data_1D9A # _entry.id 1D9A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1D9A pdb_00001d9a 10.2210/pdb1d9a/pdb RCSB RCSB009904 ? ? WWPDB D_1000009904 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1D8Z 'FIRST RNA-BINDING DOMAIN (RBD1) OF HUC' unspecified TargetDB trt001000186.1 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1D9A _pdbx_database_status.recvd_initial_deposition_date 1999-10-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, M.' 1 'Muto, Y.' 2 'Sakamoto, H.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'NMR studies on functional structures of the AU-rich element-binding domains of Hu antigen C.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 28 _citation.page_first 1743 _citation.page_last 1750 _citation.year 2000 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10734193 _citation.pdbx_database_id_DOI 10.1093/nar/28.8.1743 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, M.' 1 ? primary 'Muto, Y.' 2 ? primary 'Sakamoto, H.' 3 ? primary 'Yokoyama, S.' 4 ? # _cell.entry_id 1D9A _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1D9A _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HU ANTIGEN C' _entity.formula_weight 9351.658 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SECOND RNA-BINDING DOMAIN (RBD2)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFA NNPSQ ; _entity_poly.pdbx_seq_one_letter_code_can ;DANLYVSGLPKTMSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFA NNPSQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier trt001000186.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 ASN n 1 4 LEU n 1 5 TYR n 1 6 VAL n 1 7 SER n 1 8 GLY n 1 9 LEU n 1 10 PRO n 1 11 LYS n 1 12 THR n 1 13 MET n 1 14 SER n 1 15 GLN n 1 16 LYS n 1 17 GLU n 1 18 MET n 1 19 GLU n 1 20 GLN n 1 21 LEU n 1 22 PHE n 1 23 SER n 1 24 GLN n 1 25 TYR n 1 26 GLY n 1 27 ARG n 1 28 ILE n 1 29 ILE n 1 30 THR n 1 31 SER n 1 32 ARG n 1 33 ILE n 1 34 LEU n 1 35 LEU n 1 36 ASP n 1 37 GLN n 1 38 ALA n 1 39 THR n 1 40 GLY n 1 41 VAL n 1 42 SER n 1 43 ARG n 1 44 GLY n 1 45 VAL n 1 46 GLY n 1 47 PHE n 1 48 ILE n 1 49 ARG n 1 50 PHE n 1 51 ASP n 1 52 LYS n 1 53 ARG n 1 54 ILE n 1 55 GLU n 1 56 ALA n 1 57 GLU n 1 58 GLU n 1 59 ALA n 1 60 ILE n 1 61 LYS n 1 62 GLY n 1 63 LEU n 1 64 ASN n 1 65 GLY n 1 66 GLN n 1 67 LYS n 1 68 PRO n 1 69 LEU n 1 70 GLY n 1 71 ALA n 1 72 ALA n 1 73 GLU n 1 74 PRO n 1 75 ILE n 1 76 THR n 1 77 VAL n 1 78 LYS n 1 79 PHE n 1 80 ALA n 1 81 ASN n 1 82 ASN n 1 83 PRO n 1 84 SER n 1 85 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PK7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ELAV3_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q60900 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1D9A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q60900 _struct_ref_seq.db_align_beg 124 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 208 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 3D_15N-SEPARATED_NOESY 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 3.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2MM PROTEIN; 20 MM POTASSIUM OXALATE BUFFER; 90% H2O; 10% D2O' ? 2 '2MM PROTEIN U-15N; 20 MM POTASSIUM OXALATE BUFFER; 90% H2O; 10% D2O' ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1D9A _pdbx_nmr_refine.method 'DISTANCE GEOMETRY AND SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1D9A _pdbx_nmr_details.text ;THIS STRUCTURE WAS DETERMINED USING STANDARD 2D HOMONUCLEAR AND 15N-SEPARATED HETERONUCLEAR TECHNIQUES. ; # _pdbx_nmr_ensemble.entry_id 1D9A _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' X-PLOR 3.1 BRUNGER 1 refinement X-PLOR 3.1 BRUNGER 2 # _exptl.entry_id 1D9A _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1D9A _struct.title 'SOLUTION STRUCTURE OF THE SECOND RNA-BINDING DOMAIN (RBD2) OF HU ANTIGEN C (HUC)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1D9A _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RNA-BINDING DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 14 ? GLN A 24 ? SER A 14 GLN A 24 1 ? 11 HELX_P HELX_P2 2 LYS A 52 ? ASN A 64 ? LYS A 52 ASN A 64 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 28 ? LEU A 34 ? ILE A 28 LEU A 34 A 2 VAL A 45 ? PHE A 50 ? VAL A 45 PHE A 50 A 3 TYR A 5 ? SER A 7 ? TYR A 5 SER A 7 A 4 THR A 76 ? LYS A 78 ? THR A 76 LYS A 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 34 ? O LEU A 34 N VAL A 45 ? N VAL A 45 A 2 3 O GLY A 46 ? O GLY A 46 N VAL A 6 ? N VAL A 6 A 3 4 N SER A 7 ? N SER A 7 O THR A 76 ? O THR A 76 # _database_PDB_matrix.entry_id 1D9A _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1D9A _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLN 85 85 85 GLN GLN A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-04-07 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -116.40 63.03 2 1 ARG A 27 ? ? -43.00 105.54 3 1 ILE A 29 ? ? -88.43 -73.55 4 1 ARG A 32 ? ? 175.55 152.58 5 1 LEU A 35 ? ? -162.73 102.49 6 1 GLN A 37 ? ? -150.08 62.36 7 1 ALA A 38 ? ? -176.52 -42.70 8 1 LEU A 63 ? ? -133.61 -46.76 9 1 ASN A 64 ? ? -39.28 136.07 10 1 LYS A 67 ? ? -160.81 102.35 11 1 ALA A 71 ? ? -43.01 105.84 12 1 ALA A 72 ? ? 171.82 -26.54 13 1 THR A 76 ? ? -159.72 82.91 14 1 ASN A 82 ? ? 59.72 118.97 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 27 ? ? 0.307 'SIDE CHAIN' 2 1 ARG A 32 ? ? 0.290 'SIDE CHAIN' 3 1 ARG A 43 ? ? 0.208 'SIDE CHAIN' 4 1 ARG A 49 ? ? 0.253 'SIDE CHAIN' 5 1 ARG A 53 ? ? 0.257 'SIDE CHAIN' #