data_1DBY # _entry.id 1DBY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DBY pdb_00001dby 10.2210/pdb1dby/pdb RCSB RCSB009956 ? ? WWPDB D_1000009956 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-11-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DBY _pdbx_database_status.recvd_initial_deposition_date 1999-11-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1TOF _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lancelin, J.-M.' 1 'Guilhaudis, L.' 2 'Krimm, I.' 3 'Blackledge, M.J.' 4 'Marion, D.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR structures of thioredoxin m from the green alga Chlamydomonas reinhardtii.' Proteins 41 334 349 2000 PSFGEY US 0887-3585 0867 ? 11025545 '10.1002/1097-0134(20001115)41:3<334::AID-PROT60>3.3.CO;2-D' 1 ;Secondary Structure and Protein Folding of Recombinant Chloroplastic Thioredoxin Ch2 from the Green Alga Chlamydomonas reinhardtii as Determined by 1H NMR ; 'J.Biochem.(Tokyo)' 114 421 431 1993 JOBIAO JA 0021-924X 0418 ? ? ? 2 ;Chlamydomonas reinhardtii Thioredoxins: Structure of the Genes Coding for Chloroplastic m and Cytosolic h Isoforms; Expression in Escherichia coli of the Recombinant Proteins, Purification and Biochemical Properties ; 'Plant Mol.Biol.' 28 487 503 1995 PMBIDB NE 0167-4412 2006 ? ? ? 3 'PCR Cloning of a Nucleotidic Sequence Coding for the Mature Part of Chlamydomonas reinhardtii Thioredoxin Ch2' 'Nucleic Acids Res.' 20 617 617 1992 NARHAD UK 0305-1048 0389 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lancelin, J.M.' 1 ? primary 'Guilhaudis, L.' 2 ? primary 'Krimm, I.' 3 ? primary 'Blackledge, M.J.' 4 ? primary 'Marion, D.' 5 ? primary 'Jacquot, J.P.' 6 ? 1 'Lancelin, J.-M.' 7 ? 1 'Stein, M.' 8 ? 1 'Jacquot, J.-P.' 9 ? 2 'Stein, M.' 10 ? 2 'Jacquot, J.-P.' 11 ? 2 'Jeannette, E.' 12 ? 2 'Decottignies, P.' 13 ? 2 'Hodges, M.' 14 ? 2 'Lancelin, J.-M.' 15 ? 2 'Mittard, V.' 16 ? 2 'Schmitter, J.M.' 17 ? 2 'Miginiac-Maslow, M.' 18 ? 3 'Jacquot, J.-P.' 19 ? 3 'Stein, M.' 20 ? 3 'Hodges, M.' 21 ? 3 'Miginiac-Maslow, M.' 22 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CHLOROPLAST THIOREDOXIN M CH2' _entity.formula_weight 11686.549 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVF KGGKKCETIIGAVPKATIVQTVEKYLN ; _entity_poly.pdbx_seq_one_letter_code_can ;MEAGAVNDDTFKNVVLESSVPVLVDFWAPWCGPCRIIAPVVDEIAGEYKDKLKCVKLNTDESPNVASEYGIRSIPTIMVF KGGKKCETIIGAVPKATIVQTVEKYLN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ALA n 1 4 GLY n 1 5 ALA n 1 6 VAL n 1 7 ASN n 1 8 ASP n 1 9 ASP n 1 10 THR n 1 11 PHE n 1 12 LYS n 1 13 ASN n 1 14 VAL n 1 15 VAL n 1 16 LEU n 1 17 GLU n 1 18 SER n 1 19 SER n 1 20 VAL n 1 21 PRO n 1 22 VAL n 1 23 LEU n 1 24 VAL n 1 25 ASP n 1 26 PHE n 1 27 TRP n 1 28 ALA n 1 29 PRO n 1 30 TRP n 1 31 CYS n 1 32 GLY n 1 33 PRO n 1 34 CYS n 1 35 ARG n 1 36 ILE n 1 37 ILE n 1 38 ALA n 1 39 PRO n 1 40 VAL n 1 41 VAL n 1 42 ASP n 1 43 GLU n 1 44 ILE n 1 45 ALA n 1 46 GLY n 1 47 GLU n 1 48 TYR n 1 49 LYS n 1 50 ASP n 1 51 LYS n 1 52 LEU n 1 53 LYS n 1 54 CYS n 1 55 VAL n 1 56 LYS n 1 57 LEU n 1 58 ASN n 1 59 THR n 1 60 ASP n 1 61 GLU n 1 62 SER n 1 63 PRO n 1 64 ASN n 1 65 VAL n 1 66 ALA n 1 67 SER n 1 68 GLU n 1 69 TYR n 1 70 GLY n 1 71 ILE n 1 72 ARG n 1 73 SER n 1 74 ILE n 1 75 PRO n 1 76 THR n 1 77 ILE n 1 78 MET n 1 79 VAL n 1 80 PHE n 1 81 LYS n 1 82 GLY n 1 83 GLY n 1 84 LYS n 1 85 LYS n 1 86 CYS n 1 87 GLU n 1 88 THR n 1 89 ILE n 1 90 ILE n 1 91 GLY n 1 92 ALA n 1 93 VAL n 1 94 PRO n 1 95 LYS n 1 96 ALA n 1 97 THR n 1 98 ILE n 1 99 VAL n 1 100 GLN n 1 101 THR n 1 102 VAL n 1 103 GLU n 1 104 LYS n 1 105 TYR n 1 106 LEU n 1 107 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Chlamydomonas _entity_src_gen.pdbx_gene_src_gene NUCLEAR _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chlamydomonas reinhardtii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3055 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle CHLOROPLAST _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET3 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ASN 107 107 107 ASN ASN A . n # _cell.entry_id 1DBY _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DBY _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1DBY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1DBY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1DBY _struct.title 'NMR STRUCTURES OF CHLOROPLAST THIOREDOXIN M CH2 FROM THE GREEN ALGA CHLAMYDOMONAS REINHARDTII' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DBY _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'THIOREDOXIN M, THIOREDOXIN CH2, CHLOROPLASTIC THIOREDOXIN, OXIDOREDUCTASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRXM_CHLRE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P23400 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DBY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P23400 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 107 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1DBY _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P23400 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 7 ? VAL A 15 ? ASN A 7 VAL A 15 1 ? 9 HELX_P HELX_P2 2 CYS A 31 ? TYR A 48 ? CYS A 31 TYR A 48 1 ? 18 HELX_P HELX_P3 3 SER A 62 ? GLY A 70 ? SER A 62 GLY A 70 1 ? 9 HELX_P HELX_P4 4 PRO A 94 ? LEU A 106 ? PRO A 94 LEU A 106 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 31 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 34 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 31 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 34 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.076 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 31 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 34 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 31 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 34 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 1 3.24 2 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 2 1.32 3 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 3 2.21 4 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 4 1.56 5 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 5 1.82 6 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 6 3.16 7 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 7 2.56 8 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 8 2.44 9 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 9 1.61 10 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 10 1.88 11 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 11 2.35 12 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 12 3.05 13 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 13 1.57 14 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 14 1.54 15 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 15 0.50 16 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 16 3.91 17 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 17 1.25 18 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 18 2.09 19 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 19 3.99 20 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 20 2.20 21 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 21 4.46 22 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 22 1.05 23 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 23 2.14 24 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 24 1.05 25 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 25 1.52 26 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 26 2.51 27 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 27 2.43 28 ILE 74 A . ? ILE 74 A PRO 75 A ? PRO 75 A 28 3.00 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 4 ? VAL A 6 ? GLY A 4 VAL A 6 A 2 LYS A 53 ? ASN A 58 ? LYS A 53 ASN A 58 A 3 VAL A 22 ? TRP A 27 ? VAL A 22 TRP A 27 A 4 THR A 76 ? PHE A 80 ? THR A 76 PHE A 80 A 5 LYS A 85 ? ILE A 90 ? LYS A 85 ILE A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 4 ? N GLY A 4 O CYS A 54 ? O CYS A 54 A 2 3 N VAL A 55 ? N VAL A 55 O LEU A 23 ? O LEU A 23 A 3 4 N PHE A 26 ? N PHE A 26 O THR A 76 ? O THR A 76 A 4 5 O VAL A 79 ? O VAL A 79 N CYS A 86 ? N CYS A 86 # _pdbx_entry_details.entry_id 1DBY _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 8 CA A CYS 34 ? ? CB A CYS 34 ? ? SG A CYS 34 ? ? 121.17 114.20 6.97 1.10 N 2 16 CA A CYS 34 ? ? CB A CYS 34 ? ? SG A CYS 34 ? ? 120.94 114.20 6.74 1.10 N 3 18 C A THR 76 ? ? N A ILE 77 ? ? CA A ILE 77 ? ? 140.59 121.70 18.89 2.50 Y 4 18 CB A ILE 77 ? ? CA A ILE 77 ? ? C A ILE 77 ? ? 97.55 111.60 -14.05 2.00 N 5 18 N A ILE 77 ? ? CA A ILE 77 ? ? CB A ILE 77 ? ? 93.01 110.80 -17.79 2.30 N 6 18 N A ILE 77 ? ? CA A ILE 77 ? ? C A ILE 77 ? ? 139.00 111.00 28.00 2.70 N 7 21 N A LYS 53 ? ? CA A LYS 53 ? ? C A LYS 53 ? ? 127.69 111.00 16.69 2.70 N 8 25 CA A CYS 34 ? ? CB A CYS 34 ? ? SG A CYS 34 ? ? 121.09 114.20 6.89 1.10 N 9 27 N A LYS 53 ? ? CA A LYS 53 ? ? C A LYS 53 ? ? 127.61 111.00 16.61 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 15 ? ? -115.46 -74.82 2 1 ASP A 50 ? ? 68.51 -55.10 3 1 ASN A 64 ? ? -30.07 -73.64 4 1 ARG A 72 ? ? -149.35 -64.23 5 1 CYS A 86 ? ? -126.96 -58.18 6 1 LEU A 106 ? ? -92.09 -97.09 7 2 ASP A 9 ? ? -62.57 -74.08 8 2 VAL A 15 ? ? -115.95 -72.43 9 2 TYR A 48 ? ? -97.25 33.19 10 2 ASP A 50 ? ? 71.90 -58.55 11 2 SER A 73 ? ? 94.31 166.19 12 2 CYS A 86 ? ? -129.61 -66.23 13 3 ALA A 3 ? ? -62.84 92.07 14 3 ASP A 9 ? ? -57.34 -72.22 15 3 VAL A 15 ? ? -126.60 -51.64 16 3 ASP A 50 ? ? 73.82 -53.71 17 3 ASN A 64 ? ? -51.83 -71.66 18 3 SER A 73 ? ? 101.60 172.82 19 3 LYS A 81 ? ? -145.42 33.94 20 4 LYS A 12 ? ? -42.62 -70.44 21 4 VAL A 15 ? ? -104.17 -65.50 22 4 GLU A 17 ? ? -79.49 41.39 23 4 SER A 19 ? ? -97.18 -71.65 24 4 ARG A 72 ? ? -154.25 -58.39 25 4 LYS A 81 ? ? -146.42 42.62 26 4 CYS A 86 ? ? -88.38 -70.29 27 4 LEU A 106 ? ? -118.11 -95.44 28 5 GLU A 2 ? ? 72.08 -67.26 29 5 VAL A 15 ? ? -98.61 -66.26 30 5 GLU A 17 ? ? -78.87 40.55 31 5 SER A 19 ? ? -131.58 -66.14 32 5 ASP A 50 ? ? 72.77 -61.81 33 5 SER A 62 ? ? -119.84 52.28 34 5 CYS A 86 ? ? -148.83 -80.28 35 5 ALA A 92 ? ? 71.53 -46.57 36 5 LEU A 106 ? ? -95.44 -107.10 37 6 ASP A 9 ? ? -66.09 -74.14 38 6 GLU A 17 ? ? -79.39 45.53 39 6 SER A 19 ? ? -104.98 -68.62 40 6 SER A 62 ? ? -117.33 51.29 41 6 LYS A 81 ? ? -162.28 -161.00 42 6 CYS A 86 ? ? -103.59 -69.15 43 6 TYR A 105 ? ? -105.46 -77.00 44 6 LEU A 106 ? ? 67.62 -58.91 45 7 VAL A 15 ? ? -109.95 -64.56 46 7 LEU A 16 ? ? -69.23 -71.05 47 7 SER A 18 ? ? -90.80 -129.60 48 7 SER A 19 ? ? -161.54 -78.04 49 7 ALA A 28 ? ? -171.53 142.07 50 7 TRP A 30 ? ? 137.85 -29.96 51 7 ASP A 50 ? ? -29.91 -58.81 52 7 ASN A 64 ? ? -42.97 -72.64 53 7 SER A 73 ? ? 65.33 -157.28 54 7 LYS A 81 ? ? -107.43 -101.30 55 7 CYS A 86 ? ? -130.54 -56.87 56 7 TYR A 105 ? ? -78.09 -76.15 57 7 LEU A 106 ? ? 11.95 -52.38 58 8 VAL A 15 ? ? -93.68 -61.54 59 8 SER A 19 ? ? -87.10 -73.77 60 8 TRP A 27 ? ? -116.61 -169.91 61 8 ALA A 28 ? ? -173.49 148.73 62 8 THR A 59 ? ? -81.96 48.33 63 8 ASP A 60 ? ? -145.50 -47.35 64 8 LYS A 81 ? ? -152.15 54.56 65 8 LEU A 106 ? ? -104.70 -99.68 66 9 VAL A 15 ? ? -119.51 -75.10 67 9 LEU A 106 ? ? -108.16 -98.99 68 10 ASP A 9 ? ? -59.52 -74.00 69 10 LEU A 16 ? ? -66.57 -71.34 70 10 SER A 19 ? ? -91.72 -69.87 71 10 ASN A 64 ? ? -43.64 -75.44 72 10 CYS A 86 ? ? -131.16 -63.10 73 11 ASP A 9 ? ? -58.17 -70.02 74 11 VAL A 15 ? ? -114.24 -72.52 75 11 ASP A 50 ? ? 70.73 -56.20 76 11 ARG A 72 ? ? -158.62 -63.66 77 11 THR A 76 ? ? -160.46 115.74 78 11 CYS A 86 ? ? -116.17 -72.38 79 11 LEU A 106 ? ? -90.40 -104.02 80 12 ALA A 3 ? ? -65.75 95.67 81 12 ASP A 9 ? ? -66.46 -76.19 82 12 VAL A 15 ? ? -106.33 -73.93 83 12 ASN A 64 ? ? -54.28 -75.83 84 12 LYS A 81 ? ? -143.80 53.10 85 13 SER A 19 ? ? -100.94 -71.37 86 13 CYS A 86 ? ? -120.40 -66.61 87 13 GLU A 87 ? ? -126.36 -169.16 88 13 LEU A 106 ? ? -88.64 -84.84 89 14 GLU A 2 ? ? 70.52 -70.49 90 14 ASP A 9 ? ? -62.39 -72.20 91 14 SER A 19 ? ? -93.44 -65.77 92 14 TRP A 27 ? ? -122.30 -169.15 93 14 THR A 59 ? ? -81.21 45.84 94 14 ASP A 60 ? ? -152.09 -48.94 95 14 ILE A 71 ? ? -69.75 92.90 96 14 SER A 73 ? ? 73.21 -175.81 97 14 LYS A 81 ? ? -161.91 77.51 98 14 LEU A 106 ? ? -95.43 -88.52 99 15 ASP A 9 ? ? -59.95 -73.45 100 15 VAL A 15 ? ? -100.88 -60.21 101 15 GLU A 17 ? ? -77.98 34.98 102 15 LYS A 49 ? ? -41.60 -74.21 103 15 CYS A 86 ? ? -114.81 -82.25 104 15 LEU A 106 ? ? -112.93 -92.00 105 16 ASP A 9 ? ? -57.31 -70.86 106 16 LEU A 16 ? ? -70.38 -71.03 107 16 GLU A 17 ? ? -78.88 48.41 108 16 ASP A 50 ? ? 71.30 -52.62 109 16 ASN A 64 ? ? -50.85 -70.38 110 16 SER A 73 ? ? 64.52 -160.15 111 16 CYS A 86 ? ? -128.70 -57.37 112 17 ASP A 9 ? ? -65.68 -77.76 113 17 GLU A 17 ? ? -77.51 33.22 114 17 LYS A 51 ? ? -132.47 -54.26 115 17 THR A 59 ? ? -82.61 47.59 116 17 ASP A 60 ? ? -152.19 -46.59 117 17 SER A 73 ? ? 163.30 150.93 118 18 ASP A 9 ? ? -56.69 -73.34 119 18 GLU A 17 ? ? -77.81 49.61 120 18 ASP A 50 ? ? -62.16 -92.78 121 18 LYS A 51 ? ? -161.17 110.41 122 18 ASN A 64 ? ? -40.78 -75.23 123 18 CYS A 86 ? ? -150.59 -80.17 124 18 ALA A 92 ? ? 64.35 -16.61 125 19 ASP A 9 ? ? -61.05 -71.57 126 19 LEU A 16 ? ? -73.60 -73.01 127 19 GLU A 17 ? ? -79.62 47.09 128 19 LYS A 51 ? ? -149.88 -58.89 129 19 ASN A 64 ? ? -47.37 -70.51 130 19 LEU A 106 ? ? -157.39 87.26 131 20 GLU A 2 ? ? 71.71 -63.03 132 20 VAL A 15 ? ? -129.15 -51.18 133 20 LEU A 16 ? ? -76.71 -70.86 134 20 GLU A 17 ? ? -79.01 40.22 135 20 ASP A 50 ? ? 74.61 -50.09 136 20 ASP A 60 ? ? -148.28 -46.30 137 20 THR A 76 ? ? -160.15 114.43 138 20 CYS A 86 ? ? -100.07 -60.69 139 20 GLU A 87 ? ? -164.47 -168.50 140 21 GLU A 17 ? ? -79.61 41.69 141 21 ASP A 50 ? ? 73.30 -52.10 142 21 LEU A 52 ? ? -146.41 -158.32 143 21 CYS A 86 ? ? -130.53 -50.90 144 21 THR A 88 ? ? -151.81 89.02 145 21 ALA A 92 ? ? 70.90 -43.71 146 21 TYR A 105 ? ? -99.30 30.04 147 21 LEU A 106 ? ? -144.56 -47.25 148 22 ASP A 9 ? ? -61.22 -72.01 149 22 VAL A 15 ? ? -95.90 -64.65 150 22 GLU A 17 ? ? -78.36 41.98 151 22 SER A 19 ? ? -128.20 -65.45 152 22 ALA A 28 ? ? -170.41 142.73 153 22 LYS A 51 ? ? -127.96 -55.04 154 22 LYS A 81 ? ? -100.14 -137.29 155 22 ALA A 92 ? ? 70.12 -31.10 156 22 LEU A 106 ? ? -103.54 66.11 157 23 ALA A 3 ? ? -67.45 74.61 158 23 GLU A 17 ? ? -79.84 42.32 159 23 GLU A 47 ? ? -67.47 -70.27 160 23 TYR A 48 ? ? -86.86 48.46 161 23 ASP A 50 ? ? -70.08 -72.44 162 23 ASP A 60 ? ? -150.89 -48.67 163 23 SER A 62 ? ? -115.87 53.13 164 23 ASN A 64 ? ? -49.14 -70.56 165 23 CYS A 86 ? ? -110.82 -71.06 166 23 ALA A 92 ? ? -67.85 82.71 167 23 LEU A 106 ? ? -157.65 85.58 168 24 GLU A 17 ? ? -79.44 48.70 169 24 SER A 19 ? ? -91.26 -72.05 170 24 ASN A 64 ? ? -29.09 -75.07 171 24 LEU A 106 ? ? -117.47 -99.98 172 25 GLU A 2 ? ? 70.56 -66.51 173 25 LEU A 16 ? ? -66.40 -73.57 174 25 SER A 18 ? ? -87.60 -139.50 175 25 SER A 19 ? ? -160.68 -68.66 176 25 ALA A 28 ? ? -173.38 141.46 177 25 TRP A 30 ? ? 137.31 -29.51 178 25 CYS A 31 ? ? -68.78 88.53 179 25 ASP A 50 ? ? 72.18 -46.53 180 25 THR A 59 ? ? -84.22 49.86 181 25 ASP A 60 ? ? -162.12 -42.15 182 25 CYS A 86 ? ? -138.90 -66.08 183 25 ALA A 92 ? ? -65.94 66.29 184 26 ASP A 9 ? ? 172.76 -76.83 185 26 VAL A 15 ? ? -93.20 -61.33 186 26 GLU A 17 ? ? -79.59 43.75 187 26 SER A 19 ? ? -120.34 -73.34 188 26 ALA A 28 ? ? -170.06 149.32 189 26 ASP A 50 ? ? 74.92 -55.44 190 26 ASN A 64 ? ? -38.46 -72.55 191 26 CYS A 86 ? ? -108.65 -62.46 192 26 LEU A 106 ? ? -129.60 -56.27 193 27 ALA A 3 ? ? -65.65 70.55 194 27 ASP A 9 ? ? -63.33 -78.57 195 27 VAL A 15 ? ? -132.49 -66.51 196 27 LYS A 51 ? ? -140.22 -55.51 197 27 LEU A 52 ? ? -78.57 -169.13 198 27 SER A 62 ? ? -119.19 51.03 199 27 ASN A 64 ? ? -44.34 -72.41 200 27 ILE A 71 ? ? -100.18 -169.21 201 27 ARG A 72 ? ? -158.80 -84.81 202 27 CYS A 86 ? ? -138.46 -80.39 203 28 ASP A 9 ? ? -57.38 -70.55 204 28 VAL A 15 ? ? -108.69 -69.46 205 28 ASP A 50 ? ? 71.64 -48.45 206 28 ARG A 72 ? ? -148.67 -71.08 207 28 LYS A 81 ? ? -153.31 -154.90 208 28 CYS A 86 ? ? -109.36 -60.45 209 28 LEU A 106 ? ? -153.32 83.88 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 48 ? ? 0.159 'SIDE CHAIN' 2 2 ARG A 35 ? ? 0.131 'SIDE CHAIN' 3 3 PHE A 26 ? ? 0.106 'SIDE CHAIN' 4 3 TYR A 48 ? ? 0.067 'SIDE CHAIN' 5 3 TYR A 69 ? ? 0.104 'SIDE CHAIN' 6 4 TYR A 105 ? ? 0.106 'SIDE CHAIN' 7 5 TYR A 48 ? ? 0.095 'SIDE CHAIN' 8 5 TYR A 69 ? ? 0.113 'SIDE CHAIN' 9 6 TYR A 105 ? ? 0.109 'SIDE CHAIN' 10 7 TYR A 48 ? ? 0.071 'SIDE CHAIN' 11 8 TYR A 69 ? ? 0.095 'SIDE CHAIN' 12 8 TYR A 105 ? ? 0.091 'SIDE CHAIN' 13 9 TYR A 105 ? ? 0.089 'SIDE CHAIN' 14 10 TYR A 69 ? ? 0.092 'SIDE CHAIN' 15 11 TYR A 48 ? ? 0.130 'SIDE CHAIN' 16 12 TYR A 105 ? ? 0.088 'SIDE CHAIN' 17 14 TYR A 48 ? ? 0.103 'SIDE CHAIN' 18 14 TYR A 69 ? ? 0.081 'SIDE CHAIN' 19 15 TYR A 48 ? ? 0.072 'SIDE CHAIN' 20 15 TYR A 69 ? ? 0.102 'SIDE CHAIN' 21 16 TYR A 105 ? ? 0.140 'SIDE CHAIN' 22 17 TYR A 48 ? ? 0.089 'SIDE CHAIN' 23 17 TYR A 69 ? ? 0.086 'SIDE CHAIN' 24 19 TYR A 48 ? ? 0.150 'SIDE CHAIN' 25 19 TYR A 69 ? ? 0.091 'SIDE CHAIN' 26 20 TYR A 69 ? ? 0.119 'SIDE CHAIN' 27 20 TYR A 105 ? ? 0.101 'SIDE CHAIN' 28 21 TYR A 69 ? ? 0.066 'SIDE CHAIN' 29 22 TYR A 69 ? ? 0.085 'SIDE CHAIN' 30 23 TYR A 48 ? ? 0.130 'SIDE CHAIN' 31 23 TYR A 69 ? ? 0.111 'SIDE CHAIN' 32 24 TYR A 48 ? ? 0.091 'SIDE CHAIN' 33 24 TYR A 69 ? ? 0.071 'SIDE CHAIN' 34 24 TYR A 105 ? ? 0.086 'SIDE CHAIN' 35 25 TYR A 69 ? ? 0.107 'SIDE CHAIN' 36 26 TYR A 48 ? ? 0.166 'SIDE CHAIN' 37 26 TYR A 69 ? ? 0.081 'SIDE CHAIN' 38 27 TYR A 69 ? ? 0.122 'SIDE CHAIN' 39 28 TYR A 48 ? ? 0.094 'SIDE CHAIN' 40 28 TYR A 69 ? ? 0.090 'SIDE CHAIN' 41 28 TYR A 105 ? ? 0.092 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1DBY _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 28 _pdbx_nmr_ensemble.conformer_selection_criteria ;STRUCTURES WITH ACCEPTABLE COVALENT GEOMETRY. STRUCTURES WITH FAVORABLE NON- BOND ENERGY. STRUCTURES WITH THE LEAST RESTRAINT VIOLATIONS. STRUCTURES WITH THE LOWEST ENERGY. ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1DBY _pdbx_nmr_representative.conformer_id 16 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;2-3 MM THIOREDOXIN M (OXIDIZED) U-15N; 100 MM POTASSIUM PHOSPHATE BUFFER PH 5.8; 90% H2O 10% D20 ; ? 2 ;2-3 MM THIOREDOXIN M (OXIDIZED);100 MM POTASSIUM PHOSPHATE BUFFER PH 5.8; 90% H2O 10% D20 ; ? 3 ;2-3 MM THIOREDOXIN M (OXIDIZED);100 MM POTASSIUM PHOSPHATE BUFFER PH 5.8; 100% D20 ; ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 311 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM POTASSIUM PHOSPHATE' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-SEPARATED_NOESY 1 2 1 3D-SEPARATED-TOCSY 1 3 1 '2D NOESY' 2 4 1 '2D NOESY' 3 5 1 TOCSY 2 # _pdbx_nmr_details.entry_id 1DBY _pdbx_nmr_details.text ;THE STRUCTURE WAS DETERMINED USING 2D HOMONUCLEAR IN H20 AND 100% D2O AND 3D- 15N SEPARATED NOESY AND TOCSY DATA. ; # _pdbx_nmr_refine.entry_id 1DBY _pdbx_nmr_refine.method ;SIMULATED ANNEALING STARTING FROM A RANDOM ARRAY OF ATOMS. HIGH TEMPERATURE SIMULATED ANNEALING. RESTRAINED MOLECULAR DYNAMIC AT ROOM TEMPERATURE. ; _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON 1372 TOTAL INTERPROTON DISTANCE RESTRAINTS, 1348 ARE DERIVED FROM NOE DATA AND 44 DERIVED FROM SLOW DEUTERIUM EXCHANGE EXPERIMENTS OF HYDROGEN BONDED AMIDE PROTONS IN REGULAR SECONDARY STRUCTURE MOTIFS. THE RESTRAINT SET INCLUDES 102 DIHEDRAL RESTRAINTS, 66 PHI, 34 KHI1, 2 KHI2. FINAL STRUCTURES ARE REFINED AGAINST THE FULL DESCRIPTION OF AMBER4 FORCE FIELD WITH REDUCED CHARGES FOR FORMALLY CHARGED GROUPS AS ARG, LYS, ASP, GLU RESIDUES. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.0 'BRUKER SPECTROSPIN AG' 1 'data analysis' Felix 2.3 'BIOSYM TECHNOLOGIES' 2 processing NMRPipe 1.7 DELAGLIO 3 'structure solution' Discover 2.3.0 'BIOSYM TECHNOLOGIES' 4 collection UXNMR 940501.3 'BRUKER SPECTROSPIN AG' 5 processing Gifa 4.0 DELSUC 6 refinement Discover 2.3.0 'BIOSYM TECHNOLOGIES' 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TRP N N N N 297 TRP CA C N S 298 TRP C C N N 299 TRP O O N N 300 TRP CB C N N 301 TRP CG C Y N 302 TRP CD1 C Y N 303 TRP CD2 C Y N 304 TRP NE1 N Y N 305 TRP CE2 C Y N 306 TRP CE3 C Y N 307 TRP CZ2 C Y N 308 TRP CZ3 C Y N 309 TRP CH2 C Y N 310 TRP OXT O N N 311 TRP H H N N 312 TRP H2 H N N 313 TRP HA H N N 314 TRP HB2 H N N 315 TRP HB3 H N N 316 TRP HD1 H N N 317 TRP HE1 H N N 318 TRP HE3 H N N 319 TRP HZ2 H N N 320 TRP HZ3 H N N 321 TRP HH2 H N N 322 TRP HXT H N N 323 TYR N N N N 324 TYR CA C N S 325 TYR C C N N 326 TYR O O N N 327 TYR CB C N N 328 TYR CG C Y N 329 TYR CD1 C Y N 330 TYR CD2 C Y N 331 TYR CE1 C Y N 332 TYR CE2 C Y N 333 TYR CZ C Y N 334 TYR OH O N N 335 TYR OXT O N N 336 TYR H H N N 337 TYR H2 H N N 338 TYR HA H N N 339 TYR HB2 H N N 340 TYR HB3 H N N 341 TYR HD1 H N N 342 TYR HD2 H N N 343 TYR HE1 H N N 344 TYR HE2 H N N 345 TYR HH H N N 346 TYR HXT H N N 347 VAL N N N N 348 VAL CA C N S 349 VAL C C N N 350 VAL O O N N 351 VAL CB C N N 352 VAL CG1 C N N 353 VAL CG2 C N N 354 VAL OXT O N N 355 VAL H H N N 356 VAL H2 H N N 357 VAL HA H N N 358 VAL HB H N N 359 VAL HG11 H N N 360 VAL HG12 H N N 361 VAL HG13 H N N 362 VAL HG21 H N N 363 VAL HG22 H N N 364 VAL HG23 H N N 365 VAL HXT H N N 366 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AMX Bruker 600 ? 2 DRX Bruker 500 ? # _atom_sites.entry_id 1DBY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_