' PDB 1IKF unspecified 'CRYSTAL STRUCTURE OF CTCLOSPORIN-FAB COMPLEX' PDB 1M63 unspecified 'CRYSTAL STRUCTURE OF CALCINEURIN-CYCLOPHILIN-CYCLOSPORIN COMPLEX' PDB 1MF8 unspecified 'CRYSTAL STRUCTURE OF HUMAN CALCINEURIN COMPLEXED WITH HUMAN CYCLOPHILIN AND CYCLOSPORIN A' PDB 1MIK unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 6' PDB 1QNG unspecified 'CRYSTAL STRUCTURE OF PLASMODIUM FALCIPARUM CYCLOPHILIN COMPLEXED WITH CYCLOSPORIN A' PDB 1QNH unspecified 'CRYSTAL STRUCTURE OF PLASMODIUM FALCIPARUM CYCLOPHILIN (DOUBLE MUTANT) COMPLEXED WITH CYCLOSPORIN A' PDB 1XQ7 unspecified 'CRYSTAL STRUCTURE OF TRYPANOSOMA CRUZI CYCLOPHILIN COMPLEXED WITH CYCLOSPORIN A' PDB 2ESL unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN C COMPLEXED WITH CYCLOSPORIN A' PDB 2OJU unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN J COMPLEXED WITH CYCLOSPORIN A' PDB 2POY unspecified 'CRYSTAL STRUCTURE OF CRYPTOSPORIDIUM PARVUM IOWA II CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A' PDB 2RMA unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A' PDB 2RMB unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 5' PDB 2RMC unspecified 'CRYSTAL STRUCTURE OF MURINE CYCLOPHILIN C COMPLEXED WITH CYCLOSPORIN A' PDB 2WFJ unspecified 'CRYSTAL STRUCTURE OF THE PPIASE DOMAIN OF HUMAN CYCLOPHILIN G COMPLEXED WITH CYCLOSPORIN A' PDB 2X2C unspecified 'CRYSTAL STRUCTURE OF HUMAN ACETYL-CYPA COMPLEXED WITH CYCLOSPORINE A' PDB 2X7K unspecified 'CRYSTAL STRUCTURE OF PPIL1 COMPLEXED WITH CYCLOSPORINE A' PDB 2Z6W unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN D IN COMPLEX WITH CYCLOSPORIN A' PDB 3BO7 unspecified 'CRYSTAL STRUCTURE OF CYCLOSPHILIN A FROM TOXOPLASMA GONDII COMPLEXED WIT CYCLOSPORIN A' PDB 3CYS unspecified 'SOLUTION STRUCTURE OF THE HUMAN CYCLOSPORIN A COMPLEXED WITH CYCLOSPORIN A' PDB 3EOV unspecified 'CRYSTAL STRUCTURE OF CYCLOPHILIN FROM LEISHMANIA DONOVANI COMPLEXED WITH CYCLOSPORIN A' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CWC _pdbx_database_status.recvd_initial_deposition_date 1995-09-06 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Mikol, V.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Improved Binding Affinity for Cyclophilin a by a Cyclosporin Derivative Singly Modified at its Effector Domain.' J.Med.Chem. 37 3674 ? 1994 JMCMAR US 0022-2623 0151 ? 7966126 10.1021/JM00048A002 1 'Crystallization of the Complex between Cyclophilin a and Cyclosporin Derivatives: The Use of Cross- Seeding.' 'Acta Crystallogr.,Sect.D' 50 543 ? 1994 ABCRE6 DK 0907-4449 0766 ? 15299416 10.1107/S0907444994001800 2 ;The X-Ray Structure of (Mebm2T)1-Cyclosporin Complexed with Cyclophilin a Provides an Explanation for its Anomalously High Immunosuppressive Activity. ; 'Protein Eng.' 7 597 ? 1994 PRENE9 UK 0269-2139 0859 ? 8073029 ? 3 'X-Ray Structure of a Monomeric Cyclophilin A- Cyclosporin a Crystal Complex at 2.1 A Resolution.' J.Mol.Biol. 234 1119 ? 1993 JMOBAK UK 0022-2836 0070 ? 8263916 10.1006/JMBI.1993.1664 4 'X-Ray Structure of a Decameric Cyclophilin- Cyclosporin Crystal Complex.' Nature 361 91 ? 1993 NATUAS UK 0028-0836 0006 ? 8421501 10.1038/361091A0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Papageorgiou, C.' 1 primary 'Florineth, A.' 2 primary 'Mikol, V.' 3 1 'Mikol, V.' 4 1 'Duc, D.' 5 2 'Mikol, V.' 6 2 'Kallen, J.' 7 2 'Walkinshaw, M.D.' 8 3 'Mikol, V.' 9 3 'Kallen, J.' 10 3 'Pflugl, G.' 11 3 'Walkinshaw, M.D.' 12 4 'Pflugl, G.' 13 4 'Kallen, J.' 14 4 'Schirmer, T.' 15 4 'Jansonius, J.N.' 16 4 'Zurini, M.G.' 17 4 'Walkinshaw, M.D.' 18 # _cell.entry_id 1CWC _cell.length_a 36.394 _cell.length_b 61.132 _cell.length_c 73.362 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1CWC _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A' 18036.504 1 5.2.1.8 ? ? ? 2 polymer syn 'CYCLOSPORIN A' 1234.652 1 ? YES ? '4, N-DIMETHYLNORLEUCINE AT POSITION 8' 3 water nat water 18.015 169 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'PPIASE, ROTAMASE, CYCLOPHILIN A' 2 'CYCLOSPORINE, CICLOSPORIN, CICLOSPORINE' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD CGQLE ; ;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD CGQLE ; A ? 2 'polypeptide(L)' no yes '(DAL)(MLE)(MLE)(MVA)(BMT)(ABA)(SAR)(MNL)V(MLE)A' ALLVTAGLVLA C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ASN n 1 4 PRO n 1 5 THR n 1 6 VAL n 1 7 PHE n 1 8 PHE n 1 9 ASP n 1 10 ILE n 1 11 ALA n 1 12 VAL n 1 13 ASP n 1 14 GLY n 1 15 GLU n 1 16 PRO n 1 17 LEU n 1 18 GLY n 1 19 ARG n 1 20 VAL n 1 21 SER n 1 22 PHE n 1 23 GLU n 1 24 LEU n 1 25 PHE n 1 26 ALA n 1 27 ASP n 1 28 LYS n 1 29 VAL n 1 30 PRO n 1 31 LYS n 1 32 THR n 1 33 ALA n 1 34 GLU n 1 35 ASN n 1 36 PHE n 1 37 ARG n 1 38 ALA n 1 39 LEU n 1 40 SER n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 LYS n 1 45 GLY n 1 46 PHE n 1 47 GLY n 1 48 TYR n 1 49 LYS n 1 50 GLY n 1 51 SER n 1 52 CYS n 1 53 PHE n 1 54 HIS n 1 55 ARG n 1 56 ILE n 1 57 ILE n 1 58 PRO n 1 59 GLY n 1 60 PHE n 1 61 MET n 1 62 CYS n 1 63 GLN n 1 64 GLY n 1 65 GLY n 1 66 ASP n 1 67 PHE n 1 68 THR n 1 69 ARG n 1 70 HIS n 1 71 ASN n 1 72 GLY n 1 73 THR n 1 74 GLY n 1 75 GLY n 1 76 LYS n 1 77 SER n 1 78 ILE n 1 79 TYR n 1 80 GLY n 1 81 GLU n 1 82 LYS n 1 83 PHE n 1 84 GLU n 1 85 ASP n 1 86 GLU n 1 87 ASN n 1 88 PHE n 1 89 ILE n 1 90 LEU n 1 91 LYS n 1 92 HIS n 1 93 THR n 1 94 GLY n 1 95 PRO n 1 96 GLY n 1 97 ILE n 1 98 LEU n 1 99 SER n 1 100 MET n 1 101 ALA n 1 102 ASN n 1 103 ALA n 1 104 GLY n 1 105 PRO n 1 106 ASN n 1 107 THR n 1 108 ASN n 1 109 GLY n 1 110 SER n 1 111 GLN n 1 112 PHE n 1 113 PHE n 1 114 ILE n 1 115 CYS n 1 116 THR n 1 117 ALA n 1 118 LYS n 1 119 THR n 1 120 GLU n 1 121 TRP n 1 122 LEU n 1 123 ASP n 1 124 GLY n 1 125 LYS n 1 126 HIS n 1 127 VAL n 1 128 VAL n 1 129 PHE n 1 130 GLY n 1 131 LYS n 1 132 VAL n 1 133 LYS n 1 134 GLU n 1 135 GLY n 1 136 MET n 1 137 ASN n 1 138 ILE n 1 139 VAL n 1 140 GLU n 1 141 ALA n 1 142 MET n 1 143 GLU n 1 144 ARG n 1 145 PHE n 1 146 GLY n 1 147 SER n 1 148 ARG n 1 149 ASN n 1 150 GLY n 1 151 LYS n 1 152 THR n 1 153 SER n 1 154 LYS n 1 155 LYS n 1 156 ILE n 1 157 THR n 1 158 ILE n 1 159 ALA n 1 160 ASP n 1 161 CYS n 1 162 GLY n 1 163 GLN n 1 164 LEU n 1 165 GLU n 2 1 DAL n 2 2 MLE n 2 3 MLE n 2 4 MVA n 2 5 BMT n 2 6 ABA n 2 7 SAR n 2 8 MNL n 2 9 VAL n 2 10 MLE n 2 11 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CYCLOPHILIN _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene CYCLOPHILIN _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'TOLYPOCLADIUM INFLATUM' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 29910 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP CYPH_HUMAN 1 ? ? P05092 ? 2 NOR NOR00033 2 ? ? NOR00033 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1CWC A 2 ? 165 ? P05092 1 ? 164 ? 2 165 2 2 1CWC C 1 ? 11 ? NOR00033 1 ? 11 ? 1 11 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 1CWC _struct_ref_seq_dif.mon_id MNL _struct_ref_seq_dif.pdbx_pdb_strand_id C _struct_ref_seq_dif.seq_num 8 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name NOR _struct_ref_seq_dif.pdbx_seq_db_accession_code NOR00033 _struct_ref_seq_dif.db_mon_id MLE _struct_ref_seq_dif.pdbx_seq_db_seq_num 8 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 8 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMT 'L-peptide linking' n '4-METHYL-4-[(E)-2-BUTENYL]-4,N-METHYL-THREONINE' ? 'C10 H19 N O3' 201.263 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DAL 'D-peptide linking' . D-ALANINE ? 'C3 H7 N O2' 89.093 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLE 'L-peptide linking' n N-METHYLLEUCINE ? 'C7 H15 N O2' 145.199 MNL 'L-peptide linking' n 4,N-DIMETHYLNORLEUCINE ? 'C8 H17 N O2' 159.226 MVA 'L-peptide linking' n N-METHYLVALINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAR 'peptide linking' n SARCOSINE ? 'C3 H7 N O2' 89.093 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1CWC _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_percent_sol 41.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1CWC _reflns.observed_criterion_sigma_I 2.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 10.000 _reflns.d_resolution_high 1.860 _reflns.number_obs 12126 _reflns.number_all ? _reflns.percent_possible_obs 86.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1CWC _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.00 _refine.ls_d_res_high 1.86 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.177 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.177 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1352 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 169 _refine_hist.number_atoms_total 1521 _refine_hist.d_res_high 1.86 _refine_hist.d_res_low 8.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.89 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1CWC _struct.title 'IMPROVED BINDING AFFINITY FOR CYCLOPHILIN A BY A CYCLOSPORIN DERIVATIVE SINGLY MODIFIED AT ITS EFFECTOR DOMAIN' _struct.pdbx_descriptor 'PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A (E.C.5.2.1.8), CYCLOSPORIN A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CWC _struct_keywords.pdbx_keywords ISOMERASE/IMMUNOSUPPRESSANT _struct_keywords.text 'ISOMERASE-IMMUNOSUPPRESSANT COMPLEX, CYCLOPHILIN-CYCLOSPORIN COMPLEX, CYCLOSPORIN A, IMMUNOSUPPRESSANT, CYCLOPHILIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 29 ? GLY A 42 ? VAL A 29 GLY A 42 1 ? 14 HELX_P HELX_P2 2 THR A 119 ? ASP A 123 ? THR A 119 ASP A 123 5 ? 5 HELX_P HELX_P3 3 GLY A 135 ? ARG A 144 ? GLY A 135 ARG A 144 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? B DAL 1 C ? ? ? 1_555 B MLE 2 N ? ? C DAL 1 C MLE 2 1_555 ? ? ? ? ? ? ? 1.334 ? covale2 covale ? ? B DAL 1 N ? ? ? 1_555 B ALA 11 C ? ? C DAL 1 C ALA 11 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale ? ? B MLE 2 C ? ? ? 1_555 B MLE 3 N ? ? C MLE 2 C MLE 3 1_555 ? ? ? ? ? ? ? 1.324 ? covale4 covale ? ? B MLE 3 C ? ? ? 1_555 B MVA 4 N ? ? C MLE 3 C MVA 4 1_555 ? ? ? ? ? ? ? 1.335 ? covale5 covale ? ? B MVA 4 C ? ? ? 1_555 B BMT 5 N ? ? C MVA 4 C BMT 5 1_555 ? ? ? ? ? ? ? 1.336 ? covale6 covale ? ? B BMT 5 C ? ? ? 1_555 B ABA 6 N ? ? C BMT 5 C ABA 6 1_555 ? ? ? ? ? ? ? 1.326 ? covale7 covale ? ? B ABA 6 C ? ? ? 1_555 B SAR 7 N ? ? C ABA 6 C SAR 7 1_555 ? ? ? ? ? ? ? 1.335 ? covale8 covale ? ? B SAR 7 C ? ? ? 1_555 B MNL 8 N ? ? C SAR 7 C MNL 8 1_555 ? ? ? ? ? ? ? 1.334 ? covale9 covale ? ? B MNL 8 C ? ? ? 1_555 B VAL 9 N ? ? C MNL 8 C VAL 9 1_555 ? ? ? ? ? ? ? 1.330 ? covale10 covale ? ? B VAL 9 C ? ? ? 1_555 B MLE 10 N ? ? C VAL 9 C MLE 10 1_555 ? ? ? ? ? ? ? 1.329 ? covale11 covale ? ? B MLE 10 C ? ? ? 1_555 B ALA 11 N ? ? C MLE 10 C ALA 11 1_555 ? ? ? ? ? ? ? 1.324 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel AA 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 PHE A 53 ? ILE A 57 ? PHE A 53 ILE A 57 AA 2 MET A 61 ? GLY A 64 ? MET A 61 GLY A 64 AA 3 PHE A 112 ? CYS A 115 ? PHE A 112 CYS A 115 AA 4 ILE A 97 ? MET A 100 ? ILE A 97 MET A 100 AA 5 VAL A 128 ? GLU A 134 ? VAL A 128 GLU A 134 AA 6 GLU A 15 ? LEU A 24 ? GLU A 15 LEU A 24 AA 7 THR A 5 ? VAL A 12 ? THR A 5 VAL A 12 AA 8 ILE A 156 ? GLU A 165 ? ILE A 156 GLU A 165 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 57 ? N ILE A 57 O MET A 61 ? O MET A 61 AA 2 3 N GLY A 64 ? N GLY A 64 O PHE A 112 ? O PHE A 112 AA 3 4 N CYS A 115 ? N CYS A 115 O ILE A 97 ? O ILE A 97 AA 4 5 O LEU A 98 ? O LEU A 98 N PHE A 129 ? N PHE A 129 AA 5 6 N LYS A 133 ? N LYS A 133 O SER A 21 ? O SER A 21 AA 6 7 N PHE A 22 ? N PHE A 22 O VAL A 6 ? O VAL A 6 AA 7 8 N ALA A 11 ? N ALA A 11 O THR A 157 ? O THR A 157 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 17 _struct_site.details 'BINDING SITE FOR CHAIN C OF CYCLOSPORIN A' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 ARG A 19 ? ARG A 19 . ? 1_555 ? 2 AC1 17 ARG A 55 ? ARG A 55 . ? 1_555 ? 3 AC1 17 PHE A 60 ? PHE A 60 . ? 1_555 ? 4 AC1 17 GLN A 63 ? GLN A 63 . ? 1_555 ? 5 AC1 17 GLY A 72 ? GLY A 72 . ? 1_555 ? 6 AC1 17 ALA A 101 ? ALA A 101 . ? 1_555 ? 7 AC1 17 ASN A 102 ? ASN A 102 . ? 1_555 ? 8 AC1 17 ALA A 103 ? ALA A 103 . ? 1_555 ? 9 AC1 17 GLN A 111 ? GLN A 111 . ? 1_555 ? 10 AC1 17 PHE A 113 ? PHE A 113 . ? 1_555 ? 11 AC1 17 TRP A 121 ? TRP A 121 . ? 1_555 ? 12 AC1 17 LEU A 122 ? LEU A 122 . ? 1_555 ? 13 AC1 17 HIS A 126 ? HIS A 126 . ? 1_555 ? 14 AC1 17 HOH C . ? HOH A 2117 . ? 1_555 ? 15 AC1 17 HOH D . ? HOH C 2005 . ? 1_555 ? 16 AC1 17 HOH D . ? HOH C 2006 . ? 1_555 ? 17 AC1 17 HOH D . ? HOH C 2007 . ? 1_555 ? # _database_PDB_matrix.entry_id 1CWC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CWC _atom_sites.fract_transf_matrix[1][1] 0.027477 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016358 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013631 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'VAL C 5 - LEU C 6 OMEGA = 359.98 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 TRP 121 121 121 TRP TRP A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLU 165 165 165 GLU GLU A . n B 2 1 DAL 1 1 1 DAL DAL C . n B 2 2 MLE 2 2 2 MLE MLE C . n B 2 3 MLE 3 3 3 MLE MLE C . n B 2 4 MVA 4 4 4 MVA MVA C . n B 2 5 BMT 5 5 5 BMT BMT C . n B 2 6 ABA 6 6 6 ABA ABA C . n B 2 7 SAR 7 7 7 SAR SAR C . n B 2 8 MNL 8 8 8 MNL MNL C . n B 2 9 VAL 9 9 9 VAL VAL C . n B 2 10 MLE 10 10 10 MLE MLE C . n B 2 11 ALA 11 11 11 ALA ALA C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . C 3 HOH 47 2047 2047 HOH HOH A . C 3 HOH 48 2048 2048 HOH HOH A . C 3 HOH 49 2049 2049 HOH HOH A . C 3 HOH 50 2050 2050 HOH HOH A . C 3 HOH 51 2051 2051 HOH HOH A . C 3 HOH 52 2052 2052 HOH HOH A . C 3 HOH 53 2053 2053 HOH HOH A . C 3 HOH 54 2054 2054 HOH HOH A . C 3 HOH 55 2055 2055 HOH HOH A . C 3 HOH 56 2056 2056 HOH HOH A . C 3 HOH 57 2057 2057 HOH HOH A . C 3 HOH 58 2058 2058 HOH HOH A . C 3 HOH 59 2059 2059 HOH HOH A . C 3 HOH 60 2060 2060 HOH HOH A . C 3 HOH 61 2061 2061 HOH HOH A . C 3 HOH 62 2062 2062 HOH HOH A . C 3 HOH 63 2063 2063 HOH HOH A . C 3 HOH 64 2064 2064 HOH HOH A . C 3 HOH 65 2065 2065 HOH HOH A . C 3 HOH 66 2066 2066 HOH HOH A . C 3 HOH 67 2067 2067 HOH HOH A . C 3 HOH 68 2068 2068 HOH HOH A . C 3 HOH 69 2069 2069 HOH HOH A . C 3 HOH 70 2070 2070 HOH HOH A . C 3 HOH 71 2071 2071 HOH HOH A . C 3 HOH 72 2072 2072 HOH HOH A . C 3 HOH 73 2073 2073 HOH HOH A . C 3 HOH 74 2074 2074 HOH HOH A . C 3 HOH 75 2075 2075 HOH HOH A . C 3 HOH 76 2076 2076 HOH HOH A . C 3 HOH 77 2077 2077 HOH HOH A . C 3 HOH 78 2078 2078 HOH HOH A . C 3 HOH 79 2079 2079 HOH HOH A . C 3 HOH 80 2080 2080 HOH HOH A . C 3 HOH 81 2081 2081 HOH HOH A . C 3 HOH 82 2082 2082 HOH HOH A . C 3 HOH 83 2083 2083 HOH HOH A . C 3 HOH 84 2084 2084 HOH HOH A . C 3 HOH 85 2085 2085 HOH HOH A . C 3 HOH 86 2086 2086 HOH HOH A . C 3 HOH 87 2087 2087 HOH HOH A . C 3 HOH 88 2088 2088 HOH HOH A . C 3 HOH 89 2089 2089 HOH HOH A . C 3 HOH 90 2090 2090 HOH HOH A . C 3 HOH 91 2091 2091 HOH HOH A . C 3 HOH 92 2092 2092 HOH HOH A . C 3 HOH 93 2093 2093 HOH HOH A . C 3 HOH 94 2094 2094 HOH HOH A . C 3 HOH 95 2095 2095 HOH HOH A . C 3 HOH 96 2096 2096 HOH HOH A . C 3 HOH 97 2097 2097 HOH HOH A . C 3 HOH 98 2098 2098 HOH HOH A . C 3 HOH 99 2099 2099 HOH HOH A . C 3 HOH 100 2100 2100 HOH HOH A . C 3 HOH 101 2101 2101 HOH HOH A . C 3 HOH 102 2102 2102 HOH HOH A . C 3 HOH 103 2103 2103 HOH HOH A . C 3 HOH 104 2104 2104 HOH HOH A . C 3 HOH 105 2105 2105 HOH HOH A . C 3 HOH 106 2106 2106 HOH HOH A . C 3 HOH 107 2107 2107 HOH HOH A . C 3 HOH 108 2108 2108 HOH HOH A . C 3 HOH 109 2109 2109 HOH HOH A . C 3 HOH 110 2110 2110 HOH HOH A . C 3 HOH 111 2111 2111 HOH HOH A . C 3 HOH 112 2112 2112 HOH HOH A . C 3 HOH 113 2113 2113 HOH HOH A . C 3 HOH 114 2114 2114 HOH HOH A . C 3 HOH 115 2115 2115 HOH HOH A . C 3 HOH 116 2116 2116 HOH HOH A . C 3 HOH 117 2117 2117 HOH HOH A . C 3 HOH 118 2118 2118 HOH HOH A . C 3 HOH 119 2119 2119 HOH HOH A . C 3 HOH 120 2120 2120 HOH HOH A . C 3 HOH 121 2121 2121 HOH HOH A . C 3 HOH 122 2122 2122 HOH HOH A . C 3 HOH 123 2123 2123 HOH HOH A . C 3 HOH 124 2124 2124 HOH HOH A . C 3 HOH 125 2125 2125 HOH HOH A . C 3 HOH 126 2126 2126 HOH HOH A . C 3 HOH 127 2127 2127 HOH HOH A . C 3 HOH 128 2128 2128 HOH HOH A . C 3 HOH 129 2129 2129 HOH HOH A . C 3 HOH 130 2130 2130 HOH HOH A . C 3 HOH 131 2131 2131 HOH HOH A . C 3 HOH 132 2132 2132 HOH HOH A . C 3 HOH 133 2133 2133 HOH HOH A . C 3 HOH 134 2134 2134 HOH HOH A . C 3 HOH 135 2135 2135 HOH HOH A . C 3 HOH 136 2136 2136 HOH HOH A . C 3 HOH 137 2137 2137 HOH HOH A . C 3 HOH 138 2138 2138 HOH HOH A . C 3 HOH 139 2139 2139 HOH HOH A . C 3 HOH 140 2140 2140 HOH HOH A . C 3 HOH 141 2141 2141 HOH HOH A . C 3 HOH 142 2142 2142 HOH HOH A . C 3 HOH 143 2143 2143 HOH HOH A . C 3 HOH 144 2144 2144 HOH HOH A . C 3 HOH 145 2145 2145 HOH HOH A . C 3 HOH 146 2146 2146 HOH HOH A . C 3 HOH 147 2147 2147 HOH HOH A . C 3 HOH 148 2148 2148 HOH HOH A . C 3 HOH 149 2149 2149 HOH HOH A . C 3 HOH 150 2150 2150 HOH HOH A . C 3 HOH 151 2151 2151 HOH HOH A . C 3 HOH 152 2152 2152 HOH HOH A . C 3 HOH 153 2153 2153 HOH HOH A . C 3 HOH 154 2154 2154 HOH HOH A . C 3 HOH 155 2155 2155 HOH HOH A . C 3 HOH 156 2156 2156 HOH HOH A . C 3 HOH 157 2157 2157 HOH HOH A . C 3 HOH 158 2158 2158 HOH HOH A . C 3 HOH 159 2159 2159 HOH HOH A . C 3 HOH 160 2160 2160 HOH HOH A . C 3 HOH 161 2161 2161 HOH HOH A . C 3 HOH 162 2162 2162 HOH HOH A . D 3 HOH 1 2001 2001 HOH HOH C . D 3 HOH 2 2002 2002 HOH HOH C . D 3 HOH 3 2003 2003 HOH HOH C . D 3 HOH 4 2004 2004 HOH HOH C . D 3 HOH 5 2005 2005 HOH HOH C . D 3 HOH 6 2006 2006 HOH HOH C . D 3 HOH 7 2007 2007 HOH HOH C . # _pdbx_molecule_features.prd_id PRD_001108 _pdbx_molecule_features.name 'Cyclosporin A variant, MLE 8 to MNL' _pdbx_molecule_features.type 'Cyclic peptide' _pdbx_molecule_features.class Immunosuppressant _pdbx_molecule_features.details ;CYCLOSPORIN IS A CYCLIC UNDECAPEPTIDE. CYCLIZATION IS ACHIEVED BY LINKING THE N- AND THE C- TERMINI. THE CYCLOSPORIN MOLECULE WAS MODIFIED AT POSITION 8 TO BE 4,N-DIMETHYLNORLEUCINE. ; # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_001108 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1020 ? 1 MORE -8.0 ? 1 'SSA (A^2)' 7780 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-01-29 2 'Structure model' 1 1 2011-06-14 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-07-27 5 'Structure model' 1 4 2012-12-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Non-polymer description' 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' Other # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _pdbx_entry_details.entry_id 1CWC _pdbx_entry_details.compound_details ;CYCLOSPORIN IS A CYCLIC UNDECAPEPTIDE. HERE, CYCLOSPORIN A IS REPRESENTED BY THE SEQUENCE (SEQRES) ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 N _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 MET _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 2001 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.02 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 60 ? ? -125.59 -72.19 2 1 MLE C 2 ? ? -119.07 73.25 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id MLE _pdbx_validate_main_chain_plane.auth_asym_id C _pdbx_validate_main_chain_plane.auth_seq_id 10 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 12.73 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #