data_1DHT # _entry.id 1DHT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DHT pdb_00001dht 10.2210/pdb1dht/pdb WWPDB D_1000172791 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DHT _pdbx_database_status.recvd_initial_deposition_date 1998-03-25 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Han, Q.' 1 'Campbell, R.L.' 2 'Gangloff, A.' 3 'Lin, S.X.' 4 # _citation.id primary _citation.title ;Dehydroepiandrosterone and dihydrotestosterone recognition by human estrogenic 17beta-hydroxysteroid dehydrogenase. C-18/c-19 steroid discrimination and enzyme-induced strain. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 275 _citation.page_first 1105 _citation.page_last 1111 _citation.year 2000 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10625652 _citation.pdbx_database_id_DOI 10.1074/jbc.275.2.1105 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Han, Q.' 1 ? primary 'Campbell, R.L.' 2 ? primary 'Gangloff, A.' 3 ? primary 'Huang, Y.W.' 4 ? primary 'Lin, S.X.' 5 ? # _cell.entry_id 1DHT _cell.length_a 123.660 _cell.length_b 45.190 _cell.length_c 61.300 _cell.angle_alpha 90.00 _cell.angle_beta 99.10 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DHT _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ESTROGENIC 17-BETA HYDROXYSTEROID DEHYDROGENASE' 34887.828 1 1.1.1.62 ? ? ? 2 non-polymer syn 5-ALPHA-DIHYDROTESTOSTERONE 290.440 1 ? ? ? ? 3 water nat water 18.015 52 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLETLQLDVRDSKSVAAARERVT EGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKF ALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVF LTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRSAVGDPELG DPPAAPQ ; _entity_poly.pdbx_seq_one_letter_code_can ;ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLETLQLDVRDSKSVAAARERVT EGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKF ALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVF LTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRSAVGDPELG DPPAAPQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ARG n 1 3 THR n 1 4 VAL n 1 5 VAL n 1 6 LEU n 1 7 ILE n 1 8 THR n 1 9 GLY n 1 10 CYS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 ILE n 1 15 GLY n 1 16 LEU n 1 17 HIS n 1 18 LEU n 1 19 ALA n 1 20 VAL n 1 21 ARG n 1 22 LEU n 1 23 ALA n 1 24 SER n 1 25 ASP n 1 26 PRO n 1 27 SER n 1 28 GLN n 1 29 SER n 1 30 PHE n 1 31 LYS n 1 32 VAL n 1 33 TYR n 1 34 ALA n 1 35 THR n 1 36 LEU n 1 37 ARG n 1 38 ASP n 1 39 LEU n 1 40 LYS n 1 41 THR n 1 42 GLN n 1 43 GLY n 1 44 ARG n 1 45 LEU n 1 46 TRP n 1 47 GLU n 1 48 ALA n 1 49 ALA n 1 50 ARG n 1 51 ALA n 1 52 LEU n 1 53 ALA n 1 54 CYS n 1 55 PRO n 1 56 PRO n 1 57 GLY n 1 58 SER n 1 59 LEU n 1 60 GLU n 1 61 THR n 1 62 LEU n 1 63 GLN n 1 64 LEU n 1 65 ASP n 1 66 VAL n 1 67 ARG n 1 68 ASP n 1 69 SER n 1 70 LYS n 1 71 SER n 1 72 VAL n 1 73 ALA n 1 74 ALA n 1 75 ALA n 1 76 ARG n 1 77 GLU n 1 78 ARG n 1 79 VAL n 1 80 THR n 1 81 GLU n 1 82 GLY n 1 83 ARG n 1 84 VAL n 1 85 ASP n 1 86 VAL n 1 87 LEU n 1 88 VAL n 1 89 CYS n 1 90 ASN n 1 91 ALA n 1 92 GLY n 1 93 LEU n 1 94 GLY n 1 95 LEU n 1 96 LEU n 1 97 GLY n 1 98 PRO n 1 99 LEU n 1 100 GLU n 1 101 ALA n 1 102 LEU n 1 103 GLY n 1 104 GLU n 1 105 ASP n 1 106 ALA n 1 107 VAL n 1 108 ALA n 1 109 SER n 1 110 VAL n 1 111 LEU n 1 112 ASP n 1 113 VAL n 1 114 ASN n 1 115 VAL n 1 116 VAL n 1 117 GLY n 1 118 THR n 1 119 VAL n 1 120 ARG n 1 121 MET n 1 122 LEU n 1 123 GLN n 1 124 ALA n 1 125 PHE n 1 126 LEU n 1 127 PRO n 1 128 ASP n 1 129 MET n 1 130 LYS n 1 131 ARG n 1 132 ARG n 1 133 GLY n 1 134 SER n 1 135 GLY n 1 136 ARG n 1 137 VAL n 1 138 LEU n 1 139 VAL n 1 140 THR n 1 141 GLY n 1 142 SER n 1 143 VAL n 1 144 GLY n 1 145 GLY n 1 146 LEU n 1 147 MET n 1 148 GLY n 1 149 LEU n 1 150 PRO n 1 151 PHE n 1 152 ASN n 1 153 ASP n 1 154 VAL n 1 155 TYR n 1 156 CYS n 1 157 ALA n 1 158 SER n 1 159 LYS n 1 160 PHE n 1 161 ALA n 1 162 LEU n 1 163 GLU n 1 164 GLY n 1 165 LEU n 1 166 CYS n 1 167 GLU n 1 168 SER n 1 169 LEU n 1 170 ALA n 1 171 VAL n 1 172 LEU n 1 173 LEU n 1 174 LEU n 1 175 PRO n 1 176 PHE n 1 177 GLY n 1 178 VAL n 1 179 HIS n 1 180 LEU n 1 181 SER n 1 182 LEU n 1 183 ILE n 1 184 GLU n 1 185 CYS n 1 186 GLY n 1 187 PRO n 1 188 VAL n 1 189 HIS n 1 190 THR n 1 191 ALA n 1 192 PHE n 1 193 MET n 1 194 GLU n 1 195 LYS n 1 196 VAL n 1 197 LEU n 1 198 GLY n 1 199 SER n 1 200 PRO n 1 201 GLU n 1 202 GLU n 1 203 VAL n 1 204 LEU n 1 205 ASP n 1 206 ARG n 1 207 THR n 1 208 ASP n 1 209 ILE n 1 210 HIS n 1 211 THR n 1 212 PHE n 1 213 HIS n 1 214 ARG n 1 215 PHE n 1 216 TYR n 1 217 GLN n 1 218 TYR n 1 219 LEU n 1 220 ALA n 1 221 HIS n 1 222 SER n 1 223 LYS n 1 224 GLN n 1 225 VAL n 1 226 PHE n 1 227 ARG n 1 228 GLU n 1 229 ALA n 1 230 ALA n 1 231 GLN n 1 232 ASN n 1 233 PRO n 1 234 GLU n 1 235 GLU n 1 236 VAL n 1 237 ALA n 1 238 GLU n 1 239 VAL n 1 240 PHE n 1 241 LEU n 1 242 THR n 1 243 ALA n 1 244 LEU n 1 245 ARG n 1 246 ALA n 1 247 PRO n 1 248 LYS n 1 249 PRO n 1 250 THR n 1 251 LEU n 1 252 ARG n 1 253 TYR n 1 254 PHE n 1 255 THR n 1 256 THR n 1 257 GLU n 1 258 ARG n 1 259 PHE n 1 260 LEU n 1 261 PRO n 1 262 LEU n 1 263 LEU n 1 264 ARG n 1 265 MET n 1 266 ARG n 1 267 LEU n 1 268 ASP n 1 269 ASP n 1 270 PRO n 1 271 SER n 1 272 GLY n 1 273 SER n 1 274 ASN n 1 275 TYR n 1 276 VAL n 1 277 THR n 1 278 ALA n 1 279 MET n 1 280 HIS n 1 281 ARG n 1 282 GLU n 1 283 VAL n 1 284 PHE n 1 285 GLY n 1 286 ASP n 1 287 VAL n 1 288 PRO n 1 289 ALA n 1 290 LYS n 1 291 ALA n 1 292 GLU n 1 293 ALA n 1 294 GLY n 1 295 ALA n 1 296 GLU n 1 297 ALA n 1 298 GLY n 1 299 GLY n 1 300 GLY n 1 301 ALA n 1 302 GLY n 1 303 PRO n 1 304 GLY n 1 305 ALA n 1 306 GLU n 1 307 ASP n 1 308 GLU n 1 309 ALA n 1 310 GLY n 1 311 ARG n 1 312 SER n 1 313 ALA n 1 314 VAL n 1 315 GLY n 1 316 ASP n 1 317 PRO n 1 318 GLU n 1 319 LEU n 1 320 GLY n 1 321 ASP n 1 322 PRO n 1 323 PRO n 1 324 ALA n 1 325 ALA n 1 326 PRO n 1 327 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ PLACENTA _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DHB1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P14061 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLETLQLDVRDSKSVAAARERVT EGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKF ALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVF LTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGGGAGPGAEDEAGRSAVGDPELG DPPAAPQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DHT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 327 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P14061 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 327 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 327 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DHT non-polymer . 5-ALPHA-DIHYDROTESTOSTERONE ? 'C19 H30 O2' 290.440 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1DHT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_percent_sol 49.0 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.20 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.20' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector ? _diffrn_detector.type ? _diffrn_detector.pdbx_collection_date 1997-02 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X12C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X12C _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1DHT _reflns.observed_criterion_sigma_I 2.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.000 _reflns.d_resolution_high 2.000 _reflns.number_obs 14692 _reflns.number_all ? _reflns.percent_possible_obs 97.0 _reflns.pdbx_Rmerge_I_obs 0.0380000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.700 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.24 _reflns_shell.d_res_low 2.34 _reflns_shell.percent_possible_all 96.0 _reflns_shell.Rmerge_I_obs 0.0410000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1DHT _refine.ls_number_reflns_obs 14692 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.000 _refine.pdbx_data_cutoff_high_absF 2.240 _refine.pdbx_data_cutoff_low_absF 8.0000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.00 _refine.ls_d_res_high 2.24 _refine.ls_percent_reflns_obs 40.0 _refine.ls_R_factor_obs 0.1880000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1880000 _refine.ls_R_factor_R_free 0.2790000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1IOL' _refine.pdbx_method_to_determine_struct 'DIFFERENCE FOURIER' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2177 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 2250 _refine_hist.d_res_high 2.24 _refine_hist.d_res_low 8.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.014 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 2.10 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.24 _refine_ls_shell.d_res_low ? _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.R_factor_R_work ? _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 1DHT _struct.title 'ESTROGENIC 17-BETA HYDROXYSTEROID DEHYDROGENASE COMPLEXED DIHYDROTESTOSTERONE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DHT _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'SHORT-CHAIN DEHYDROGENASE, OXIDOREDUCTASE, STEROID, DIHYDROTESTOSTERONE, DHT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 13 ? ALA A 23 ? GLY A 13 ALA A 23 1 ? 11 HELX_P HELX_P2 2 LEU A 39 ? THR A 41 ? LEU A 39 THR A 41 5 ? 3 HELX_P HELX_P3 3 GLY A 43 ? ALA A 51 ? GLY A 43 ALA A 51 1 ? 9 HELX_P HELX_P4 4 SER A 69 ? ARG A 78 ? SER A 69 ARG A 78 1 ? 10 HELX_P HELX_P5 5 LEU A 99 ? ALA A 101 ? LEU A 99 ALA A 101 5 ? 3 HELX_P HELX_P6 6 GLU A 104 ? ASN A 114 ? GLU A 104 ASN A 114 1 ? 11 HELX_P HELX_P7 7 VAL A 116 ? ARG A 131 ? VAL A 116 ARG A 131 1 ? 16 HELX_P HELX_P8 8 VAL A 143 ? GLY A 145 ? VAL A 143 GLY A 145 5 ? 3 HELX_P HELX_P9 9 ASP A 153 ? PHE A 176 ? ASP A 153 PHE A 176 1 ? 24 HELX_P HELX_P10 10 MET A 193 ? VAL A 196 ? MET A 193 VAL A 196 1 ? 4 HELX_P HELX_P11 11 GLU A 201 ? ARG A 206 ? GLU A 201 ARG A 206 1 ? 6 HELX_P HELX_P12 12 ILE A 209 ? ALA A 229 ? ILE A 209 ALA A 229 1 ? 21 HELX_P HELX_P13 13 PRO A 233 ? ARG A 245 ? PRO A 233 ARG A 245 1 ? 13 HELX_P HELX_P14 14 LEU A 260 ? LEU A 267 ? LEU A 260 LEU A 267 1 ? 8 HELX_P HELX_P15 15 SER A 273 ? GLU A 282 ? SER A 273 GLU A 282 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel A 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 252 ? PHE A 254 ? ARG A 252 PHE A 254 A 2 VAL A 178 ? GLU A 184 ? VAL A 178 GLU A 184 A 3 GLY A 135 ? THR A 140 ? GLY A 135 THR A 140 A 4 VAL A 86 ? CYS A 89 ? VAL A 86 CYS A 89 A 5 THR A 3 ? ILE A 7 ? THR A 3 ILE A 7 A 6 PHE A 30 ? LEU A 36 ? PHE A 30 LEU A 36 A 7 LEU A 59 ? GLN A 63 ? LEU A 59 GLN A 63 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 253 ? O TYR A 253 N LEU A 182 ? N LEU A 182 A 2 3 O HIS A 179 ? O HIS A 179 N GLY A 135 ? N GLY A 135 A 3 4 O ARG A 136 ? O ARG A 136 N LEU A 87 ? N LEU A 87 A 4 5 O VAL A 86 ? O VAL A 86 N LEU A 6 ? N LEU A 6 A 5 6 O THR A 3 ? O THR A 3 N LYS A 31 ? N LYS A 31 A 6 7 O VAL A 32 ? O VAL A 32 N GLU A 60 ? N GLU A 60 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id DHT _struct_site.pdbx_auth_seq_id 400 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE DHT A 400' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 SER A 142 ? SER A 142 . ? 1_555 ? 2 AC1 11 VAL A 143 ? VAL A 143 . ? 1_555 ? 3 AC1 11 LEU A 149 ? LEU A 149 . ? 1_555 ? 4 AC1 11 TYR A 155 ? TYR A 155 . ? 1_555 ? 5 AC1 11 PRO A 187 ? PRO A 187 . ? 1_555 ? 6 AC1 11 TYR A 218 ? TYR A 218 . ? 1_555 ? 7 AC1 11 HIS A 221 ? HIS A 221 . ? 1_555 ? 8 AC1 11 PHE A 259 ? PHE A 259 . ? 1_555 ? 9 AC1 11 MET A 279 ? MET A 279 . ? 1_555 ? 10 AC1 11 GLU A 282 ? GLU A 282 . ? 1_555 ? 11 AC1 11 VAL A 283 ? VAL A 283 . ? 1_555 ? # _database_PDB_matrix.entry_id 1DHT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DHT _atom_sites.fract_transf_matrix[1][1] 0.008087 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001295 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022129 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016521 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 MET 129 129 129 MET MET A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 MET 147 147 147 MET MET A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 CYS 156 156 156 CYS CYS A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 CYS 166 166 166 CYS CYS A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 PHE 176 176 176 PHE PHE A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 HIS 179 179 179 HIS HIS A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 CYS 185 185 185 CYS CYS A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 HIS 189 189 189 HIS HIS A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 MET 193 193 193 MET MET A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 VAL 203 203 203 VAL VAL A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 HIS 210 210 210 HIS HIS A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 PHE 212 212 212 PHE PHE A . n A 1 213 HIS 213 213 213 HIS HIS A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 PHE 215 215 215 PHE PHE A . n A 1 216 TYR 216 216 216 TYR TYR A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 TYR 218 218 218 TYR TYR A . n A 1 219 LEU 219 219 219 LEU LEU A . n A 1 220 ALA 220 220 220 ALA ALA A . n A 1 221 HIS 221 221 221 HIS HIS A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 LYS 223 223 223 LYS LYS A . n A 1 224 GLN 224 224 224 GLN GLN A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 ALA 230 230 230 ALA ALA A . n A 1 231 GLN 231 231 231 GLN GLN A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 PRO 233 233 233 PRO PRO A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 GLU 235 235 235 GLU GLU A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 GLU 238 238 238 GLU GLU A . n A 1 239 VAL 239 239 239 VAL VAL A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 THR 242 242 242 THR THR A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 ALA 246 246 246 ALA ALA A . n A 1 247 PRO 247 247 247 PRO PRO A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 PRO 249 249 249 PRO PRO A . n A 1 250 THR 250 250 250 THR THR A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 ARG 252 252 252 ARG ARG A . n A 1 253 TYR 253 253 253 TYR TYR A . n A 1 254 PHE 254 254 254 PHE PHE A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 THR 256 256 256 THR THR A . n A 1 257 GLU 257 257 257 GLU GLU A . n A 1 258 ARG 258 258 258 ARG ARG A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 PRO 261 261 261 PRO PRO A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 ARG 264 264 264 ARG ARG A . n A 1 265 MET 265 265 265 MET MET A . n A 1 266 ARG 266 266 266 ARG ARG A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 ASP 268 268 268 ASP ASP A . n A 1 269 ASP 269 269 269 ASP ASP A . n A 1 270 PRO 270 270 270 PRO PRO A . n A 1 271 SER 271 271 271 SER SER A . n A 1 272 GLY 272 272 272 GLY GLY A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 ASN 274 274 274 ASN ASN A . n A 1 275 TYR 275 275 275 TYR TYR A . n A 1 276 VAL 276 276 276 VAL VAL A . n A 1 277 THR 277 277 277 THR THR A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 MET 279 279 279 MET MET A . n A 1 280 HIS 280 280 280 HIS HIS A . n A 1 281 ARG 281 281 281 ARG ARG A . n A 1 282 GLU 282 282 282 GLU GLU A . n A 1 283 VAL 283 283 283 VAL VAL A . n A 1 284 PHE 284 284 284 PHE PHE A . n A 1 285 GLY 285 285 ? ? ? A . n A 1 286 ASP 286 286 ? ? ? A . n A 1 287 VAL 287 287 ? ? ? A . n A 1 288 PRO 288 288 ? ? ? A . n A 1 289 ALA 289 289 ? ? ? A . n A 1 290 LYS 290 290 ? ? ? A . n A 1 291 ALA 291 291 ? ? ? A . n A 1 292 GLU 292 292 ? ? ? A . n A 1 293 ALA 293 293 ? ? ? A . n A 1 294 GLY 294 294 ? ? ? A . n A 1 295 ALA 295 295 ? ? ? A . n A 1 296 GLU 296 296 ? ? ? A . n A 1 297 ALA 297 297 ? ? ? A . n A 1 298 GLY 298 298 ? ? ? A . n A 1 299 GLY 299 299 ? ? ? A . n A 1 300 GLY 300 300 ? ? ? A . n A 1 301 ALA 301 301 ? ? ? A . n A 1 302 GLY 302 302 ? ? ? A . n A 1 303 PRO 303 303 ? ? ? A . n A 1 304 GLY 304 304 ? ? ? A . n A 1 305 ALA 305 305 ? ? ? A . n A 1 306 GLU 306 306 ? ? ? A . n A 1 307 ASP 307 307 ? ? ? A . n A 1 308 GLU 308 308 ? ? ? A . n A 1 309 ALA 309 309 ? ? ? A . n A 1 310 GLY 310 310 ? ? ? A . n A 1 311 ARG 311 311 ? ? ? A . n A 1 312 SER 312 312 ? ? ? A . n A 1 313 ALA 313 313 ? ? ? A . n A 1 314 VAL 314 314 ? ? ? A . n A 1 315 GLY 315 315 ? ? ? A . n A 1 316 ASP 316 316 ? ? ? A . n A 1 317 PRO 317 317 ? ? ? A . n A 1 318 GLU 318 318 ? ? ? A . n A 1 319 LEU 319 319 ? ? ? A . n A 1 320 GLY 320 320 ? ? ? A . n A 1 321 ASP 321 321 ? ? ? A . n A 1 322 PRO 322 322 ? ? ? A . n A 1 323 PRO 323 323 ? ? ? A . n A 1 324 ALA 324 324 ? ? ? A . n A 1 325 ALA 325 325 ? ? ? A . n A 1 326 PRO 326 326 ? ? ? A . n A 1 327 GLN 327 327 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DHT 1 400 400 DHT DHT A . C 3 HOH 1 1001 1001 HOH HOH A . C 3 HOH 2 1002 1002 HOH HOH A . C 3 HOH 3 1003 1003 HOH HOH A . C 3 HOH 4 1004 1004 HOH HOH A . C 3 HOH 5 1005 1005 HOH HOH A . C 3 HOH 6 1007 1007 HOH HOH A . C 3 HOH 7 1009 1009 HOH HOH A . C 3 HOH 8 1010 1010 HOH HOH A . C 3 HOH 9 1011 1011 HOH HOH A . C 3 HOH 10 1012 1012 HOH HOH A . C 3 HOH 11 1013 1013 HOH HOH A . C 3 HOH 12 1025 1025 HOH HOH A . C 3 HOH 13 1026 1026 HOH HOH A . C 3 HOH 14 1027 1027 HOH HOH A . C 3 HOH 15 1038 1038 HOH HOH A . C 3 HOH 16 1050 1050 HOH HOH A . C 3 HOH 17 1053 1053 HOH HOH A . C 3 HOH 18 1054 1054 HOH HOH A . C 3 HOH 19 1056 1056 HOH HOH A . C 3 HOH 20 1058 1058 HOH HOH A . C 3 HOH 21 1059 1059 HOH HOH A . C 3 HOH 22 1060 1060 HOH HOH A . C 3 HOH 23 1067 1067 HOH HOH A . C 3 HOH 24 1068 1068 HOH HOH A . C 3 HOH 25 1070 1070 HOH HOH A . C 3 HOH 26 1071 1071 HOH HOH A . C 3 HOH 27 1072 1072 HOH HOH A . C 3 HOH 28 1073 1073 HOH HOH A . C 3 HOH 29 1074 1074 HOH HOH A . C 3 HOH 30 1075 1075 HOH HOH A . C 3 HOH 31 1078 1078 HOH HOH A . C 3 HOH 32 1079 1079 HOH HOH A . C 3 HOH 33 1082 1082 HOH HOH A . C 3 HOH 34 1085 1085 HOH HOH A . C 3 HOH 35 1086 1086 HOH HOH A . C 3 HOH 36 1087 1087 HOH HOH A . C 3 HOH 37 1094 1094 HOH HOH A . C 3 HOH 38 1099 1099 HOH HOH A . C 3 HOH 39 1103 1103 HOH HOH A . C 3 HOH 40 1105 1105 HOH HOH A . C 3 HOH 41 1106 1106 HOH HOH A . C 3 HOH 42 1112 1112 HOH HOH A . C 3 HOH 43 1115 1115 HOH HOH A . C 3 HOH 44 1150 1150 HOH HOH A . C 3 HOH 45 1152 1152 HOH HOH A . C 3 HOH 46 1154 1154 HOH HOH A . C 3 HOH 47 1159 1159 HOH HOH A . C 3 HOH 48 1167 1167 HOH HOH A . C 3 HOH 49 1181 1181 HOH HOH A . C 3 HOH 50 1205 1205 HOH HOH A . C 3 HOH 51 1206 1206 HOH HOH A . C 3 HOH 52 1210 1210 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6840 ? 1 MORE -35 ? 1 'SSA (A^2)' 21890 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-09-25 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_initial_refinement_model 4 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 SCALEPACK 'data scaling' . ? 3 X-PLOR phasing 3.1 ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 CE1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HIS _pdbx_validate_symm_contact.auth_seq_id_1 213 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 CE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HIS _pdbx_validate_symm_contact.auth_seq_id_2 213 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_554 _pdbx_validate_symm_contact.dist 1.47 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 112 ? ? CG A ASP 112 ? ? OD2 A ASP 112 ? ? 112.82 118.30 -5.48 0.90 N 2 1 NE A ARG 206 ? ? CZ A ARG 206 ? ? NH2 A ARG 206 ? ? 123.91 120.30 3.61 0.50 N 3 1 NE A ARG 214 ? ? CZ A ARG 214 ? ? NH2 A ARG 214 ? ? 123.75 120.30 3.45 0.50 N 4 1 NE A ARG 227 ? ? CZ A ARG 227 ? ? NH2 A ARG 227 ? ? 123.68 120.30 3.38 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 40 ? ? -65.00 2.10 2 1 GLU A 81 ? ? -64.01 4.80 3 1 ARG A 83 ? ? 179.71 146.76 4 1 LEU A 95 ? ? -164.76 119.75 5 1 VAL A 115 ? ? -100.76 -61.97 6 1 HIS A 189 ? ? -30.52 108.39 7 1 PRO A 200 ? ? -74.02 -108.29 8 1 ASP A 269 ? ? -158.69 83.97 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 285 ? A GLY 285 2 1 Y 1 A ASP 286 ? A ASP 286 3 1 Y 1 A VAL 287 ? A VAL 287 4 1 Y 1 A PRO 288 ? A PRO 288 5 1 Y 1 A ALA 289 ? A ALA 289 6 1 Y 1 A LYS 290 ? A LYS 290 7 1 Y 1 A ALA 291 ? A ALA 291 8 1 Y 1 A GLU 292 ? A GLU 292 9 1 Y 1 A ALA 293 ? A ALA 293 10 1 Y 1 A GLY 294 ? A GLY 294 11 1 Y 1 A ALA 295 ? A ALA 295 12 1 Y 1 A GLU 296 ? A GLU 296 13 1 Y 1 A ALA 297 ? A ALA 297 14 1 Y 1 A GLY 298 ? A GLY 298 15 1 Y 1 A GLY 299 ? A GLY 299 16 1 Y 1 A GLY 300 ? A GLY 300 17 1 Y 1 A ALA 301 ? A ALA 301 18 1 Y 1 A GLY 302 ? A GLY 302 19 1 Y 1 A PRO 303 ? A PRO 303 20 1 Y 1 A GLY 304 ? A GLY 304 21 1 Y 1 A ALA 305 ? A ALA 305 22 1 Y 1 A GLU 306 ? A GLU 306 23 1 Y 1 A ASP 307 ? A ASP 307 24 1 Y 1 A GLU 308 ? A GLU 308 25 1 Y 1 A ALA 309 ? A ALA 309 26 1 Y 1 A GLY 310 ? A GLY 310 27 1 Y 1 A ARG 311 ? A ARG 311 28 1 Y 1 A SER 312 ? A SER 312 29 1 Y 1 A ALA 313 ? A ALA 313 30 1 Y 1 A VAL 314 ? A VAL 314 31 1 Y 1 A GLY 315 ? A GLY 315 32 1 Y 1 A ASP 316 ? A ASP 316 33 1 Y 1 A PRO 317 ? A PRO 317 34 1 Y 1 A GLU 318 ? A GLU 318 35 1 Y 1 A LEU 319 ? A LEU 319 36 1 Y 1 A GLY 320 ? A GLY 320 37 1 Y 1 A ASP 321 ? A ASP 321 38 1 Y 1 A PRO 322 ? A PRO 322 39 1 Y 1 A PRO 323 ? A PRO 323 40 1 Y 1 A ALA 324 ? A ALA 324 41 1 Y 1 A ALA 325 ? A ALA 325 42 1 Y 1 A PRO 326 ? A PRO 326 43 1 Y 1 A GLN 327 ? A GLN 327 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 5-ALPHA-DIHYDROTESTOSTERONE DHT 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1IOL _pdbx_initial_refinement_model.details 'PDB ENTRY 1IOL' #