data_1CZ4 # _entry.id 1CZ4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1CZ4 pdb_00001cz4 10.2210/pdb1cz4/pdb RCSB RCSB009634 ? ? WWPDB D_1000009634 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1CZ5 'ENSEMBLE OF 25 NMR STRUCTURES' unspecified BMRB 4376 'CHEMICAL SHIFTS, 3JHNHA COUPLING-CONSTANTS AND HET. NOE VALUES' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CZ4 _pdbx_database_status.recvd_initial_deposition_date 1999-09-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Coles, M.' 1 'Diercks, T.' 2 'Liermann, J.' 3 'Groeger, A.' 4 'Rockel, B.' 5 'Baumeister, W.' 6 'Koretke, K.' 7 'Lupas, A.' 8 'Peters, J.' 9 'Kessler, H.' 10 # _citation.id primary _citation.title ;The solution structure of VAT-N reveals a 'missing link' in the evolution of complex enzymes from a simple betaalphabetabeta element. ; _citation.journal_abbrev Curr.Biol. _citation.journal_volume 9 _citation.page_first 1158 _citation.page_last 1168 _citation.year 1999 _citation.journal_id_ASTM CUBLE2 _citation.country UK _citation.journal_id_ISSN 0960-9822 _citation.journal_id_CSD 2060 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10531028 _citation.pdbx_database_id_DOI '10.1016/S0960-9822(00)80017-2' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Coles, M.' 1 ? primary 'Diercks, T.' 2 ? primary 'Liermann, J.' 3 ? primary 'Groger, A.' 4 ? primary 'Rockel, B.' 5 ? primary 'Baumeister, W.' 6 ? primary 'Koretke, K.K.' 7 ? primary 'Lupas, A.' 8 ? primary 'Peters, J.' 9 ? primary 'Kessler, H.' 10 ? # _cell.entry_id 1CZ4 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CZ4 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'VCP-LIKE ATPASE' _entity.formula_weight 20649.816 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL DOMAIN: M1 TO E183 FOLLOWED BY A DIGLYCINE SPACER' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGAS IGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKV PVEIGEETKIEIREEPASEVLEEGG ; _entity_poly.pdbx_seq_one_letter_code_can ;MESNNGIILRVAEANSTDPGMSRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGAS IGDKVKVRKVRTEIAKKVTLAPIIRKDQRLKFGEGIEEYVQRALIRRPMLEQDNISVPGLTLAGQTGLLFKVVKTLPSKV PVEIGEETKIEIREEPASEVLEEGG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 SER n 1 4 ASN n 1 5 ASN n 1 6 GLY n 1 7 ILE n 1 8 ILE n 1 9 LEU n 1 10 ARG n 1 11 VAL n 1 12 ALA n 1 13 GLU n 1 14 ALA n 1 15 ASN n 1 16 SER n 1 17 THR n 1 18 ASP n 1 19 PRO n 1 20 GLY n 1 21 MET n 1 22 SER n 1 23 ARG n 1 24 VAL n 1 25 ARG n 1 26 LEU n 1 27 ASP n 1 28 GLU n 1 29 SER n 1 30 SER n 1 31 ARG n 1 32 ARG n 1 33 LEU n 1 34 LEU n 1 35 ASP n 1 36 ALA n 1 37 GLU n 1 38 ILE n 1 39 GLY n 1 40 ASP n 1 41 VAL n 1 42 VAL n 1 43 GLU n 1 44 ILE n 1 45 GLU n 1 46 LYS n 1 47 VAL n 1 48 ARG n 1 49 LYS n 1 50 THR n 1 51 VAL n 1 52 GLY n 1 53 ARG n 1 54 VAL n 1 55 TYR n 1 56 ARG n 1 57 ALA n 1 58 ARG n 1 59 PRO n 1 60 GLU n 1 61 ASP n 1 62 GLU n 1 63 ASN n 1 64 LYS n 1 65 GLY n 1 66 ILE n 1 67 VAL n 1 68 ARG n 1 69 ILE n 1 70 ASP n 1 71 SER n 1 72 VAL n 1 73 MET n 1 74 ARG n 1 75 ASN n 1 76 ASN n 1 77 CYS n 1 78 GLY n 1 79 ALA n 1 80 SER n 1 81 ILE n 1 82 GLY n 1 83 ASP n 1 84 LYS n 1 85 VAL n 1 86 LYS n 1 87 VAL n 1 88 ARG n 1 89 LYS n 1 90 VAL n 1 91 ARG n 1 92 THR n 1 93 GLU n 1 94 ILE n 1 95 ALA n 1 96 LYS n 1 97 LYS n 1 98 VAL n 1 99 THR n 1 100 LEU n 1 101 ALA n 1 102 PRO n 1 103 ILE n 1 104 ILE n 1 105 ARG n 1 106 LYS n 1 107 ASP n 1 108 GLN n 1 109 ARG n 1 110 LEU n 1 111 LYS n 1 112 PHE n 1 113 GLY n 1 114 GLU n 1 115 GLY n 1 116 ILE n 1 117 GLU n 1 118 GLU n 1 119 TYR n 1 120 VAL n 1 121 GLN n 1 122 ARG n 1 123 ALA n 1 124 LEU n 1 125 ILE n 1 126 ARG n 1 127 ARG n 1 128 PRO n 1 129 MET n 1 130 LEU n 1 131 GLU n 1 132 GLN n 1 133 ASP n 1 134 ASN n 1 135 ILE n 1 136 SER n 1 137 VAL n 1 138 PRO n 1 139 GLY n 1 140 LEU n 1 141 THR n 1 142 LEU n 1 143 ALA n 1 144 GLY n 1 145 GLN n 1 146 THR n 1 147 GLY n 1 148 LEU n 1 149 LEU n 1 150 PHE n 1 151 LYS n 1 152 VAL n 1 153 VAL n 1 154 LYS n 1 155 THR n 1 156 LEU n 1 157 PRO n 1 158 SER n 1 159 LYS n 1 160 VAL n 1 161 PRO n 1 162 VAL n 1 163 GLU n 1 164 ILE n 1 165 GLY n 1 166 GLU n 1 167 GLU n 1 168 THR n 1 169 LYS n 1 170 ILE n 1 171 GLU n 1 172 ILE n 1 173 ARG n 1 174 GLU n 1 175 GLU n 1 176 PRO n 1 177 ALA n 1 178 SER n 1 179 GLU n 1 180 VAL n 1 181 LEU n 1 182 GLU n 1 183 GLU n 1 184 GLY n 1 185 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermoplasma _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2303 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VAT_THEAC _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession O05209 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CZ4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O05209 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1CZ4 GLY A 184 ? UNP O05209 VAL 184 'SEE REMARK 999' 184 1 1 1CZ4 GLY A 185 ? UNP O05209 SER 185 'SEE REMARK 999' 185 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-SEPARATED_NOESY 1 2 1 3D_CNH-NOESY 1 3 1 3D_NCH-NOESY 1 4 1 3D_CCH-NOESY 1 5 1 3D_15N-SEPARATED_NOESY 2 6 1 3D_NNH-NOESY 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 320 AMBIENT 5.9 '80 mM' ? K 2 320 AMBIENT 5.9 '80 mM' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.4 MM VAT-NU-15N,13C; 40 MM PHOSPHATE BUFFER NA; 90% H2O, 10% D2O' ? 2 '1.2 MM VAT-N U-15N; 40 MM PHOSPHATE BUFFER NA; 90% H2O, 10% D2O' ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 750 ? 2 DMX Bruker 600 ? # _pdbx_nmr_refine.entry_id 1CZ4 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;STRUCTURES BASED ON 1923 DISTANCE RESTRAINTS; 1817 NOE BASED RESTRAINTS, 196 DIHEDRAL ANGLE RESTRAINTS, 56 J-COUPLING RESTRAINTS, 106 DISTANCE RESTRAINTS FOR H-BONDS, 158 CA AND 148 CB CHEMICAL SHIFT RESTRAINTS. REFINED WITH A CONFORMATIONAL DATABASE POTENTIAL ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1CZ4 _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY. 3JHNHA COUPLING-CONSTANTS FROM AN HNHA SPECTRUM' # _pdbx_nmr_ensemble.entry_id 1CZ4 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1CZ4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.5 BRUKER 1 processing XwinNMR 2.5 BRUKER 2 'data analysis' AURELIA 2.5.11 BRUKER 3 'structure solution' X-PLOR 3.851 BRUNGER 4 refinement X-PLOR 3.851 BRUNGER 5 # _exptl.entry_id 1CZ4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1CZ4 _struct.title 'NMR STRUCTURE OF VAT-N: THE N-TERMINAL DOMAIN OF VAT (VCP-LIKE ATPASE OF THERMOPLASMA)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CZ4 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'DOUBLE-PSI BETA-BARREL, BETA-CLAM, SUBSTRATE RECOGNITION DOMAIN, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 27 ? LEU A 33 ? ASP A 27 LEU A 33 1 ? 7 HELX_P HELX_P2 2 ASP A 70 ? GLY A 78 ? ASP A 70 GLY A 78 1 ? 9 HELX_P HELX_P3 3 GLY A 115 ? ILE A 125 ? GLY A 115 ILE A 125 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 4 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 6 ? ALA A 12 ? GLY A 6 ALA A 12 A 2 ILE A 66 ? ARG A 68 ? ILE A 66 ARG A 68 A 3 GLY A 6 ? ALA A 12 ? GLY A 6 ALA A 12 A 4 LYS A 84 ? VAL A 90 ? LYS A 84 VAL A 90 A 5 VAL A 41 ? GLU A 45 ? VAL A 41 GLU A 45 A 6 LYS A 49 ? ARG A 56 ? LYS A 49 ARG A 56 A 7 ARG A 23 ? LEU A 26 ? ARG A 23 LEU A 26 B 1 ASN A 134 ? ILE A 135 ? ASN A 134 ILE A 135 B 2 LEU A 149 ? THR A 155 ? LEU A 149 THR A 155 B 3 LYS A 97 ? ILE A 103 ? LYS A 97 ILE A 103 B 4 LYS A 169 ? ILE A 172 ? LYS A 169 ILE A 172 C 1 PRO A 128 ? MET A 129 ? PRO A 128 MET A 129 C 2 VAL A 162 ? GLU A 163 ? VAL A 162 GLU A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 12 ? N ALA A 12 O VAL A 67 ? O VAL A 67 A 2 3 N VAL A 67 ? N VAL A 67 O ARG A 10 ? O ARG A 10 A 3 4 N LEU A 9 ? N LEU A 9 O VAL A 85 ? O VAL A 85 A 4 5 N VAL A 90 ? N VAL A 90 O VAL A 41 ? O VAL A 41 A 5 6 O ILE A 44 ? O ILE A 44 N THR A 50 ? N THR A 50 A 6 7 N TYR A 55 ? N TYR A 55 O VAL A 24 ? O VAL A 24 B 1 2 N ILE A 135 ? N ILE A 135 O PHE A 150 ? O PHE A 150 B 2 3 O LYS A 154 ? O LYS A 154 N THR A 99 ? N THR A 99 B 3 4 N VAL A 98 ? N VAL A 98 O LYS A 169 ? O LYS A 169 C 1 2 N MET A 129 ? N MET A 129 O VAL A 162 ? O VAL A 162 # _database_PDB_matrix.entry_id 1CZ4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CZ4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 PRO 161 161 161 PRO PRO A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 GLY 185 185 185 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-10-12 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A SER 80 ? ? OD2 A ASP 83 ? ? 1.46 2 1 O A LYS 96 ? ? H A LYS 169 ? ? 1.47 3 1 OD1 A ASP 27 ? ? H A SER 30 ? ? 1.49 4 1 H A GLU 37 ? ? OD2 A ASP 40 ? ? 1.54 5 1 O A GLU 93 ? ? H A GLU 163 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 13 ? ? -176.43 148.45 2 1 ASP A 18 ? ? 36.43 59.97 3 1 LEU A 34 ? ? -105.23 -74.05 4 1 ASP A 35 ? ? -170.17 -24.56 5 1 ALA A 36 ? ? -24.57 119.19 6 1 LYS A 46 ? ? -98.39 -67.35 7 1 GLU A 60 ? ? -73.53 34.38 8 1 ASP A 61 ? ? -146.25 -27.57 9 1 ASN A 63 ? ? -81.79 43.60 10 1 ASP A 83 ? ? -57.29 -167.57 11 1 ARG A 105 ? ? -140.62 -135.54 12 1 LEU A 110 ? ? -99.25 52.26 13 1 PHE A 112 ? ? -142.77 -40.06 14 1 GLU A 114 ? ? 41.48 94.45 15 1 ILE A 125 ? ? -47.31 166.65 16 1 ARG A 126 ? ? 33.07 46.68 17 1 GLN A 132 ? ? 73.84 -0.48 18 1 ASP A 133 ? ? -69.97 -176.22 19 1 PRO A 138 ? ? -46.53 177.87 20 1 THR A 141 ? ? 176.97 -167.50 21 1 LEU A 142 ? ? -146.06 -122.84 22 1 ALA A 143 ? ? -52.81 -161.19 23 1 PRO A 157 ? ? -53.07 -174.09 24 1 SER A 158 ? ? -86.83 41.50 25 1 PRO A 176 ? ? -71.88 -156.43 #