data_1DIS # _entry.id 1DIS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DIS pdb_00001dis 10.2210/pdb1dis/pdb WWPDB D_1000172806 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1DIU _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DIS _pdbx_database_status.recvd_initial_deposition_date 1995-08-01 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Morgan, W.D.' 1 'Birdsall, B.' 2 'Polshakov, V.I.' 3 'Sali, D.' 4 'Kompis, I.' 5 'Feeney, J.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of a brodimoprim analogue in its complex with Lactobacillus casei dihydrofolate reductase.' Biochemistry 34 11690 11702 1995 BICHAW US 0006-2960 0033 ? 7547901 10.1021/bi00037a006 1 'Solution Structure of Bound Trimethoprim in its Complex with Lactobacillus Casei Dihydrofolate Reductase' Biochemistry 33 12416 ? 1994 BICHAW US 0006-2960 0033 ? ? ? 2 ;A 1H NMR Study of the Interactions and Conformations of Rationally Designed Brodimoprim Analogues in Complexes with Lactobacillus Casei Dihydrofolate Reductase ; J.Med.Chem. 27 1672 ? 1984 JMCMAR US 0022-2623 0151 ? ? ? 3 ;Crystal Structures of Escherichia Coli and Lactobacillus Casei Dihydrofolate Reductase Refined at 1.7 Angstroms Resolution. I. General Features and Binding of Methotrexate ; J.Biol.Chem. 257 13650 ? 1982 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Morgan, W.D.' 1 ? primary 'Birdsall, B.' 2 ? primary 'Polshakov, V.I.' 3 ? primary 'Sali, D.' 4 ? primary 'Kompis, I.' 5 ? primary 'Feeney, J.' 6 ? 1 'Martorell, G.' 7 ? 1 'Gradwell, M.J.' 8 ? 1 'Birdsall, B.' 9 ? 1 'Bauer, C.J.' 10 ? 1 'Frenkiel, T.A.' 11 ? 1 'Cheung, H.T.A.' 12 ? 1 'Polshakov, V.I.' 13 ? 1 'Kuyper, L.' 14 ? 1 'Feeney, J.' 15 ? 2 'Birdsall, B.' 16 ? 2 'Feeney, J.' 17 ? 2 'Pascual, C.' 18 ? 2 'Roberts, G.C.K.' 19 ? 2 'Kompis, I.' 20 ? 2 'Then, R.L.' 21 ? 2 'Mueller, K.' 22 ? 2 'Kroehn, A.' 23 ? 3 'Bolin, J.T.' 24 ? 3 'Filman, D.J.' 25 ? 3 'Matthews, D.A.' 26 ? 3 'Hamlin, R.C.' 27 ? 3 'Kraut, J.' 28 ? # _cell.entry_id 1DIS _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DIS _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DIHYDROFOLATE REDUCTASE' 18331.594 1 1.5.1.3 ? ? ? 2 non-polymer syn BRODIMOPRIM-4,6-DICARBOXYLATE 496.332 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVA AVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQK KA ; _entity_poly.pdbx_seq_one_letter_code_can ;TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVA AVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQK KA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ALA n 1 3 PHE n 1 4 LEU n 1 5 TRP n 1 6 ALA n 1 7 GLN n 1 8 ASP n 1 9 ARG n 1 10 ASP n 1 11 GLY n 1 12 LEU n 1 13 ILE n 1 14 GLY n 1 15 LYS n 1 16 ASP n 1 17 GLY n 1 18 HIS n 1 19 LEU n 1 20 PRO n 1 21 TRP n 1 22 HIS n 1 23 LEU n 1 24 PRO n 1 25 ASP n 1 26 ASP n 1 27 LEU n 1 28 HIS n 1 29 TYR n 1 30 PHE n 1 31 ARG n 1 32 ALA n 1 33 GLN n 1 34 THR n 1 35 VAL n 1 36 GLY n 1 37 LYS n 1 38 ILE n 1 39 MET n 1 40 VAL n 1 41 VAL n 1 42 GLY n 1 43 ARG n 1 44 ARG n 1 45 THR n 1 46 TYR n 1 47 GLU n 1 48 SER n 1 49 PHE n 1 50 PRO n 1 51 LYS n 1 52 ARG n 1 53 PRO n 1 54 LEU n 1 55 PRO n 1 56 GLU n 1 57 ARG n 1 58 THR n 1 59 ASN n 1 60 VAL n 1 61 VAL n 1 62 LEU n 1 63 THR n 1 64 HIS n 1 65 GLN n 1 66 GLU n 1 67 ASP n 1 68 TYR n 1 69 GLN n 1 70 ALA n 1 71 GLN n 1 72 GLY n 1 73 ALA n 1 74 VAL n 1 75 VAL n 1 76 VAL n 1 77 HIS n 1 78 ASP n 1 79 VAL n 1 80 ALA n 1 81 ALA n 1 82 VAL n 1 83 PHE n 1 84 ALA n 1 85 TYR n 1 86 ALA n 1 87 LYS n 1 88 GLN n 1 89 HIS n 1 90 PRO n 1 91 ASP n 1 92 GLN n 1 93 GLU n 1 94 LEU n 1 95 VAL n 1 96 ILE n 1 97 ALA n 1 98 GLY n 1 99 GLY n 1 100 ALA n 1 101 GLN n 1 102 ILE n 1 103 PHE n 1 104 THR n 1 105 ALA n 1 106 PHE n 1 107 LYS n 1 108 ASP n 1 109 ASP n 1 110 VAL n 1 111 ASP n 1 112 THR n 1 113 LEU n 1 114 LEU n 1 115 VAL n 1 116 THR n 1 117 ARG n 1 118 LEU n 1 119 ALA n 1 120 GLY n 1 121 SER n 1 122 PHE n 1 123 GLU n 1 124 GLY n 1 125 ASP n 1 126 THR n 1 127 LYS n 1 128 MET n 1 129 ILE n 1 130 PRO n 1 131 LEU n 1 132 ASN n 1 133 TRP n 1 134 ASP n 1 135 ASP n 1 136 PHE n 1 137 THR n 1 138 LYS n 1 139 VAL n 1 140 SER n 1 141 SER n 1 142 ARG n 1 143 THR n 1 144 VAL n 1 145 GLU n 1 146 ASP n 1 147 THR n 1 148 ASN n 1 149 PRO n 1 150 ALA n 1 151 LEU n 1 152 THR n 1 153 HIS n 1 154 THR n 1 155 TYR n 1 156 GLU n 1 157 VAL n 1 158 TRP n 1 159 GLN n 1 160 LYS n 1 161 LYS n 1 162 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lactobacillus _entity_src_gen.pdbx_gene_src_gene POTENTIAL _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain METHOTREXATE-RESISTANT _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactobacillus casei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1582 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DYR_LACCA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00381 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;TAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTNVVLTHQEDYQAQGAVVVHDVA AVFAYAKQHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQK KA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DIS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00381 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 162 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BDM non-polymer . BRODIMOPRIM-4,6-DICARBOXYLATE ? 'C20 H24 Br N4 O6 -1' 496.332 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1DIS _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name Discover _pdbx_nmr_software.version ? _pdbx_nmr_software.authors ? _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1DIS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1DIS _struct.title 'DIHYDROFOLATE REDUCTASE (E.C.1.5.1.3) COMPLEX WITH BRODIMOPRIM-4,6-DICARBOXYLATE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DIS _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'INHIBITOR-ENZYME COMPLEX, OXIDO-REDUCTASE, OXIDOREDUCTASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 HB PRO A 24 ? GLN A 33 ? PRO A 24 GLN A 33 1 ? 10 HELX_P HELX_P2 HC ARG A 43 ? SER A 48 ? ARG A 43 SER A 48 1 ? 6 HELX_P HELX_P3 HE VAL A 79 ? GLN A 88 ? VAL A 79 GLN A 88 1 ? 10 HELX_P HELX_P4 HF GLY A 99 ? PHE A 106 ? GLY A 99 PHE A 106 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 52 A . ? ARG 52 A PRO 53 A ? PRO 53 A 1 -16.45 2 GLY 98 A . ? GLY 98 A GLY 99 A ? GLY 99 A 1 7.98 # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? parallel S1 2 3 ? parallel S1 3 4 ? parallel S1 4 5 ? parallel S1 5 6 ? parallel S1 6 7 ? anti-parallel S1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 VAL A 74 ? VAL A 76 ? VAL A 74 VAL A 76 S1 2 THR A 58 ? LEU A 62 ? THR A 58 LEU A 62 S1 3 ILE A 38 ? GLY A 42 ? ILE A 38 GLY A 42 S1 4 LEU A 94 ? ILE A 96 ? LEU A 94 ILE A 96 S1 5 THR A 1 ? GLN A 7 ? THR A 1 GLN A 7 S1 6 THR A 112 ? LEU A 118 ? THR A 112 LEU A 118 S1 7 HIS A 153 ? LYS A 160 ? HIS A 153 LYS A 160 S1 8 PHE A 136 ? VAL A 144 ? PHE A 136 VAL A 144 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O VAL A 74 ? O VAL A 74 N VAL A 61 ? N VAL A 61 S1 2 3 O THR A 58 ? O THR A 58 N MET A 39 ? N MET A 39 S1 3 4 O ILE A 38 ? O ILE A 38 N VAL A 95 ? N VAL A 95 S1 4 5 O LEU A 94 ? O LEU A 94 N ALA A 2 ? N ALA A 2 S1 5 6 O THR A 1 ? O THR A 1 N THR A 112 ? N THR A 112 S1 6 7 O LEU A 113 ? O LEU A 113 N TRP A 158 ? N TRP A 158 S1 7 8 O GLN A 159 ? O GLN A 159 N PHE A 136 ? N PHE A 136 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id BDM _struct_site.pdbx_auth_seq_id 163 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 14 _struct_site.details 'BINDING SITE FOR RESIDUE BDM A 163' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 14 LEU A 4 ? LEU A 4 . ? 1_555 ? 2 AC1 14 TRP A 5 ? TRP A 5 . ? 1_555 ? 3 AC1 14 ALA A 6 ? ALA A 6 . ? 1_555 ? 4 AC1 14 LEU A 19 ? LEU A 19 . ? 1_555 ? 5 AC1 14 ASP A 26 ? ASP A 26 . ? 1_555 ? 6 AC1 14 LEU A 27 ? LEU A 27 . ? 1_555 ? 7 AC1 14 HIS A 28 ? HIS A 28 . ? 1_555 ? 8 AC1 14 PHE A 30 ? PHE A 30 . ? 1_555 ? 9 AC1 14 ARG A 31 ? ARG A 31 . ? 1_555 ? 10 AC1 14 SER A 48 ? SER A 48 . ? 1_555 ? 11 AC1 14 PHE A 49 ? PHE A 49 . ? 1_555 ? 12 AC1 14 PRO A 50 ? PRO A 50 . ? 1_555 ? 13 AC1 14 ARG A 57 ? ARG A 57 . ? 1_555 ? 14 AC1 14 ALA A 97 ? ALA A 97 . ? 1_555 ? # _database_PDB_matrix.entry_id 1DIS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DIS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'CIS PROLINE - PRO 53' 2 'GLY 98 - GLY 99 OMEGA = 7.98 PEPTIDE BOND DEVIATES SIGNIFICANTLY FROM TRANS CONFORMATION' # loop_ _atom_type.symbol BR C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLN 101 101 101 GLN GLN A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 MET 128 128 128 MET MET A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 TRP 133 133 133 TRP TRP A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 PRO 149 149 149 PRO PRO A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 TYR 155 155 155 TYR TYR A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 TRP 158 158 158 TRP TRP A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ALA 162 162 162 ALA ALA A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id BDM _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 163 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id BDM _pdbx_nonpoly_scheme.auth_mon_id BDM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-11-14 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_keywords 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_keywords.text' 6 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 PHE _pdbx_validate_close_contact.auth_seq_id_1 30 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H152 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 BDM _pdbx_validate_close_contact.auth_seq_id_2 163 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.33 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 18 ? ? CD2 A HIS 18 ? ? 1.410 1.354 0.056 0.009 N 2 1 CG A HIS 22 ? ? CD2 A HIS 22 ? ? 1.409 1.354 0.055 0.009 N 3 1 CG A HIS 28 ? ? CD2 A HIS 28 ? ? 1.410 1.354 0.056 0.009 N 4 1 CG A HIS 64 ? ? CD2 A HIS 64 ? ? 1.409 1.354 0.055 0.009 N 5 1 CG A HIS 77 ? ? CD2 A HIS 77 ? ? 1.410 1.354 0.056 0.009 N 6 1 CG A HIS 89 ? ? CD2 A HIS 89 ? ? 1.409 1.354 0.055 0.009 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 9 ? ? CZ A ARG 9 ? ? NH1 A ARG 9 ? ? 124.04 120.30 3.74 0.50 N 2 1 ND1 A HIS 18 ? ? CE1 A HIS 18 ? ? NE2 A HIS 18 ? ? 119.44 111.50 7.94 1.30 N 3 1 ND1 A HIS 22 ? ? CE1 A HIS 22 ? ? NE2 A HIS 22 ? ? 119.45 111.50 7.95 1.30 N 4 1 ND1 A HIS 28 ? ? CE1 A HIS 28 ? ? NE2 A HIS 28 ? ? 119.49 111.50 7.99 1.30 N 5 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.97 120.30 3.67 0.50 N 6 1 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.06 120.30 3.76 0.50 N 7 1 NE A ARG 44 ? ? CZ A ARG 44 ? ? NH1 A ARG 44 ? ? 124.19 120.30 3.89 0.50 N 8 1 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH1 A ARG 52 ? ? 124.27 120.30 3.97 0.50 N 9 1 NE A ARG 57 ? ? CZ A ARG 57 ? ? NH1 A ARG 57 ? ? 124.04 120.30 3.74 0.50 N 10 1 ND1 A HIS 64 ? ? CE1 A HIS 64 ? ? NE2 A HIS 64 ? ? 119.48 111.50 7.98 1.30 N 11 1 ND1 A HIS 77 ? ? CE1 A HIS 77 ? ? NE2 A HIS 77 ? ? 119.62 111.50 8.12 1.30 N 12 1 ND1 A HIS 89 ? ? CE1 A HIS 89 ? ? NE2 A HIS 89 ? ? 119.52 111.50 8.02 1.30 N 13 1 NE A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 124.03 120.30 3.73 0.50 N 14 1 NE A ARG 142 ? ? CZ A ARG 142 ? ? NH1 A ARG 142 ? ? 124.14 120.30 3.84 0.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 56 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 73.75 _pdbx_validate_torsion.psi -0.71 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name BRODIMOPRIM-4,6-DICARBOXYLATE _pdbx_entity_nonpoly.comp_id BDM #