data_1DC8 # _entry.id 1DC8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DC8 pdb_00001dc8 10.2210/pdb1dc8/pdb RCSB RCSB009966 ? ? WWPDB D_1000009966 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1NTR 'THREE-DIMENSIONAL SOLUTION STRUCTURE OF THE N-TERMINAL RECEIVER DOMAIN OF NTRC' unspecified PDB 1DC7 'UNPHOSPHORYLATED NTRC RECEIVER DOMAIN' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DC8 _pdbx_database_status.recvd_initial_deposition_date 1999-11-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kern, D.' 1 'Volkman, B.F.' 2 'Luginbuhl, P.' 3 'Nohaile, M.J.' 4 'Kustu, S.' 5 'Wemmer, D.E.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of a transiently phosphorylated switch in bacterial signal transduction.' Nature 402 894 898 1999 NATUAS UK 0028-0836 0006 ? 10622255 10.1038/47273 1 'Three-Dimensional Solution Structure of the N-Terminal Receiver Domain of NTRC' Biochemistry 34 1413 1424 1995 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kern, D.' 1 ? primary 'Volkman, B.F.' 2 ? primary 'Luginbuhl, P.' 3 ? primary 'Nohaile, M.J.' 4 ? primary 'Kustu, S.' 5 ? primary 'Wemmer, D.E.' 6 ? 1 'Volkman, B.F.' 7 ? 1 'Nohaile, M.J.' 8 ? 1 'Amy, N.K.' 9 ? 1 'Kustu, S.' 10 ? 1 'Wemmer, D.E.' 11 ? # _cell.entry_id 1DC8 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DC8 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'NITROGEN REGULATION PROTEIN' _entity.formula_weight 13716.585 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'D54(ASQ)' _entity.pdbx_fragment 'N-TERMINAL RECEIVER DOMAIN(1-124)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name NTRC # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLS(PHD)IRMPGMDGLALLKQIKQRHPML PVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE ; _entity_poly.pdbx_seq_one_letter_code_can ;MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVII MTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 ARG n 1 4 GLY n 1 5 ILE n 1 6 VAL n 1 7 TRP n 1 8 VAL n 1 9 VAL n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 SER n 1 14 SER n 1 15 ILE n 1 16 ARG n 1 17 TRP n 1 18 VAL n 1 19 LEU n 1 20 GLU n 1 21 ARG n 1 22 ALA n 1 23 LEU n 1 24 ALA n 1 25 GLY n 1 26 ALA n 1 27 GLY n 1 28 LEU n 1 29 THR n 1 30 CYS n 1 31 THR n 1 32 THR n 1 33 PHE n 1 34 GLU n 1 35 ASN n 1 36 GLY n 1 37 ASN n 1 38 GLU n 1 39 VAL n 1 40 LEU n 1 41 ALA n 1 42 ALA n 1 43 LEU n 1 44 ALA n 1 45 SER n 1 46 LYS n 1 47 THR n 1 48 PRO n 1 49 ASP n 1 50 VAL n 1 51 LEU n 1 52 LEU n 1 53 SER n 1 54 PHD n 1 55 ILE n 1 56 ARG n 1 57 MET n 1 58 PRO n 1 59 GLY n 1 60 MET n 1 61 ASP n 1 62 GLY n 1 63 LEU n 1 64 ALA n 1 65 LEU n 1 66 LEU n 1 67 LYS n 1 68 GLN n 1 69 ILE n 1 70 LYS n 1 71 GLN n 1 72 ARG n 1 73 HIS n 1 74 PRO n 1 75 MET n 1 76 LEU n 1 77 PRO n 1 78 VAL n 1 79 ILE n 1 80 ILE n 1 81 MET n 1 82 THR n 1 83 ALA n 1 84 HIS n 1 85 SER n 1 86 ASP n 1 87 LEU n 1 88 ASP n 1 89 ALA n 1 90 ALA n 1 91 VAL n 1 92 SER n 1 93 ALA n 1 94 TYR n 1 95 GLN n 1 96 GLN n 1 97 GLY n 1 98 ALA n 1 99 PHE n 1 100 ASP n 1 101 TYR n 1 102 LEU n 1 103 PRO n 1 104 LYS n 1 105 PRO n 1 106 PHE n 1 107 ASP n 1 108 ILE n 1 109 ASP n 1 110 GLU n 1 111 ALA n 1 112 VAL n 1 113 ALA n 1 114 LEU n 1 115 VAL n 1 116 GLU n 1 117 ARG n 1 118 ALA n 1 119 ILE n 1 120 SER n 1 121 HIS n 1 122 TYR n 1 123 GLN n 1 124 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Salmonella _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella typhimurium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 602 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PJES592 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NTRC_SALTY _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P41789 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DC8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 124 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P41789 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 124 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 124 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1DC8 _struct_ref_seq_dif.mon_id PHD _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 54 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P41789 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 54 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 54 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHD 'L-peptide linking' n 'ASPARTYL PHOSPHATE' ? 'C4 H8 N O7 P' 213.083 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-SEPARATED_NOESY 1 2 1 3D_13C-SEPARATED_NOESY 2 3 1 '2D NOESY' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.75 _pdbx_nmr_exptl_sample_conditions.ionic_strength '250-500 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;0.3 MM NTRC(1-124) U-15N; 200 MM SODIUM PHOSPHATE, PH 6.75; 50 MM MAGNESIUM CHLORIDE; 200 MM CARBAMOYLPHOSPHATE ; ? 2 ;0.3 MM NTRC(1-124) U-15N,13C; 200 MM SODIUM PHOSPHATE, PH 6.75; 50 MM MAGNESIUM CHLORIDE; 200 MM CARBAMOYLPHOSPHATE ; ? 3 ;0.3 MM NTRC(1-124) U-15N; 200 MM SODIUM PHOSPHATE, PH 6.75; 50 MM MAGNESIUM CHLORIDE; 200 MM CARBAMOYLPHOSPHATE ; ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 600 ? 2 DMX Bruker 750 ? # _pdbx_nmr_refine.entry_id 1DC8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;STRUCTURE BASED ON A TOTAL OF 1301 UNIQUE DISTANCE CONSTRAINTS (OBTAINED FROM 3095 NOE CROSSPEAKS), INCLUDING 374 INTRARESIDUE, 405 SHORT-RANGE, 228 MEDIUM RANGE AND 294 LONG-RANGE CONSTRAINTS. DYANA 1.5 ANNEAL COMMAND (10000 STEPS) USED TO GENERATE 40 CONFORMERS. 20 LOWEST TARGET FUNCTION STRUCTURES ANALYZED. CONFORMER 4 CHOSEN FOR DEPOSITION AS CLOSEST TO MEAN COORDINATES OF THE ENSEMBLE. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1DC8 _pdbx_nmr_details.text ;PHOSPHORYLATION (>95%) COULD BE MAINTAINED FOR 36 HR. TO OBTAIN SUFFICIENT S/N IN 3D NOESY EXPERIMENTS, MULTIPLE (TYPICALLY 4) COMPLETE 3D DATASETS WERE ACQUIRED ON FRESHLY PREPARED SAMPLES AND THEN COADDED TO YIELD HIGH-QUALITY DATASETS FOR STRUCTURE DETERMINATION. ; # _pdbx_nmr_ensemble.entry_id 1DC8 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1DC8 _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' DYANA 1.5 'PETER GUENTERT' 1 processing Felix 95.0 MSI 2 collection XwinNMR 1.5 BRUKER 3 'data analysis' DYANA 1.5 'PETER GUENTERT' 4 'data analysis' XEASY 1.3.13 MUMENTHALER 5 refinement DYANA 1.5 'PETER GUENTERT' 6 # _exptl.entry_id 1DC8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1DC8 _struct.title ;STRUCTURE OF A TRANSIENTLY PHOSPHORYLATED "SWITCH" IN BACTERIAL SIGNAL TRANSDUCTION ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DC8 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'RECEIVER DOMAIN, PHOSPHORYLATION, SIGNAL TRANSDUCTION, CONFORMATIONAL REARRANGEMENT, TWO-COMPONENT SYSTEM, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 15 ? ALA A 24 ? ILE A 15 ALA A 24 1 ? 10 HELX_P HELX_P2 2 GLY A 25 ? GLY A 27 ? GLY A 25 GLY A 27 5 ? 3 HELX_P HELX_P3 3 GLY A 36 ? ALA A 42 ? GLY A 36 ALA A 42 1 ? 7 HELX_P HELX_P4 4 GLN A 68 ? HIS A 73 ? GLN A 68 HIS A 73 1 ? 6 HELX_P HELX_P5 5 ILE A 108 ? SER A 120 ? ILE A 108 SER A 120 1 ? 13 HELX_P HELX_P6 6 HIS A 121 ? GLN A 123 ? HIS A 121 GLN A 123 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 53 C ? ? ? 1_555 A PHD 54 N ? ? A SER 53 A PHD 54 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale2 covale both ? A PHD 54 C ? ? ? 1_555 A ILE 55 N ? ? A PHD 54 A ILE 55 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1DC8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DC8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PHD 54 54 54 PHD ASP A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 GLU 124 124 124 GLU GLU A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PHD _pdbx_struct_mod_residue.label_seq_id 54 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PHD _pdbx_struct_mod_residue.auth_seq_id 54 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id ASP _pdbx_struct_mod_residue.details 'ASPARTYL PHOSPHATE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-01-05 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2022-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 108 ? ? H A VAL 112 ? ? 1.49 2 1 O A ILE 15 ? ? H A LEU 19 ? ? 1.54 3 1 O A ASP 109 ? ? H A ALA 113 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 11 ? ? -166.49 31.46 2 1 ASP A 12 ? ? -62.13 -79.73 3 1 SER A 13 ? ? -154.99 -44.69 4 1 SER A 14 ? ? -174.95 41.73 5 1 LEU A 28 ? ? 174.95 147.88 6 1 THR A 29 ? ? 55.61 109.33 7 1 GLU A 34 ? ? -95.82 -76.87 8 1 ASN A 37 ? ? -59.81 -74.16 9 1 LYS A 46 ? ? -97.65 -78.25 10 1 THR A 47 ? ? 71.31 103.78 11 1 PRO A 48 ? ? -75.00 -162.46 12 1 LEU A 52 ? ? -104.78 -157.62 13 1 SER A 53 ? ? 167.01 89.73 14 1 ILE A 55 ? ? -176.04 -146.17 15 1 ARG A 56 ? ? 175.50 38.98 16 1 MET A 60 ? ? -139.57 -82.26 17 1 ASP A 61 ? ? 50.41 165.04 18 1 ALA A 64 ? ? 34.23 -139.33 19 1 LEU A 65 ? ? -46.19 -89.98 20 1 LEU A 66 ? ? 154.84 -25.20 21 1 LYS A 67 ? ? -80.13 -72.39 22 1 LYS A 70 ? ? -52.23 -91.81 23 1 HIS A 73 ? ? -165.39 84.00 24 1 ILE A 79 ? ? 35.37 -147.73 25 1 THR A 82 ? ? 161.85 120.67 26 1 ALA A 83 ? ? -83.93 -143.94 27 1 HIS A 84 ? ? 45.96 -156.80 28 1 ASP A 86 ? ? 179.30 55.69 29 1 VAL A 91 ? ? -137.62 -60.26 30 1 GLN A 95 ? ? -179.06 44.94 31 1 GLN A 96 ? ? -174.47 -89.93 32 1 ALA A 98 ? ? 93.97 131.98 33 1 TYR A 101 ? ? -176.29 140.97 34 1 LYS A 104 ? ? 55.52 171.30 35 1 PHE A 106 ? ? -51.61 -171.52 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHD 54 ? P ? A PHD 54 P 2 1 Y 1 A PHD 54 ? OP1 ? A PHD 54 OP1 3 1 Y 1 A PHD 54 ? OP2 ? A PHD 54 OP2 4 1 Y 1 A PHD 54 ? OP3 ? A PHD 54 OP3 #