data_1D1N # _entry.id 1D1N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1D1N pdb_00001d1n 10.2210/pdb1d1n/pdb RCSB RCSB009712 ? ? WWPDB D_1000009712 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-20 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1D1N _pdbx_database_status.recvd_initial_deposition_date 1999-09-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Meunier, S.' 1 'Spurio, S.' 2 'Czisch, M.' 3 'Wechselberger, R.' 4 'Gueunneugues, M.' 5 # _citation.id primary _citation.title 'Structure of the fMet-tRNA(fMet)-binding domain of B. stearothermophilus initiation factor IF2.' _citation.journal_abbrev 'EMBO J.' _citation.journal_volume 19 _citation.page_first 1918 _citation.page_last 1926 _citation.year 2000 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10775275 _citation.pdbx_database_id_DOI 10.1093/emboj/19.8.1918 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Meunier, S.' 1 ? primary 'Spurio, R.' 2 ? primary 'Czisch, M.' 3 ? primary 'Wechselberger, R.' 4 ? primary 'Guenneugues, M.' 5 ? primary 'Gualerzi, C.O.' 6 ? primary 'Boelens, R.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'INITIATION FACTOR 2' _entity.formula_weight 11210.744 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C2 TERMINAL DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;YEEKVIGQAEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGIVVYEGEIDSLKRYKDDVREVAQGYECGLTIKNFN DIKEGDVIEAYVMQEVARA ; _entity_poly.pdbx_seq_one_letter_code_can ;YEEKVIGQAEVRQTFKVSKVGTIAGCYVTDGKITRDSKVRLIRQGIVVYEGEIDSLKRYKDDVREVAQGYECGLTIKNFN DIKEGDVIEAYVMQEVARA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 GLU n 1 3 GLU n 1 4 LYS n 1 5 VAL n 1 6 ILE n 1 7 GLY n 1 8 GLN n 1 9 ALA n 1 10 GLU n 1 11 VAL n 1 12 ARG n 1 13 GLN n 1 14 THR n 1 15 PHE n 1 16 LYS n 1 17 VAL n 1 18 SER n 1 19 LYS n 1 20 VAL n 1 21 GLY n 1 22 THR n 1 23 ILE n 1 24 ALA n 1 25 GLY n 1 26 CYS n 1 27 TYR n 1 28 VAL n 1 29 THR n 1 30 ASP n 1 31 GLY n 1 32 LYS n 1 33 ILE n 1 34 THR n 1 35 ARG n 1 36 ASP n 1 37 SER n 1 38 LYS n 1 39 VAL n 1 40 ARG n 1 41 LEU n 1 42 ILE n 1 43 ARG n 1 44 GLN n 1 45 GLY n 1 46 ILE n 1 47 VAL n 1 48 VAL n 1 49 TYR n 1 50 GLU n 1 51 GLY n 1 52 GLU n 1 53 ILE n 1 54 ASP n 1 55 SER n 1 56 LEU n 1 57 LYS n 1 58 ARG n 1 59 TYR n 1 60 LYS n 1 61 ASP n 1 62 ASP n 1 63 VAL n 1 64 ARG n 1 65 GLU n 1 66 VAL n 1 67 ALA n 1 68 GLN n 1 69 GLY n 1 70 TYR n 1 71 GLU n 1 72 CYS n 1 73 GLY n 1 74 LEU n 1 75 THR n 1 76 ILE n 1 77 LYS n 1 78 ASN n 1 79 PHE n 1 80 ASN n 1 81 ASP n 1 82 ILE n 1 83 LYS n 1 84 GLU n 1 85 GLY n 1 86 ASP n 1 87 VAL n 1 88 ILE n 1 89 GLU n 1 90 ALA n 1 91 TYR n 1 92 VAL n 1 93 MET n 1 94 GLN n 1 95 GLU n 1 96 VAL n 1 97 ALA n 1 98 ARG n 1 99 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Geobacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus stearothermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1422 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PXP401C-2 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 143 143 TYR TYR A . n A 1 2 GLU 2 144 144 GLU GLU A . n A 1 3 GLU 3 145 145 GLU GLU A . n A 1 4 LYS 4 146 146 LYS LYS A . n A 1 5 VAL 5 147 147 VAL VAL A . n A 1 6 ILE 6 148 148 ILE ILE A . n A 1 7 GLY 7 149 149 GLY GLY A . n A 1 8 GLN 8 150 150 GLN GLN A . n A 1 9 ALA 9 151 151 ALA ALA A . n A 1 10 GLU 10 152 152 GLU GLU A . n A 1 11 VAL 11 153 153 VAL VAL A . n A 1 12 ARG 12 154 154 ARG ARG A . n A 1 13 GLN 13 155 155 GLN GLN A . n A 1 14 THR 14 156 156 THR THR A . n A 1 15 PHE 15 157 157 PHE PHE A . n A 1 16 LYS 16 158 158 LYS LYS A . n A 1 17 VAL 17 159 159 VAL VAL A . n A 1 18 SER 18 160 160 SER SER A . n A 1 19 LYS 19 161 161 LYS LYS A . n A 1 20 VAL 20 162 162 VAL VAL A . n A 1 21 GLY 21 163 163 GLY GLY A . n A 1 22 THR 22 164 164 THR THR A . n A 1 23 ILE 23 165 165 ILE ILE A . n A 1 24 ALA 24 166 166 ALA ALA A . n A 1 25 GLY 25 167 167 GLY GLY A . n A 1 26 CYS 26 168 168 CYS CYS A . n A 1 27 TYR 27 169 169 TYR TYR A . n A 1 28 VAL 28 170 170 VAL VAL A . n A 1 29 THR 29 171 171 THR THR A . n A 1 30 ASP 30 172 172 ASP ASP A . n A 1 31 GLY 31 173 173 GLY GLY A . n A 1 32 LYS 32 174 174 LYS LYS A . n A 1 33 ILE 33 175 175 ILE ILE A . n A 1 34 THR 34 176 176 THR THR A . n A 1 35 ARG 35 177 177 ARG ARG A . n A 1 36 ASP 36 178 178 ASP ASP A . n A 1 37 SER 37 179 179 SER SER A . n A 1 38 LYS 38 180 180 LYS LYS A . n A 1 39 VAL 39 181 181 VAL VAL A . n A 1 40 ARG 40 182 182 ARG ARG A . n A 1 41 LEU 41 183 183 LEU LEU A . n A 1 42 ILE 42 184 184 ILE ILE A . n A 1 43 ARG 43 185 185 ARG ARG A . n A 1 44 GLN 44 186 186 GLN GLN A . n A 1 45 GLY 45 187 187 GLY GLY A . n A 1 46 ILE 46 188 188 ILE ILE A . n A 1 47 VAL 47 189 189 VAL VAL A . n A 1 48 VAL 48 190 190 VAL VAL A . n A 1 49 TYR 49 191 191 TYR TYR A . n A 1 50 GLU 50 192 192 GLU GLU A . n A 1 51 GLY 51 193 193 GLY GLY A . n A 1 52 GLU 52 194 194 GLU GLU A . n A 1 53 ILE 53 195 195 ILE ILE A . n A 1 54 ASP 54 196 196 ASP ASP A . n A 1 55 SER 55 197 197 SER SER A . n A 1 56 LEU 56 198 198 LEU LEU A . n A 1 57 LYS 57 199 199 LYS LYS A . n A 1 58 ARG 58 200 200 ARG ARG A . n A 1 59 TYR 59 201 201 TYR TYR A . n A 1 60 LYS 60 202 202 LYS LYS A . n A 1 61 ASP 61 203 203 ASP ASP A . n A 1 62 ASP 62 204 204 ASP ASP A . n A 1 63 VAL 63 205 205 VAL VAL A . n A 1 64 ARG 64 206 206 ARG ARG A . n A 1 65 GLU 65 207 207 GLU GLU A . n A 1 66 VAL 66 208 208 VAL VAL A . n A 1 67 ALA 67 209 209 ALA ALA A . n A 1 68 GLN 68 210 210 GLN GLN A . n A 1 69 GLY 69 211 211 GLY GLY A . n A 1 70 TYR 70 212 212 TYR TYR A . n A 1 71 GLU 71 213 213 GLU GLU A . n A 1 72 CYS 72 214 214 CYS CYS A . n A 1 73 GLY 73 215 215 GLY GLY A . n A 1 74 LEU 74 216 216 LEU LEU A . n A 1 75 THR 75 217 217 THR THR A . n A 1 76 ILE 76 218 218 ILE ILE A . n A 1 77 LYS 77 219 219 LYS LYS A . n A 1 78 ASN 78 220 220 ASN ASN A . n A 1 79 PHE 79 221 221 PHE PHE A . n A 1 80 ASN 80 222 222 ASN ASN A . n A 1 81 ASP 81 223 223 ASP ASP A . n A 1 82 ILE 82 224 224 ILE ILE A . n A 1 83 LYS 83 225 225 LYS LYS A . n A 1 84 GLU 84 226 226 GLU GLU A . n A 1 85 GLY 85 227 227 GLY GLY A . n A 1 86 ASP 86 228 228 ASP ASP A . n A 1 87 VAL 87 229 229 VAL VAL A . n A 1 88 ILE 88 230 230 ILE ILE A . n A 1 89 GLU 89 231 231 GLU GLU A . n A 1 90 ALA 90 232 232 ALA ALA A . n A 1 91 TYR 91 233 233 TYR TYR A . n A 1 92 VAL 92 234 234 VAL VAL A . n A 1 93 MET 93 235 235 MET MET A . n A 1 94 GLN 94 236 236 GLN GLN A . n A 1 95 GLU 95 237 237 GLU GLU A . n A 1 96 VAL 96 238 238 VAL VAL A . n A 1 97 ALA 97 239 239 ALA ALA A . n A 1 98 ARG 98 240 240 ARG ARG A . n A 1 99 ALA 99 241 241 ALA ALA A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ALA 241 ? O ? A ALA 99 O 2 2 Y 1 A ALA 241 ? O ? A ALA 99 O 3 3 Y 1 A ALA 241 ? O ? A ALA 99 O 4 4 Y 1 A ALA 241 ? O ? A ALA 99 O 5 5 Y 1 A ALA 241 ? O ? A ALA 99 O 6 6 Y 1 A ALA 241 ? O ? A ALA 99 O 7 7 Y 1 A ALA 241 ? O ? A ALA 99 O 8 8 Y 1 A ALA 241 ? O ? A ALA 99 O 9 9 Y 1 A ALA 241 ? O ? A ALA 99 O 10 10 Y 1 A ALA 241 ? O ? A ALA 99 O 11 11 Y 1 A ALA 241 ? O ? A ALA 99 O 12 12 Y 1 A ALA 241 ? O ? A ALA 99 O 13 13 Y 1 A ALA 241 ? O ? A ALA 99 O 14 14 Y 1 A ALA 241 ? O ? A ALA 99 O 15 15 Y 1 A ALA 241 ? O ? A ALA 99 O 16 16 Y 1 A ALA 241 ? O ? A ALA 99 O 17 17 Y 1 A ALA 241 ? O ? A ALA 99 O 18 18 Y 1 A ALA 241 ? O ? A ALA 99 O 19 19 Y 1 A ALA 241 ? O ? A ALA 99 O 20 20 Y 1 A ALA 241 ? O ? A ALA 99 O # _cell.entry_id 1D1N _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1D1N _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1D1N _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1D1N _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1D1N _struct.title 'SOLUTION STRUCTURE OF THE FMET-TRNAFMET BINDING DOMAIN OF BECILLUS STEAROTHERMOPHILLUS TRANSLATION INITIATION FACTOR IF2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1D1N _struct_keywords.pdbx_keywords 'GENE REGULATION' _struct_keywords.text 'BETA-BARREL, GENE REGULATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IF2_BACST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04766 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1D1N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04766 _struct_ref_seq.db_align_beg 643 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 741 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 143 _struct_ref_seq.pdbx_auth_seq_align_end 241 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 55 ? LYS A 57 ? SER A 197 LYS A 199 A 2 GLU A 71 ? THR A 75 ? GLU A 213 THR A 217 A 3 ALA A 24 ? VAL A 28 ? ALA A 166 VAL A 170 A 4 VAL A 5 ? VAL A 11 ? VAL A 147 VAL A 153 A 5 VAL A 87 ? TYR A 91 ? VAL A 229 TYR A 233 B 1 LYS A 38 ? ILE A 42 ? LYS A 180 ILE A 184 B 2 VAL A 47 ? GLU A 52 ? VAL A 189 GLU A 194 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 57 ? N LYS A 199 O GLY A 73 ? O GLY A 215 A 2 3 N LEU A 74 ? N LEU A 216 O ALA A 24 ? O ALA A 166 A 3 4 N TYR A 27 ? N TYR A 169 O GLU A 10 ? O GLU A 152 A 4 5 N ALA A 9 ? N ALA A 151 O ILE A 88 ? O ILE A 230 B 1 2 O LEU A 41 ? O LEU A 183 N VAL A 48 ? N VAL A 190 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A ARG 154 ? ? O A GLY 167 ? ? 1.59 2 2 H A ARG 154 ? ? O A GLY 167 ? ? 1.58 3 2 O A GLU 152 ? ? H A TYR 169 ? ? 1.60 4 2 OG1 A THR 156 ? ? H A LYS 225 ? ? 1.60 5 3 H A ARG 154 ? ? O A GLY 167 ? ? 1.59 6 4 H A ARG 154 ? ? O A GLY 167 ? ? 1.55 7 5 O A GLU 152 ? ? H A TYR 169 ? ? 1.58 8 6 H A ARG 154 ? ? O A GLY 167 ? ? 1.58 9 6 O A ILE 148 ? ? H A LYS 174 ? ? 1.59 10 7 H A ARG 154 ? ? O A GLY 167 ? ? 1.55 11 7 H A ASP 196 ? ? O A THR 217 ? ? 1.59 12 8 H A ARG 154 ? ? O A GLY 167 ? ? 1.49 13 8 OG1 A THR 156 ? ? H A LYS 225 ? ? 1.54 14 9 OG1 A THR 156 ? ? H A LYS 225 ? ? 1.57 15 9 H A ARG 154 ? ? O A GLY 167 ? ? 1.58 16 10 H A ASP 196 ? ? O A THR 217 ? ? 1.58 17 10 O A GLU 152 ? ? H A TYR 169 ? ? 1.59 18 10 OG1 A THR 156 ? ? H A LYS 225 ? ? 1.59 19 10 H A ARG 154 ? ? O A GLY 167 ? ? 1.59 20 11 H A ARG 154 ? ? O A GLY 167 ? ? 1.51 21 13 O A GLU 152 ? ? H A TYR 169 ? ? 1.59 22 13 OG1 A THR 156 ? ? H A LYS 225 ? ? 1.59 23 13 H A ARG 154 ? ? O A GLY 167 ? ? 1.59 24 14 OG1 A THR 156 ? ? H A LYS 225 ? ? 1.55 25 14 H A ARG 154 ? ? O A GLY 167 ? ? 1.59 26 14 O A GLU 152 ? ? H A TYR 169 ? ? 1.59 27 15 OG1 A THR 156 ? ? H A LYS 225 ? ? 1.52 28 16 OG1 A THR 156 ? ? H A LYS 225 ? ? 1.56 29 17 H A ARG 154 ? ? O A GLY 167 ? ? 1.54 30 18 O A ILE 148 ? ? H A LYS 174 ? ? 1.55 31 18 H A ARG 154 ? ? O A GLY 167 ? ? 1.59 32 18 O A GLU 152 ? ? H A TYR 169 ? ? 1.59 33 19 H A ARG 154 ? ? O A GLY 167 ? ? 1.56 34 19 O A ILE 148 ? ? H A LYS 174 ? ? 1.56 35 20 H A ARG 154 ? ? O A GLY 167 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 146 ? ? -59.17 -169.13 2 1 GLN A 155 ? ? -162.38 -163.83 3 1 SER A 160 ? ? -91.36 34.71 4 1 LYS A 161 ? ? -150.84 -32.15 5 1 VAL A 162 ? ? -102.11 -103.31 6 1 THR A 164 ? ? -153.87 35.11 7 1 ILE A 165 ? ? -42.13 95.57 8 1 ASP A 172 ? ? -150.85 -144.66 9 1 ARG A 185 ? ? -86.37 -156.22 10 1 ILE A 188 ? ? -150.40 -159.74 11 1 VAL A 208 ? ? -151.18 75.83 12 1 GLN A 210 ? ? 83.94 -73.49 13 1 LYS A 219 ? ? 45.51 -144.72 14 1 LYS A 225 ? ? 58.01 115.87 15 1 GLU A 226 ? ? 3.64 66.62 16 1 ASP A 228 ? ? -164.95 -148.38 17 1 VAL A 234 ? ? -176.64 -162.33 18 1 GLN A 236 ? ? -96.48 36.82 19 1 ALA A 239 ? ? 70.53 -62.73 20 2 GLU A 145 ? ? -89.74 -72.57 21 2 LYS A 146 ? ? 64.57 168.14 22 2 GLN A 155 ? ? -164.29 -159.05 23 2 SER A 160 ? ? -91.95 35.91 24 2 LYS A 161 ? ? -150.85 -34.04 25 2 VAL A 162 ? ? -102.18 -102.04 26 2 THR A 164 ? ? -153.37 34.46 27 2 ILE A 165 ? ? -42.15 95.20 28 2 ASP A 172 ? ? -150.36 -144.28 29 2 ARG A 185 ? ? -85.74 -150.85 30 2 ILE A 188 ? ? -120.61 -156.68 31 2 ARG A 200 ? ? -87.96 -157.99 32 2 LYS A 202 ? ? -94.51 -60.77 33 2 VAL A 208 ? ? -150.93 77.00 34 2 GLN A 210 ? ? 85.77 -75.50 35 2 LYS A 219 ? ? 42.50 -144.33 36 2 LYS A 225 ? ? 63.53 147.74 37 2 GLU A 226 ? ? -36.58 87.98 38 2 ASP A 228 ? ? -163.71 -146.91 39 2 VAL A 234 ? ? 178.46 -169.83 40 2 GLU A 237 ? ? -150.61 40.16 41 2 ALA A 239 ? ? 71.25 -62.38 42 3 GLU A 144 ? ? -75.18 -168.50 43 3 LYS A 146 ? ? -71.35 -168.05 44 3 GLN A 155 ? ? -162.40 -162.29 45 3 SER A 160 ? ? -90.15 35.68 46 3 LYS A 161 ? ? -150.41 -32.40 47 3 VAL A 162 ? ? -102.85 -103.23 48 3 THR A 164 ? ? -153.49 34.65 49 3 ILE A 165 ? ? -40.86 98.11 50 3 ASP A 172 ? ? -150.07 -146.42 51 3 ARG A 185 ? ? -87.05 -147.93 52 3 ILE A 188 ? ? -112.41 -155.37 53 3 VAL A 208 ? ? -151.05 81.78 54 3 GLN A 210 ? ? 83.90 -72.98 55 3 LYS A 219 ? ? 42.34 -88.94 56 3 LYS A 225 ? ? 57.68 119.31 57 3 GLU A 226 ? ? 5.95 65.81 58 3 ASP A 228 ? ? -165.05 -147.17 59 3 VAL A 234 ? ? -177.56 -175.60 60 3 GLU A 237 ? ? -150.97 56.28 61 3 ALA A 239 ? ? 73.13 -61.05 62 4 GLU A 144 ? ? 63.34 127.71 63 4 GLU A 145 ? ? -95.16 39.21 64 4 LYS A 146 ? ? -112.55 -82.95 65 4 ARG A 154 ? ? -90.47 -60.34 66 4 GLN A 155 ? ? -164.49 -159.88 67 4 SER A 160 ? ? -90.41 34.20 68 4 LYS A 161 ? ? -150.75 -32.32 69 4 VAL A 162 ? ? -100.17 -102.68 70 4 THR A 164 ? ? -153.50 36.46 71 4 ILE A 165 ? ? -42.31 95.30 72 4 THR A 171 ? ? -140.78 14.83 73 4 ASP A 172 ? ? -150.80 -144.46 74 4 ARG A 185 ? ? -88.87 -148.44 75 4 ILE A 188 ? ? -111.60 -158.70 76 4 ARG A 200 ? ? -88.06 -159.71 77 4 LYS A 202 ? ? -121.35 -62.11 78 4 VAL A 208 ? ? -151.05 80.59 79 4 GLN A 210 ? ? 84.83 -73.88 80 4 LYS A 219 ? ? 46.43 -136.00 81 4 LYS A 225 ? ? 62.92 152.32 82 4 GLU A 226 ? ? -38.45 90.14 83 4 VAL A 234 ? ? -178.12 -177.36 84 4 MET A 235 ? ? -89.70 -157.71 85 4 GLU A 237 ? ? -150.66 58.73 86 4 ALA A 239 ? ? -49.62 -71.77 87 5 GLU A 145 ? ? -96.83 36.03 88 5 LYS A 146 ? ? -147.48 -80.39 89 5 ARG A 154 ? ? -100.77 -63.01 90 5 GLN A 155 ? ? -161.92 -165.65 91 5 PHE A 157 ? ? -115.48 76.26 92 5 SER A 160 ? ? -93.28 34.57 93 5 LYS A 161 ? ? -151.49 -34.77 94 5 VAL A 162 ? ? -97.65 -102.70 95 5 THR A 164 ? ? -154.21 32.61 96 5 ILE A 165 ? ? -42.53 95.42 97 5 ASP A 172 ? ? -150.62 -144.36 98 5 ARG A 185 ? ? -88.54 -148.45 99 5 ILE A 188 ? ? -113.06 -158.26 100 5 VAL A 208 ? ? -151.07 77.86 101 5 GLN A 210 ? ? 81.75 -70.08 102 5 LYS A 219 ? ? 45.77 -146.98 103 5 LYS A 225 ? ? 61.12 129.47 104 5 GLU A 226 ? ? -11.67 77.97 105 5 VAL A 234 ? ? -177.39 131.09 106 5 GLN A 236 ? ? -127.48 -152.00 107 5 ALA A 239 ? ? 80.74 -56.64 108 6 GLU A 144 ? ? 60.83 169.37 109 6 GLU A 145 ? ? -94.06 42.17 110 6 ARG A 154 ? ? -90.17 -61.56 111 6 GLN A 155 ? ? -162.28 -163.49 112 6 PHE A 157 ? ? -103.98 73.22 113 6 SER A 160 ? ? -92.67 34.40 114 6 LYS A 161 ? ? -151.45 -33.03 115 6 VAL A 162 ? ? -100.07 -101.95 116 6 THR A 164 ? ? -153.63 34.82 117 6 ILE A 165 ? ? -42.88 95.44 118 6 ASP A 172 ? ? -149.98 -141.04 119 6 ARG A 185 ? ? -87.08 -152.67 120 6 ILE A 188 ? ? -117.90 -155.86 121 6 ARG A 200 ? ? -88.37 -159.26 122 6 GLN A 210 ? ? 80.91 -71.80 123 6 ASN A 220 ? ? -153.23 21.10 124 6 LYS A 225 ? ? 56.56 116.25 125 6 GLU A 226 ? ? 8.78 63.88 126 6 ASP A 228 ? ? -165.38 -147.48 127 6 MET A 235 ? ? -99.52 34.55 128 6 GLN A 236 ? ? -150.53 -158.91 129 6 GLU A 237 ? ? -98.82 -90.45 130 6 ALA A 239 ? ? 66.61 -72.30 131 7 GLU A 144 ? ? 59.36 89.48 132 7 GLN A 155 ? ? -162.76 -163.61 133 7 SER A 160 ? ? -90.70 33.58 134 7 LYS A 161 ? ? -151.02 -29.67 135 7 VAL A 162 ? ? -103.19 -101.79 136 7 THR A 164 ? ? -153.14 36.24 137 7 ILE A 165 ? ? -42.55 101.92 138 7 ASP A 172 ? ? -150.12 -145.76 139 7 ARG A 185 ? ? -88.04 -150.73 140 7 ILE A 188 ? ? -116.69 -154.34 141 7 GLN A 210 ? ? 82.26 -69.36 142 7 LYS A 219 ? ? 45.06 -144.24 143 7 LYS A 225 ? ? 57.09 117.28 144 7 GLU A 226 ? ? 7.71 63.28 145 7 ASP A 228 ? ? -164.17 -150.20 146 7 GLN A 236 ? ? -132.06 -145.20 147 7 ALA A 239 ? ? 80.64 -56.24 148 8 GLU A 145 ? ? -95.98 37.39 149 8 LYS A 146 ? ? -135.17 -82.68 150 8 GLN A 155 ? ? -163.30 -166.16 151 8 LYS A 161 ? ? -150.90 6.98 152 8 VAL A 162 ? ? -130.81 -99.60 153 8 THR A 164 ? ? -153.70 32.08 154 8 ILE A 165 ? ? -41.09 94.32 155 8 THR A 171 ? ? -141.87 15.79 156 8 ASP A 172 ? ? -150.24 -142.64 157 8 ARG A 185 ? ? -87.33 -152.64 158 8 ILE A 188 ? ? -114.40 -157.22 159 8 TYR A 191 ? ? -178.54 146.40 160 8 VAL A 208 ? ? -151.17 81.44 161 8 GLN A 210 ? ? 83.49 -72.67 162 8 LYS A 219 ? ? 46.71 -144.85 163 8 LYS A 225 ? ? 57.07 114.33 164 8 GLU A 226 ? ? 8.66 64.22 165 8 ASP A 228 ? ? -164.90 -147.99 166 8 MET A 235 ? ? -88.88 -73.54 167 8 GLN A 236 ? ? -150.03 73.20 168 8 GLU A 237 ? ? -150.94 57.97 169 8 ALA A 239 ? ? -55.05 -73.23 170 9 GLU A 145 ? ? -89.86 49.39 171 9 GLN A 155 ? ? -162.30 -164.32 172 9 PHE A 157 ? ? -115.53 78.41 173 9 SER A 160 ? ? -91.29 34.64 174 9 LYS A 161 ? ? -150.76 -32.92 175 9 VAL A 162 ? ? -100.67 -103.05 176 9 THR A 164 ? ? -154.14 33.94 177 9 ILE A 165 ? ? -42.91 95.26 178 9 ASP A 172 ? ? -150.56 -144.68 179 9 ARG A 185 ? ? -87.17 -154.18 180 9 ILE A 188 ? ? -117.75 -156.75 181 9 TYR A 191 ? ? -178.34 144.31 182 9 ARG A 200 ? ? -86.88 -145.98 183 9 VAL A 208 ? ? -151.02 75.74 184 9 GLN A 210 ? ? 83.88 -75.46 185 9 LYS A 219 ? ? 45.93 -144.44 186 9 LYS A 225 ? ? 57.33 114.44 187 9 GLU A 226 ? ? 11.41 61.10 188 9 ASP A 228 ? ? -164.80 -148.93 189 9 VAL A 234 ? ? -175.62 -172.64 190 9 GLN A 236 ? ? -95.56 37.83 191 9 ALA A 239 ? ? 72.86 -60.86 192 10 GLU A 144 ? ? 59.25 85.61 193 10 GLU A 145 ? ? -97.56 40.69 194 10 LYS A 146 ? ? -94.73 -76.59 195 10 GLN A 155 ? ? -161.13 -160.46 196 10 PHE A 157 ? ? -118.11 75.58 197 10 SER A 160 ? ? -92.50 34.57 198 10 LYS A 161 ? ? -151.67 -32.97 199 10 VAL A 162 ? ? -99.83 -103.21 200 10 THR A 164 ? ? -153.83 36.18 201 10 ILE A 165 ? ? -42.14 98.27 202 10 ASP A 172 ? ? -150.19 -147.42 203 10 ARG A 185 ? ? -86.49 -157.38 204 10 TYR A 191 ? ? 179.90 158.41 205 10 VAL A 208 ? ? -150.86 82.64 206 10 GLN A 210 ? ? 83.22 -72.55 207 10 LYS A 219 ? ? 47.16 -141.91 208 10 LYS A 225 ? ? 34.12 103.92 209 10 GLU A 226 ? ? 20.35 59.49 210 10 ASP A 228 ? ? -164.06 -152.02 211 10 VAL A 234 ? ? -176.93 -161.05 212 10 GLN A 236 ? ? -98.91 32.70 213 10 ALA A 239 ? ? 69.84 -64.87 214 11 GLU A 145 ? ? -93.84 42.23 215 11 GLN A 155 ? ? -163.83 -164.07 216 11 SER A 160 ? ? -89.83 36.74 217 11 LYS A 161 ? ? -150.60 -34.18 218 11 VAL A 162 ? ? -101.65 -101.81 219 11 THR A 164 ? ? -152.32 37.07 220 11 ILE A 165 ? ? -40.28 93.21 221 11 ASP A 172 ? ? -150.46 -142.58 222 11 ARG A 185 ? ? -85.99 -150.44 223 11 ILE A 188 ? ? -115.44 -155.28 224 11 ARG A 200 ? ? -87.86 -144.27 225 11 VAL A 208 ? ? -150.88 81.56 226 11 GLN A 210 ? ? 82.59 -75.00 227 11 LYS A 219 ? ? 44.04 -145.53 228 11 LYS A 225 ? ? 55.67 120.88 229 11 GLU A 226 ? ? -3.97 71.73 230 11 ASP A 228 ? ? -164.76 -148.49 231 11 GLN A 236 ? ? -120.08 -143.54 232 11 ALA A 239 ? ? 78.62 -59.77 233 12 GLU A 144 ? ? 60.64 -175.47 234 12 GLU A 145 ? ? -93.70 42.46 235 12 LYS A 146 ? ? -76.26 -166.33 236 12 GLN A 155 ? ? -161.51 -162.03 237 12 PHE A 157 ? ? -104.21 72.13 238 12 SER A 160 ? ? -92.62 32.97 239 12 LYS A 161 ? ? -152.02 -31.54 240 12 VAL A 162 ? ? -98.98 -101.19 241 12 THR A 164 ? ? -153.70 34.85 242 12 ILE A 165 ? ? -42.45 94.87 243 12 ASP A 172 ? ? -150.52 -144.16 244 12 ARG A 185 ? ? -87.16 -153.19 245 12 ILE A 188 ? ? -116.12 -156.57 246 12 ARG A 200 ? ? -87.76 -159.77 247 12 VAL A 208 ? ? -150.79 73.03 248 12 GLN A 210 ? ? 83.11 -76.32 249 12 ASN A 220 ? ? -152.36 34.40 250 12 LYS A 225 ? ? 56.61 115.54 251 12 GLU A 226 ? ? 7.50 64.28 252 12 ASP A 228 ? ? -164.98 -147.67 253 12 VAL A 234 ? ? -178.81 -173.78 254 12 GLU A 237 ? ? -150.84 39.35 255 12 ALA A 239 ? ? 69.67 -63.65 256 13 GLU A 145 ? ? -94.54 40.63 257 13 LYS A 146 ? ? -123.79 -165.62 258 13 GLN A 155 ? ? -161.28 -161.94 259 13 PHE A 157 ? ? -104.62 76.38 260 13 SER A 160 ? ? -90.79 34.78 261 13 LYS A 161 ? ? -150.71 -31.67 262 13 VAL A 162 ? ? -102.71 -102.78 263 13 THR A 164 ? ? -156.03 54.40 264 13 ILE A 165 ? ? -34.38 -27.59 265 13 ALA A 166 ? ? 36.78 97.52 266 13 ASP A 172 ? ? -145.76 -139.21 267 13 ARG A 185 ? ? -89.00 -151.74 268 13 ILE A 188 ? ? -150.15 -158.33 269 13 VAL A 208 ? ? -151.42 71.26 270 13 GLN A 210 ? ? 83.67 -76.87 271 13 LYS A 219 ? ? 45.30 -143.47 272 13 LYS A 225 ? ? 54.87 111.10 273 13 GLU A 226 ? ? 14.81 56.67 274 13 ASP A 228 ? ? -161.25 -164.12 275 13 VAL A 234 ? ? -175.97 137.76 276 13 GLN A 236 ? ? -142.79 -146.99 277 13 ALA A 239 ? ? 81.22 -56.66 278 14 GLU A 145 ? ? -93.84 40.49 279 14 LYS A 146 ? ? -127.55 -169.91 280 14 GLN A 155 ? ? -161.45 -163.71 281 14 SER A 160 ? ? -89.74 33.49 282 14 LYS A 161 ? ? -150.93 -29.30 283 14 VAL A 162 ? ? -103.52 -101.53 284 14 THR A 164 ? ? -155.15 58.96 285 14 ILE A 165 ? ? -38.70 -22.85 286 14 ALA A 166 ? ? 31.02 98.36 287 14 ASP A 172 ? ? -151.48 -147.51 288 14 ARG A 185 ? ? -88.52 -151.94 289 14 ARG A 200 ? ? -88.83 -158.70 290 14 VAL A 208 ? ? -151.12 70.95 291 14 GLN A 210 ? ? 81.97 -75.45 292 14 LYS A 219 ? ? 34.75 -85.99 293 14 LYS A 225 ? ? 55.26 110.56 294 14 GLU A 226 ? ? 10.95 60.50 295 14 VAL A 234 ? ? 171.55 149.68 296 14 MET A 235 ? ? -94.15 45.74 297 14 GLN A 236 ? ? -133.15 -154.10 298 14 ALA A 239 ? ? 152.74 -51.28 299 15 GLU A 144 ? ? -129.53 -167.64 300 15 GLU A 145 ? ? -93.48 42.21 301 15 LYS A 146 ? ? -61.60 -171.57 302 15 ARG A 154 ? ? -97.44 -61.03 303 15 GLN A 155 ? ? -165.75 -160.53 304 15 LYS A 161 ? ? -150.71 5.66 305 15 VAL A 162 ? ? -129.98 -99.17 306 15 THR A 164 ? ? -153.98 32.90 307 15 ILE A 165 ? ? -40.27 93.78 308 15 THR A 171 ? ? -141.87 13.12 309 15 ASP A 172 ? ? -151.27 -145.87 310 15 ARG A 185 ? ? -85.45 -151.76 311 15 ILE A 188 ? ? -116.47 -156.54 312 15 VAL A 208 ? ? -150.80 83.25 313 15 GLN A 210 ? ? 80.63 -68.76 314 15 LYS A 219 ? ? -39.24 -31.75 315 15 ASN A 220 ? ? -153.08 40.38 316 15 LYS A 225 ? ? 59.37 172.76 317 15 GLU A 226 ? ? -58.61 84.09 318 15 ASP A 228 ? ? -164.60 -148.30 319 15 VAL A 234 ? ? -178.95 -166.99 320 15 GLU A 237 ? ? -150.64 39.23 321 15 ALA A 239 ? ? 70.91 -63.34 322 16 GLU A 144 ? ? 60.34 99.60 323 16 GLU A 145 ? ? -94.95 38.86 324 16 LYS A 146 ? ? -94.60 -83.50 325 16 GLN A 155 ? ? -165.55 -162.88 326 16 SER A 160 ? ? -92.33 35.89 327 16 LYS A 161 ? ? -151.37 -35.22 328 16 VAL A 162 ? ? -98.96 -103.70 329 16 THR A 164 ? ? -153.72 33.83 330 16 ILE A 165 ? ? -41.98 95.98 331 16 ASP A 172 ? ? -146.87 -144.01 332 16 ARG A 185 ? ? -85.68 -151.30 333 16 ILE A 188 ? ? -121.16 -156.34 334 16 ARG A 200 ? ? -87.56 -112.66 335 16 TYR A 201 ? ? -88.37 -79.23 336 16 VAL A 208 ? ? -151.28 79.78 337 16 GLN A 210 ? ? 84.22 -71.61 338 16 LYS A 219 ? ? 42.16 -143.70 339 16 LYS A 225 ? ? 62.38 155.63 340 16 GLU A 226 ? ? -45.08 90.35 341 16 ASP A 228 ? ? -163.83 -148.89 342 16 VAL A 234 ? ? -176.14 -163.07 343 16 GLN A 236 ? ? -96.27 37.53 344 16 ALA A 239 ? ? 167.52 -81.03 345 17 GLU A 145 ? ? -95.87 40.07 346 17 GLN A 155 ? ? -162.33 -163.36 347 17 SER A 160 ? ? -90.86 34.81 348 17 LYS A 161 ? ? -150.51 -32.76 349 17 VAL A 162 ? ? -101.53 -104.02 350 17 THR A 164 ? ? -153.92 34.83 351 17 ILE A 165 ? ? -41.56 94.78 352 17 ASP A 172 ? ? -150.01 -146.71 353 17 ARG A 185 ? ? -87.75 -157.20 354 17 GLN A 186 ? ? -93.72 30.60 355 17 ARG A 200 ? ? -87.77 -159.88 356 17 LYS A 202 ? ? -95.76 -60.34 357 17 VAL A 208 ? ? -150.94 78.40 358 17 GLN A 210 ? ? 85.89 -74.99 359 17 LYS A 219 ? ? 44.08 -134.95 360 17 LYS A 225 ? ? 34.40 100.65 361 17 GLU A 226 ? ? 25.95 57.44 362 17 ASP A 228 ? ? -157.58 -159.67 363 17 VAL A 234 ? ? -179.60 -167.14 364 17 GLU A 237 ? ? -150.87 38.75 365 17 ALA A 239 ? ? 70.02 -64.39 366 18 GLU A 144 ? ? -177.13 136.14 367 18 GLU A 145 ? ? -98.66 34.60 368 18 LYS A 146 ? ? 68.06 166.94 369 18 GLN A 155 ? ? -164.51 -160.08 370 18 PHE A 157 ? ? -104.42 73.95 371 18 SER A 160 ? ? -92.52 33.32 372 18 LYS A 161 ? ? -151.84 -31.78 373 18 VAL A 162 ? ? -99.47 -101.94 374 18 THR A 164 ? ? -153.78 35.63 375 18 ILE A 165 ? ? -42.80 95.02 376 18 ASP A 172 ? ? -142.67 -142.42 377 18 ARG A 185 ? ? -88.83 -148.09 378 18 ILE A 188 ? ? -110.22 -157.78 379 18 ARG A 200 ? ? -87.88 -159.79 380 18 LYS A 202 ? ? -94.48 -60.39 381 18 VAL A 208 ? ? -150.38 84.24 382 18 GLN A 210 ? ? 81.90 -75.01 383 18 ILE A 218 ? ? -91.33 52.61 384 18 LYS A 219 ? ? 61.48 -72.08 385 18 ASN A 220 ? ? -145.43 51.45 386 18 LYS A 225 ? ? 62.06 154.28 387 18 GLU A 226 ? ? -39.99 90.77 388 18 MET A 235 ? ? -97.06 30.94 389 18 GLN A 236 ? ? -133.72 -155.88 390 18 GLU A 237 ? ? -98.56 -99.57 391 18 VAL A 238 ? ? -154.47 -158.05 392 18 ALA A 239 ? ? -47.36 -78.62 393 19 GLU A 144 ? ? 179.46 138.76 394 19 GLU A 145 ? ? -95.30 39.50 395 19 GLN A 155 ? ? -163.10 -163.23 396 19 SER A 160 ? ? -92.07 35.45 397 19 LYS A 161 ? ? -151.47 -35.32 398 19 VAL A 162 ? ? -97.85 -102.24 399 19 THR A 164 ? ? -153.68 35.20 400 19 ILE A 165 ? ? -42.92 96.02 401 19 THR A 171 ? ? -140.09 15.12 402 19 ASP A 172 ? ? -150.60 -145.26 403 19 ARG A 185 ? ? -87.16 -155.77 404 19 ILE A 188 ? ? -150.14 -159.34 405 19 TYR A 201 ? ? -151.61 -86.40 406 19 VAL A 208 ? ? -151.07 80.34 407 19 GLN A 210 ? ? 83.11 -74.33 408 19 ASN A 220 ? ? -152.46 35.08 409 19 LYS A 225 ? ? 57.46 116.80 410 19 GLU A 226 ? ? 6.91 63.95 411 19 ASP A 228 ? ? -165.07 -148.21 412 19 VAL A 234 ? ? -175.99 -175.71 413 19 GLN A 236 ? ? -93.78 38.09 414 19 ALA A 239 ? ? 69.71 -64.68 415 20 GLU A 145 ? ? -96.11 37.08 416 20 LYS A 146 ? ? -119.17 -80.26 417 20 ARG A 154 ? ? -91.48 -60.17 418 20 GLN A 155 ? ? -164.73 -159.18 419 20 PHE A 157 ? ? -110.13 73.04 420 20 SER A 160 ? ? -93.06 34.46 421 20 LYS A 161 ? ? -151.63 -33.09 422 20 VAL A 162 ? ? -99.82 -102.19 423 20 THR A 164 ? ? -153.64 34.61 424 20 ILE A 165 ? ? -43.30 98.09 425 20 THR A 171 ? ? -140.95 12.01 426 20 ASP A 172 ? ? -150.79 -148.14 427 20 ARG A 185 ? ? -86.57 -154.02 428 20 ILE A 188 ? ? -115.49 -157.68 429 20 TYR A 201 ? ? -151.52 -96.32 430 20 VAL A 205 ? ? -56.15 173.47 431 20 VAL A 208 ? ? -150.74 81.23 432 20 GLN A 210 ? ? 83.24 -72.06 433 20 LYS A 219 ? ? 44.43 -146.10 434 20 LYS A 225 ? ? 63.88 149.46 435 20 GLU A 226 ? ? -36.92 86.50 436 20 ASP A 228 ? ? -165.21 -144.94 437 20 VAL A 234 ? ? 179.97 -173.83 438 20 ALA A 239 ? ? 69.92 -64.54 # _pdbx_nmr_ensemble.entry_id 1D1N _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ;STRUCTURES WITH ACCEPTABLE COVALENT GEOMETRY,STRUCTURES WITH FAVORABLE NON- BOND ENERGY,STRUCTURES WITH THE LEAST RESTRAINT VIOLATIONS,STRUCTURES WITH THE LOWEST ENERGY ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1D1N _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 SER N N N N 249 SER CA C N S 250 SER C C N N 251 SER O O N N 252 SER CB C N N 253 SER OG O N N 254 SER OXT O N N 255 SER H H N N 256 SER H2 H N N 257 SER HA H N N 258 SER HB2 H N N 259 SER HB3 H N N 260 SER HG H N N 261 SER HXT H N N 262 THR N N N N 263 THR CA C N S 264 THR C C N N 265 THR O O N N 266 THR CB C N R 267 THR OG1 O N N 268 THR CG2 C N N 269 THR OXT O N N 270 THR H H N N 271 THR H2 H N N 272 THR HA H N N 273 THR HB H N N 274 THR HG1 H N N 275 THR HG21 H N N 276 THR HG22 H N N 277 THR HG23 H N N 278 THR HXT H N N 279 TYR N N N N 280 TYR CA C N S 281 TYR C C N N 282 TYR O O N N 283 TYR CB C N N 284 TYR CG C Y N 285 TYR CD1 C Y N 286 TYR CD2 C Y N 287 TYR CE1 C Y N 288 TYR CE2 C Y N 289 TYR CZ C Y N 290 TYR OH O N N 291 TYR OXT O N N 292 TYR H H N N 293 TYR H2 H N N 294 TYR HA H N N 295 TYR HB2 H N N 296 TYR HB3 H N N 297 TYR HD1 H N N 298 TYR HD2 H N N 299 TYR HE1 H N N 300 TYR HE2 H N N 301 TYR HH H N N 302 TYR HXT H N N 303 VAL N N N N 304 VAL CA C N S 305 VAL C C N N 306 VAL O O N N 307 VAL CB C N N 308 VAL CG1 C N N 309 VAL CG2 C N N 310 VAL OXT O N N 311 VAL H H N N 312 VAL H2 H N N 313 VAL HA H N N 314 VAL HB H N N 315 VAL HG11 H N N 316 VAL HG12 H N N 317 VAL HG13 H N N 318 VAL HG21 H N N 319 VAL HG22 H N N 320 VAL HG23 H N N 321 VAL HXT H N N 322 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 SER N CA sing N N 237 SER N H sing N N 238 SER N H2 sing N N 239 SER CA C sing N N 240 SER CA CB sing N N 241 SER CA HA sing N N 242 SER C O doub N N 243 SER C OXT sing N N 244 SER CB OG sing N N 245 SER CB HB2 sing N N 246 SER CB HB3 sing N N 247 SER OG HG sing N N 248 SER OXT HXT sing N N 249 THR N CA sing N N 250 THR N H sing N N 251 THR N H2 sing N N 252 THR CA C sing N N 253 THR CA CB sing N N 254 THR CA HA sing N N 255 THR C O doub N N 256 THR C OXT sing N N 257 THR CB OG1 sing N N 258 THR CB CG2 sing N N 259 THR CB HB sing N N 260 THR OG1 HG1 sing N N 261 THR CG2 HG21 sing N N 262 THR CG2 HG22 sing N N 263 THR CG2 HG23 sing N N 264 THR OXT HXT sing N N 265 TYR N CA sing N N 266 TYR N H sing N N 267 TYR N H2 sing N N 268 TYR CA C sing N N 269 TYR CA CB sing N N 270 TYR CA HA sing N N 271 TYR C O doub N N 272 TYR C OXT sing N N 273 TYR CB CG sing N N 274 TYR CB HB2 sing N N 275 TYR CB HB3 sing N N 276 TYR CG CD1 doub Y N 277 TYR CG CD2 sing Y N 278 TYR CD1 CE1 sing Y N 279 TYR CD1 HD1 sing N N 280 TYR CD2 CE2 doub Y N 281 TYR CD2 HD2 sing N N 282 TYR CE1 CZ doub Y N 283 TYR CE1 HE1 sing N N 284 TYR CE2 CZ sing Y N 285 TYR CE2 HE2 sing N N 286 TYR CZ OH sing N N 287 TYR OH HH sing N N 288 TYR OXT HXT sing N N 289 VAL N CA sing N N 290 VAL N H sing N N 291 VAL N H2 sing N N 292 VAL CA C sing N N 293 VAL CA CB sing N N 294 VAL CA HA sing N N 295 VAL C O doub N N 296 VAL C OXT sing N N 297 VAL CB CG1 sing N N 298 VAL CB CG2 sing N N 299 VAL CB HB sing N N 300 VAL CG1 HG11 sing N N 301 VAL CG1 HG12 sing N N 302 VAL CG1 HG13 sing N N 303 VAL CG2 HG21 sing N N 304 VAL CG2 HG22 sing N N 305 VAL CG2 HG23 sing N N 306 VAL OXT HXT sing N N 307 # _atom_sites.entry_id 1D1N _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_