data_1DCF # _entry.id 1DCF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1DCF RCSB RCSB009969 WWPDB D_1000009969 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DCF _pdbx_database_status.recvd_initial_deposition_date 1999-11-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Muller-Dieckmann, H.J.' 1 'Grantz, A.' 2 'Kim, S.H.' 3 # _citation.id primary _citation.title 'The structure of the signal receiver domain of the Arabidopsis thaliana ethylene receptor ETR1.' _citation.journal_abbrev 'Structure Fold.Des.' _citation.journal_volume 7 _citation.page_first 1547 _citation.page_last 1556 _citation.year 1999 _citation.journal_id_ASTM FODEFH _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 1263 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10647185 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(00)88345-8' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Muller-Dieckmann, H.J.' 1 primary 'Grantz, A.A.' 2 primary 'Kim, S.H.' 3 # _cell.entry_id 1DCF _cell.length_a 47.92 _cell.length_b 47.92 _cell.length_c 111.79 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 90 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1DCF _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ETR1 PROTEIN' 15304.866 1 2.7.3.- ? 'RECEIVER DOMAIN' ? 2 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HMSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDVCMPGVENYQIALRIHEKFTKQR HQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPRVLYEGM ; _entity_poly.pdbx_seq_one_letter_code_can ;HMSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDVCMPGVENYQIALRIHEKFTKQR HQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPRVLYEGM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 MET n 1 3 SER n 1 4 ASN n 1 5 PHE n 1 6 THR n 1 7 GLY n 1 8 LEU n 1 9 LYS n 1 10 VAL n 1 11 LEU n 1 12 VAL n 1 13 MET n 1 14 ASP n 1 15 GLU n 1 16 ASN n 1 17 GLY n 1 18 VAL n 1 19 SER n 1 20 ARG n 1 21 MET n 1 22 VAL n 1 23 THR n 1 24 LYS n 1 25 GLY n 1 26 LEU n 1 27 LEU n 1 28 VAL n 1 29 HIS n 1 30 LEU n 1 31 GLY n 1 32 CYS n 1 33 GLU n 1 34 VAL n 1 35 THR n 1 36 THR n 1 37 VAL n 1 38 SER n 1 39 SER n 1 40 ASN n 1 41 GLU n 1 42 GLU n 1 43 CYS n 1 44 LEU n 1 45 ARG n 1 46 VAL n 1 47 VAL n 1 48 SER n 1 49 HIS n 1 50 GLU n 1 51 HIS n 1 52 LYS n 1 53 VAL n 1 54 VAL n 1 55 PHE n 1 56 MET n 1 57 ASP n 1 58 VAL n 1 59 CYS n 1 60 MET n 1 61 PRO n 1 62 GLY n 1 63 VAL n 1 64 GLU n 1 65 ASN n 1 66 TYR n 1 67 GLN n 1 68 ILE n 1 69 ALA n 1 70 LEU n 1 71 ARG n 1 72 ILE n 1 73 HIS n 1 74 GLU n 1 75 LYS n 1 76 PHE n 1 77 THR n 1 78 LYS n 1 79 GLN n 1 80 ARG n 1 81 HIS n 1 82 GLN n 1 83 ARG n 1 84 PRO n 1 85 LEU n 1 86 LEU n 1 87 VAL n 1 88 ALA n 1 89 LEU n 1 90 SER n 1 91 GLY n 1 92 ASN n 1 93 THR n 1 94 ASP n 1 95 LYS n 1 96 SER n 1 97 THR n 1 98 LYS n 1 99 GLU n 1 100 LYS n 1 101 CYS n 1 102 MET n 1 103 SER n 1 104 PHE n 1 105 GLY n 1 106 LEU n 1 107 ASP n 1 108 GLY n 1 109 VAL n 1 110 LEU n 1 111 LEU n 1 112 LYS n 1 113 PRO n 1 114 VAL n 1 115 SER n 1 116 LEU n 1 117 ASP n 1 118 ASN n 1 119 ILE n 1 120 ARG n 1 121 ASP n 1 122 VAL n 1 123 LEU n 1 124 SER n 1 125 ASP n 1 126 LEU n 1 127 LEU n 1 128 GLU n 1 129 PRO n 1 130 ARG n 1 131 VAL n 1 132 LEU n 1 133 TYR n 1 134 GLU n 1 135 GLY n 1 136 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ETR1_ARATH _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P49333 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DCF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 136 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P49333 _struct_ref_seq.db_align_beg 603 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 738 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 136 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1DCF HIS A 1 ? UNP P49333 ARG 603 CONFLICT 1 1 1 1DCF MET A 2 ? UNP P49333 HIS 604 CONFLICT 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1DCF _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_percent_sol 63.4983 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pdbx_details 'Li2SO4, HEPES, pH 7.4, VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 120 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 1996-12-05 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1DCF _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F 1.0 _reflns.d_resolution_low 100. _reflns.d_resolution_high 2.5 _reflns.number_obs 4410 _reflns.number_all 14608 _reflns.percent_possible_obs 87.0 _reflns.pdbx_Rmerge_I_obs 0.0490000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.2 _reflns.B_iso_Wilson_estimate 69 _reflns.pdbx_redundancy 3.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all 93.5 _reflns_shell.Rmerge_I_obs 0.4230000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 3.0 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1DCF _refine.ls_number_reflns_obs 4324 _refine.ls_number_reflns_all 4928 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 500 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 87.7 _refine.ls_R_factor_obs 0.2270000 _refine.ls_R_factor_all 0.2270000 _refine.ls_R_factor_R_work 0.2220000 _refine.ls_R_factor_R_free 0.2709000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 455 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -5.815 _refine.aniso_B[2][2] -5.815 _refine.aniso_B[3][3] 11.630 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'engh & huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1020 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 1061 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 500 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.0065 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.433 ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM ? 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM ? 'X-RAY DIFFRACTION' # _struct.entry_id 1DCF _struct.title 'CRYSTAL STRUCTURE OF THE RECEIVER DOMAIN OF THE ETHYLENE RECEPTOR OF ARABIDOPSIS THALIANA' _struct.pdbx_descriptor 'ETR1 PROTEIN (E.C.2.7.3.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DCF _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'BETA-ALPHA FIVE SANDWICH, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 16 ? LEU A 30 ? ASN A 16 LEU A 30 1 ? 15 HELX_P HELX_P2 2 SER A 39 ? VAL A 47 ? SER A 39 VAL A 47 1 ? 9 HELX_P HELX_P3 3 TYR A 66 ? THR A 77 ? TYR A 66 THR A 77 1 ? 12 HELX_P HELX_P4 4 ASP A 94 ? PHE A 104 ? ASP A 94 PHE A 104 1 ? 11 HELX_P HELX_P5 5 SER A 115 ? GLU A 128 ? SER A 115 GLU A 128 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 112 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 112 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 113 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 113 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.31 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 33 ? VAL A 37 ? GLU A 33 VAL A 37 A 2 LYS A 9 ? MET A 13 ? LYS A 9 MET A 13 A 3 VAL A 53 ? ASP A 57 ? VAL A 53 ASP A 57 A 4 LEU A 85 ? SER A 90 ? LEU A 85 SER A 90 A 5 GLY A 108 ? LEU A 111 ? GLY A 108 LEU A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 33 ? O GLU A 33 N VAL A 10 ? N VAL A 10 A 2 3 N LEU A 11 ? N LEU A 11 O VAL A 53 ? O VAL A 53 A 3 4 N VAL A 54 ? N VAL A 54 O LEU A 85 ? O LEU A 85 A 4 5 N ALA A 88 ? N ALA A 88 O GLY A 108 ? O GLY A 108 # _database_PDB_matrix.entry_id 1DCF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DCF _atom_sites.fract_transf_matrix[1][1] 0.020868 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020868 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008945 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 1 HIS HIS A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU ALA A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLU 41 41 41 GLU ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 LYS 78 78 ? ? ? A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LYS 98 98 98 LYS ALA A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 MET 102 102 102 MET MET A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LEU 111 111 111 LEU ALA A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 TYR 133 133 133 TYR GLY A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLY 135 135 ? ? ? A . n A 1 136 MET 136 136 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 1001 1001 HOH WAT A . B 2 HOH 2 1002 1002 HOH WAT A . B 2 HOH 3 1003 1003 HOH WAT A . B 2 HOH 4 1004 1004 HOH WAT A . B 2 HOH 5 1005 1005 HOH WAT A . B 2 HOH 6 1006 1006 HOH WAT A . B 2 HOH 7 1007 1007 HOH WAT A . B 2 HOH 8 1008 1008 HOH WAT A . B 2 HOH 9 1009 1009 HOH WAT A . B 2 HOH 10 1010 1010 HOH WAT A . B 2 HOH 11 1011 1011 HOH WAT A . B 2 HOH 12 1012 1012 HOH WAT A . B 2 HOH 13 1013 1013 HOH WAT A . B 2 HOH 14 1014 1014 HOH WAT A . B 2 HOH 15 1015 1015 HOH WAT A . B 2 HOH 16 1016 1016 HOH WAT A . B 2 HOH 17 1017 1017 HOH WAT A . B 2 HOH 18 1018 1018 HOH WAT A . B 2 HOH 19 1019 1019 HOH WAT A . B 2 HOH 20 1020 1020 HOH WAT A . B 2 HOH 21 1021 1021 HOH WAT A . B 2 HOH 22 1022 1022 HOH WAT A . B 2 HOH 23 1023 1023 HOH WAT A . B 2 HOH 24 1024 1024 HOH WAT A . B 2 HOH 25 1025 1025 HOH WAT A . B 2 HOH 26 1026 1026 HOH WAT A . B 2 HOH 27 1027 1027 HOH WAT A . B 2 HOH 28 1028 1028 HOH WAT A . B 2 HOH 29 1029 1029 HOH WAT A . B 2 HOH 30 1030 1030 HOH WAT A . B 2 HOH 31 1031 1031 HOH WAT A . B 2 HOH 32 1032 1032 HOH WAT A . B 2 HOH 33 1033 1033 HOH WAT A . B 2 HOH 34 1034 1034 HOH WAT A . B 2 HOH 35 1035 1035 HOH WAT A . B 2 HOH 36 1036 1036 HOH WAT A . B 2 HOH 37 1037 1037 HOH WAT A . B 2 HOH 38 1038 1038 HOH WAT A . B 2 HOH 39 1039 1039 HOH WAT A . B 2 HOH 40 1040 1040 HOH WAT A . B 2 HOH 41 1041 1041 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 55.8950000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-01-04 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2016-12-14 5 'Structure model' 1 4 2017-10-04 6 'Structure model' 1 5 2018-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Other 4 5 'Structure model' 'Refinement description' 5 6 'Structure model' 'Experimental preparation' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' software 2 6 'Structure model' exptl_crystal_grow # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 6 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_exptl_crystal_grow.temp' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SOLVE phasing . ? 1 CNS refinement . ? 2 SCALEPACK 'data scaling' . ? 3 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 94 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -57.75 _pdbx_validate_torsion.psi 177.15 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 15 ? CG ? A GLU 15 CG 2 1 Y 1 A GLU 15 ? CD ? A GLU 15 CD 3 1 Y 1 A GLU 15 ? OE1 ? A GLU 15 OE1 4 1 Y 1 A GLU 15 ? OE2 ? A GLU 15 OE2 5 1 Y 1 A GLU 41 ? CG ? A GLU 41 CG 6 1 Y 1 A GLU 41 ? CD ? A GLU 41 CD 7 1 Y 1 A GLU 41 ? OE1 ? A GLU 41 OE1 8 1 Y 1 A GLU 41 ? OE2 ? A GLU 41 OE2 9 1 Y 1 A LYS 98 ? CG ? A LYS 98 CG 10 1 Y 1 A LYS 98 ? CD ? A LYS 98 CD 11 1 Y 1 A LYS 98 ? CE ? A LYS 98 CE 12 1 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 13 1 Y 1 A LEU 111 ? CG ? A LEU 111 CG 14 1 Y 1 A LEU 111 ? CD1 ? A LEU 111 CD1 15 1 Y 1 A LEU 111 ? CD2 ? A LEU 111 CD2 16 1 Y 1 A TYR 133 ? CB ? A TYR 133 CB 17 1 Y 1 A TYR 133 ? CG ? A TYR 133 CG 18 1 Y 1 A TYR 133 ? CD1 ? A TYR 133 CD1 19 1 Y 1 A TYR 133 ? CD2 ? A TYR 133 CD2 20 1 Y 1 A TYR 133 ? CE1 ? A TYR 133 CE1 21 1 Y 1 A TYR 133 ? CE2 ? A TYR 133 CE2 22 1 Y 1 A TYR 133 ? CZ ? A TYR 133 CZ 23 1 Y 1 A TYR 133 ? OH ? A TYR 133 OH # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 78 ? A LYS 78 2 1 Y 1 A GLY 135 ? A GLY 135 3 1 Y 1 A MET 136 ? A MET 136 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #