data_1DO9 # _entry.id 1DO9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DO9 pdb_00001do9 10.2210/pdb1do9/pdb RCSB RCSB010245 ? ? WWPDB D_1000010245 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-01-05 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 16 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 17 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DO9 _pdbx_database_status.recvd_initial_deposition_date 1999-12-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Banci, L.' 1 'Bertini, I.' 2 'Rosato, A.' 3 'Scacchieri, S.' 4 # _citation.id primary _citation.title 'Solution structure of oxidized microsomal rabbit cytochrome b5. Factors determining the heterogeneous binding of the heme.' _citation.journal_abbrev Eur.J.Biochem. _citation.journal_volume 267 _citation.page_first 755 _citation.page_last 766 _citation.year 2000 _citation.journal_id_ASTM EJBCAI _citation.country IX _citation.journal_id_ISSN 0014-2956 _citation.journal_id_CSD 0262 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10651812 _citation.pdbx_database_id_DOI 10.1046/j.1432-1327.2000.01054.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Banci, L.' 1 ? primary 'Bertini, I.' 2 ? primary 'Rosato, A.' 3 ? primary 'Scacchieri, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME B5' 10881.086 1 ? ? 'SOLUBLE DOMAIN' ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELH PDDRSKLSKPMETL ; _entity_poly.pdbx_seq_one_letter_code_can ;DKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELH PDDRSKLSKPMETL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'PROTOPORPHYRIN IX CONTAINING FE' _pdbx_entity_nonpoly.comp_id HEM # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 LYS n 1 3 ASP n 1 4 VAL n 1 5 LYS n 1 6 TYR n 1 7 TYR n 1 8 THR n 1 9 LEU n 1 10 GLU n 1 11 GLU n 1 12 ILE n 1 13 LYS n 1 14 LYS n 1 15 HIS n 1 16 ASN n 1 17 HIS n 1 18 SER n 1 19 LYS n 1 20 SER n 1 21 THR n 1 22 TRP n 1 23 LEU n 1 24 ILE n 1 25 LEU n 1 26 HIS n 1 27 HIS n 1 28 LYS n 1 29 VAL n 1 30 TYR n 1 31 ASP n 1 32 LEU n 1 33 THR n 1 34 LYS n 1 35 PHE n 1 36 LEU n 1 37 GLU n 1 38 GLU n 1 39 HIS n 1 40 PRO n 1 41 GLY n 1 42 GLY n 1 43 GLU n 1 44 GLU n 1 45 VAL n 1 46 LEU n 1 47 ARG n 1 48 GLU n 1 49 GLN n 1 50 ALA n 1 51 GLY n 1 52 GLY n 1 53 ASP n 1 54 ALA n 1 55 THR n 1 56 GLU n 1 57 ASN n 1 58 PHE n 1 59 GLU n 1 60 ASP n 1 61 VAL n 1 62 GLY n 1 63 HIS n 1 64 SER n 1 65 THR n 1 66 ASP n 1 67 ALA n 1 68 ARG n 1 69 GLU n 1 70 LEU n 1 71 SER n 1 72 LYS n 1 73 THR n 1 74 PHE n 1 75 ILE n 1 76 ILE n 1 77 GLY n 1 78 GLU n 1 79 LEU n 1 80 HIS n 1 81 PRO n 1 82 ASP n 1 83 ASP n 1 84 ARG n 1 85 SER n 1 86 LYS n 1 87 LEU n 1 88 SER n 1 89 LYS n 1 90 PRO n 1 91 MET n 1 92 GLU n 1 93 THR n 1 94 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rabbit _entity_src_gen.gene_src_genus Oryctolagus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oryctolagus cuniculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9986 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PKK223 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 LEU 94 94 94 LEU LEU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEM _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 95 _pdbx_nonpoly_scheme.auth_seq_num 95 _pdbx_nonpoly_scheme.pdb_mon_id HEM _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 1DO9 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DO9 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1DO9 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1DO9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1DO9 _struct.title 'SOLUTION STRUCTURE OF OXIDIZED MICROSOMAL RABBIT CYTOCHROME B5. FACTORS DETERMINING THE HETEROGENEOUS BINDING OF THE HEME.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DO9 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'CYTOCHROME, HEME, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYB5_RABIT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00169 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DO9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00169 _struct_ref_seq.db_align_beg 6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 99 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 94 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 8 ? LYS A 13 ? THR A 8 LYS A 13 1 ? 6 HELX_P HELX_P2 2 THR A 33 ? LEU A 36 ? THR A 33 LEU A 36 5 ? 4 HELX_P HELX_P3 3 GLU A 43 ? GLN A 49 ? GLU A 43 GLN A 49 1 ? 7 HELX_P HELX_P4 4 ALA A 54 ? GLY A 62 ? ALA A 54 GLY A 62 1 ? 9 HELX_P HELX_P5 5 SER A 64 ? PHE A 74 ? SER A 64 PHE A 74 1 ? 11 HELX_P HELX_P6 6 HIS A 80 ? ARG A 84 ? HIS A 80 ARG A 84 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 39 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 39 A HEM 95 1_555 ? ? ? ? ? ? ? 2.010 ? ? metalc2 metalc ? ? A HIS 63 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 63 A HEM 95 1_555 ? ? ? ? ? ? ? 2.014 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NA ? B HEM . ? A HEM 95 ? 1_555 91.0 ? 2 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NB ? B HEM . ? A HEM 95 ? 1_555 93.6 ? 3 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NB ? B HEM . ? A HEM 95 ? 1_555 89.1 ? 4 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC ? B HEM . ? A HEM 95 ? 1_555 89.2 ? 5 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC ? B HEM . ? A HEM 95 ? 1_555 178.7 ? 6 NB ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC ? B HEM . ? A HEM 95 ? 1_555 89.6 ? 7 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 87.5 ? 8 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 91.5 ? 9 NB ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 178.8 ? 10 NC ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 89.8 ? 11 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 174.7 ? 12 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 92.2 ? 13 NB ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 90.6 ? 14 NC ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 87.7 ? 15 ND ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 88.3 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 22 ? ILE A 24 ? TRP A 22 ILE A 24 A 2 LYS A 28 ? ASP A 31 ? LYS A 28 ASP A 31 A 3 ILE A 75 ? GLU A 78 ? ILE A 75 GLU A 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 23 ? O LEU A 23 N TYR A 30 ? N TYR A 30 A 2 3 O VAL A 29 ? O VAL A 29 N ILE A 76 ? N ILE A 76 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEM _struct_site.pdbx_auth_seq_id 95 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'BINDING SITE FOR RESIDUE HEM A 95' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 PHE A 35 ? PHE A 35 . ? 1_555 ? 2 AC1 13 HIS A 39 ? HIS A 39 . ? 1_555 ? 3 AC1 13 PRO A 40 ? PRO A 40 . ? 1_555 ? 4 AC1 13 VAL A 45 ? VAL A 45 . ? 1_555 ? 5 AC1 13 LEU A 46 ? LEU A 46 . ? 1_555 ? 6 AC1 13 ALA A 54 ? ALA A 54 . ? 1_555 ? 7 AC1 13 ASN A 57 ? ASN A 57 . ? 1_555 ? 8 AC1 13 VAL A 61 ? VAL A 61 . ? 1_555 ? 9 AC1 13 HIS A 63 ? HIS A 63 . ? 1_555 ? 10 AC1 13 ALA A 67 ? ALA A 67 . ? 1_555 ? 11 AC1 13 LEU A 70 ? LEU A 70 . ? 1_555 ? 12 AC1 13 SER A 71 ? SER A 71 . ? 1_555 ? 13 AC1 13 PHE A 74 ? PHE A 74 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 25 CA A ALA 67 ? ? CB A ALA 67 ? ? 1.779 1.520 0.259 0.021 N 2 39 CA A ALA 67 ? ? CB A ALA 67 ? ? 1.854 1.520 0.334 0.021 N 3 39 CA A ALA 67 ? ? C A ALA 67 ? ? 1.696 1.525 0.171 0.026 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.56 120.80 -4.24 0.70 N 2 2 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.05 120.80 -4.75 0.70 N 3 4 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.40 120.80 -4.40 0.70 N 4 12 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 115.80 120.80 -5.00 0.70 N 5 16 CB A ASP 1 ? ? CA A ASP 1 ? ? C A ASP 1 ? ? 127.59 110.40 17.19 2.00 N 6 16 N A ASP 1 ? ? CA A ASP 1 ? ? CB A ASP 1 ? ? 95.07 110.60 -15.53 1.80 N 7 16 N A ASP 1 ? ? CA A ASP 1 ? ? C A ASP 1 ? ? 90.64 111.00 -20.36 2.70 N 8 17 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.08 120.80 -4.72 0.70 N 9 24 CB A ALA 67 ? ? CA A ALA 67 ? ? C A ALA 67 ? ? 125.73 110.10 15.63 1.50 N 10 25 CB A ALA 67 ? ? CA A ALA 67 ? ? C A ALA 67 ? ? 130.20 110.10 20.10 1.50 N 11 25 O A ALA 67 ? ? C A ALA 67 ? ? N A ARG 68 ? ? 112.10 122.70 -10.60 1.60 Y 12 26 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.08 120.80 -4.72 0.70 N 13 27 N A ASP 1 ? ? CA A ASP 1 ? ? CB A ASP 1 ? ? 99.73 110.60 -10.87 1.80 N 14 28 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 115.73 120.80 -5.07 0.70 N 15 34 CB A ASP 1 ? ? CA A ASP 1 ? ? C A ASP 1 ? ? 128.65 110.40 18.25 2.00 N 16 34 N A ASP 1 ? ? CA A ASP 1 ? ? CB A ASP 1 ? ? 97.57 110.60 -13.03 1.80 N 17 34 N A ASP 1 ? ? CA A ASP 1 ? ? C A ASP 1 ? ? 89.91 111.00 -21.09 2.70 N 18 35 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.06 120.80 -4.74 0.70 N 19 37 CB A PHE 74 ? ? CG A PHE 74 ? ? CD2 A PHE 74 ? ? 116.59 120.80 -4.21 0.70 N 20 39 CB A ALA 67 ? ? CA A ALA 67 ? ? C A ALA 67 ? ? 130.25 110.10 20.15 1.50 N 21 39 O A ALA 67 ? ? C A ALA 67 ? ? N A ARG 68 ? ? 112.09 122.70 -10.61 1.60 Y 22 39 CB A LEU 94 ? ? CA A LEU 94 ? ? C A LEU 94 ? ? 124.36 110.20 14.16 1.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 6 ? ? -31.88 110.36 2 1 HIS A 17 ? ? -125.56 -65.83 3 1 SER A 18 ? ? 172.55 -42.53 4 1 SER A 20 ? ? -151.20 26.08 5 1 THR A 21 ? ? -47.52 92.82 6 1 HIS A 26 ? ? 61.66 78.93 7 1 HIS A 27 ? ? 32.64 46.50 8 1 GLU A 43 ? ? -154.38 -45.75 9 1 LYS A 86 ? ? -155.22 -70.06 10 1 SER A 88 ? ? -154.27 84.03 11 1 PRO A 90 ? ? -76.15 -169.55 12 1 GLU A 92 ? ? 64.71 139.68 13 2 TYR A 6 ? ? -52.29 92.55 14 2 ASN A 16 ? ? -156.57 29.78 15 2 LYS A 19 ? ? 171.75 -22.32 16 2 SER A 20 ? ? -149.69 59.73 17 2 THR A 21 ? ? -66.03 81.71 18 2 HIS A 26 ? ? 70.48 79.07 19 2 HIS A 27 ? ? 30.03 45.93 20 2 HIS A 63 ? ? -49.45 156.39 21 2 HIS A 80 ? ? -58.90 107.50 22 2 LYS A 86 ? ? -140.33 43.37 23 2 SER A 88 ? ? -164.71 63.56 24 2 MET A 91 ? ? 53.58 177.72 25 3 LYS A 2 ? ? -146.65 -57.64 26 3 VAL A 4 ? ? -108.78 -126.97 27 3 TYR A 6 ? ? 44.58 97.95 28 3 HIS A 15 ? ? -80.42 -118.71 29 3 ASN A 16 ? ? 39.44 50.99 30 3 SER A 18 ? ? 56.03 -83.11 31 3 LYS A 19 ? ? -87.11 -70.88 32 3 SER A 20 ? ? -45.33 92.57 33 3 HIS A 26 ? ? 71.53 77.34 34 3 HIS A 27 ? ? 31.19 44.17 35 3 HIS A 63 ? ? -49.81 154.46 36 3 HIS A 80 ? ? -49.25 151.13 37 3 ASP A 82 ? ? 167.26 -31.92 38 3 LYS A 86 ? ? -161.54 -41.21 39 3 LEU A 87 ? ? -62.35 99.60 40 3 SER A 88 ? ? 58.47 174.77 41 3 LYS A 89 ? ? -157.52 86.36 42 4 VAL A 4 ? ? -113.23 -134.91 43 4 TYR A 6 ? ? 38.95 90.85 44 4 HIS A 15 ? ? -95.60 -107.71 45 4 LYS A 19 ? ? -176.46 -30.91 46 4 HIS A 26 ? ? 89.45 73.60 47 4 HIS A 27 ? ? 30.32 50.78 48 4 LEU A 36 ? ? -50.01 -74.37 49 4 GLU A 43 ? ? -138.88 -39.58 50 4 HIS A 63 ? ? 53.48 165.60 51 4 ILE A 75 ? ? -58.36 106.57 52 4 SER A 85 ? ? -154.83 35.61 53 4 LYS A 86 ? ? -151.29 31.90 54 5 TYR A 6 ? ? -31.21 97.57 55 5 HIS A 15 ? ? -90.62 -114.59 56 5 HIS A 17 ? ? -107.43 -69.03 57 5 SER A 18 ? ? 177.58 -42.47 58 5 HIS A 26 ? ? 89.71 76.20 59 5 HIS A 27 ? ? 30.25 50.40 60 5 GLU A 43 ? ? 166.71 -55.18 61 5 HIS A 63 ? ? -40.71 157.48 62 5 ILE A 75 ? ? -47.75 107.98 63 5 SER A 85 ? ? 165.32 42.23 64 5 LYS A 86 ? ? -141.13 -35.97 65 5 LEU A 87 ? ? -48.64 154.36 66 5 SER A 88 ? ? 70.38 101.86 67 6 ASP A 3 ? ? 65.82 -170.77 68 6 TYR A 6 ? ? 60.87 116.54 69 6 HIS A 15 ? ? -89.84 -138.47 70 6 ASN A 16 ? ? 73.18 34.82 71 6 HIS A 17 ? ? -106.43 -75.14 72 6 SER A 18 ? ? -172.82 -29.50 73 6 SER A 20 ? ? -161.68 117.63 74 6 HIS A 26 ? ? 147.59 79.23 75 6 HIS A 27 ? ? 28.92 42.26 76 6 HIS A 63 ? ? 55.04 165.58 77 6 SER A 85 ? ? -175.33 40.41 78 6 LYS A 86 ? ? -142.28 -71.81 79 6 SER A 88 ? ? -163.65 108.21 80 7 LYS A 2 ? ? 51.09 82.72 81 7 TYR A 6 ? ? 38.23 83.13 82 7 HIS A 17 ? ? -133.40 -51.00 83 7 SER A 18 ? ? 164.34 -50.74 84 7 SER A 20 ? ? -173.58 29.21 85 7 THR A 21 ? ? -46.02 89.39 86 7 HIS A 26 ? ? 77.01 -176.22 87 7 HIS A 27 ? ? -66.42 39.20 88 7 LEU A 36 ? ? -50.65 -71.34 89 7 HIS A 63 ? ? 54.62 167.71 90 7 SER A 85 ? ? 100.18 54.66 91 7 LYS A 86 ? ? -144.70 -68.71 92 7 LEU A 87 ? ? 40.17 72.57 93 8 ASP A 3 ? ? -63.29 -173.71 94 8 VAL A 4 ? ? -92.74 -127.54 95 8 TYR A 6 ? ? 39.36 89.51 96 8 HIS A 15 ? ? -104.35 -114.65 97 8 ASN A 16 ? ? 49.99 20.67 98 8 LYS A 19 ? ? -176.59 -25.42 99 8 LEU A 23 ? ? -171.62 -179.72 100 8 HIS A 26 ? ? 74.89 59.33 101 8 HIS A 27 ? ? 32.81 48.23 102 8 LEU A 36 ? ? -42.29 -83.53 103 8 HIS A 63 ? ? -45.11 152.13 104 8 ASP A 82 ? ? 160.81 -32.50 105 8 LYS A 86 ? ? -140.86 -96.39 106 8 LEU A 87 ? ? 42.11 -166.88 107 8 SER A 88 ? ? -174.49 -175.86 108 9 VAL A 4 ? ? -95.81 -125.60 109 9 LYS A 5 ? ? -124.29 -55.79 110 9 TYR A 6 ? ? 46.11 89.16 111 9 LYS A 13 ? ? -79.98 33.78 112 9 ASN A 16 ? ? -170.60 51.85 113 9 HIS A 17 ? ? -141.18 51.08 114 9 SER A 18 ? ? 76.85 -61.75 115 9 LYS A 19 ? ? -75.27 28.62 116 9 SER A 20 ? ? 166.34 43.52 117 9 THR A 21 ? ? -65.62 82.27 118 9 HIS A 26 ? ? 70.20 72.82 119 9 HIS A 27 ? ? 32.14 43.32 120 9 GLU A 43 ? ? -146.72 -52.20 121 9 HIS A 63 ? ? -43.70 154.07 122 9 ASP A 83 ? ? -94.82 35.66 123 9 LYS A 86 ? ? -162.22 -70.05 124 9 LEU A 87 ? ? 55.91 -171.19 125 9 SER A 88 ? ? 61.44 97.68 126 9 MET A 91 ? ? 46.98 87.02 127 10 VAL A 4 ? ? -104.15 79.96 128 10 TYR A 6 ? ? -48.90 97.69 129 10 ASN A 16 ? ? -115.40 50.56 130 10 SER A 18 ? ? -76.79 29.86 131 10 LYS A 19 ? ? -154.11 28.22 132 10 SER A 20 ? ? 162.52 120.92 133 10 HIS A 26 ? ? 57.82 76.54 134 10 HIS A 27 ? ? 33.52 47.23 135 10 GLU A 37 ? ? -77.60 20.50 136 10 GLU A 43 ? ? -146.06 -48.37 137 10 GLU A 56 ? ? -79.97 28.08 138 10 ASN A 57 ? ? -130.13 -66.22 139 10 HIS A 63 ? ? -45.61 -78.35 140 10 SER A 64 ? ? 166.38 168.03 141 10 SER A 85 ? ? 179.42 54.60 142 10 LYS A 86 ? ? -159.85 -65.50 143 10 LYS A 89 ? ? -156.08 73.41 144 11 ASP A 3 ? ? -171.55 -179.95 145 11 VAL A 4 ? ? -125.48 -132.91 146 11 ASN A 16 ? ? -149.28 19.18 147 11 SER A 18 ? ? -62.82 80.23 148 11 LYS A 19 ? ? -176.91 -49.94 149 11 SER A 20 ? ? -152.60 68.30 150 11 THR A 21 ? ? -60.57 83.25 151 11 HIS A 26 ? ? 57.18 72.56 152 11 HIS A 27 ? ? 33.55 50.71 153 11 LEU A 36 ? ? -48.55 -70.45 154 11 GLU A 43 ? ? -138.11 -41.26 155 11 HIS A 63 ? ? 53.23 178.43 156 11 HIS A 80 ? ? -49.82 105.46 157 11 SER A 85 ? ? -148.01 25.09 158 11 LYS A 86 ? ? -151.37 -60.52 159 11 LEU A 87 ? ? 56.94 -174.91 160 11 SER A 88 ? ? 47.44 -144.60 161 11 LYS A 89 ? ? 35.38 59.71 162 12 VAL A 4 ? ? -137.75 -136.58 163 12 LYS A 5 ? ? -140.34 -46.00 164 12 TYR A 6 ? ? 52.50 92.18 165 12 SER A 20 ? ? -152.07 25.77 166 12 THR A 21 ? ? -39.25 95.35 167 12 LEU A 23 ? ? -174.24 -175.30 168 12 HIS A 26 ? ? 82.12 62.96 169 12 HIS A 27 ? ? 34.87 43.00 170 12 HIS A 63 ? ? 54.57 -177.39 171 12 ASP A 82 ? ? -154.41 -60.77 172 13 VAL A 4 ? ? -109.23 -134.10 173 13 HIS A 17 ? ? -137.51 -63.44 174 13 SER A 18 ? ? 164.15 -42.76 175 13 SER A 20 ? ? -151.78 23.51 176 13 THR A 21 ? ? -36.12 88.47 177 13 HIS A 26 ? ? 80.44 77.76 178 13 HIS A 27 ? ? 28.70 46.93 179 13 GLU A 43 ? ? -139.40 -50.92 180 13 HIS A 63 ? ? 51.61 144.08 181 13 ASP A 82 ? ? -176.64 -49.77 182 13 LYS A 86 ? ? -157.70 -54.86 183 13 LYS A 89 ? ? 64.33 68.67 184 14 ASP A 3 ? ? 54.46 -178.18 185 14 VAL A 4 ? ? -132.57 -131.40 186 14 LYS A 5 ? ? -132.46 -31.01 187 14 TYR A 6 ? ? 34.28 82.71 188 14 ASN A 16 ? ? -69.49 72.11 189 14 SER A 18 ? ? 79.82 -55.13 190 14 SER A 20 ? ? -174.72 41.46 191 14 THR A 21 ? ? -45.08 91.55 192 14 HIS A 26 ? ? 64.68 177.30 193 14 HIS A 27 ? ? -48.61 21.08 194 14 SER A 85 ? ? -171.47 32.12 195 14 LYS A 86 ? ? -127.96 -60.16 196 15 VAL A 4 ? ? -116.04 -136.17 197 15 TYR A 6 ? ? 45.61 84.95 198 15 HIS A 15 ? ? -108.49 -127.61 199 15 HIS A 17 ? ? -109.72 -84.70 200 15 SER A 18 ? ? -159.46 -31.32 201 15 HIS A 26 ? ? 65.08 76.77 202 15 HIS A 27 ? ? 29.28 46.34 203 15 GLU A 37 ? ? -74.74 22.91 204 15 GLU A 38 ? ? -140.29 -14.03 205 15 GLU A 43 ? ? -143.47 -45.59 206 15 SER A 85 ? ? 174.19 28.46 207 15 LYS A 86 ? ? -155.26 76.55 208 15 SER A 88 ? ? -159.22 86.57 209 16 TYR A 6 ? ? 48.39 89.44 210 16 HIS A 15 ? ? -88.82 -120.18 211 16 HIS A 17 ? ? -107.74 -80.81 212 16 SER A 18 ? ? -157.36 -42.49 213 16 SER A 20 ? ? -170.28 76.35 214 16 HIS A 26 ? ? 60.93 69.05 215 16 HIS A 27 ? ? 33.82 51.80 216 16 LEU A 36 ? ? -48.39 -76.30 217 16 GLU A 43 ? ? -158.45 -48.01 218 16 HIS A 63 ? ? -43.93 -77.79 219 16 SER A 64 ? ? 165.90 171.21 220 16 ARG A 84 ? ? -91.17 38.00 221 16 SER A 85 ? ? 89.90 49.96 222 16 LYS A 86 ? ? -155.58 56.50 223 16 SER A 88 ? ? 53.81 -176.54 224 16 LYS A 89 ? ? -168.90 113.54 225 16 THR A 93 ? ? -146.35 -59.50 226 17 LYS A 2 ? ? 72.40 63.54 227 17 VAL A 4 ? ? -107.62 -131.45 228 17 TYR A 6 ? ? 30.53 86.58 229 17 ASN A 16 ? ? -119.54 78.28 230 17 LYS A 19 ? ? -115.46 -73.09 231 17 SER A 20 ? ? -37.98 109.90 232 17 HIS A 26 ? ? 57.68 177.06 233 17 HIS A 27 ? ? -41.45 29.84 234 17 HIS A 63 ? ? 54.19 169.67 235 17 SER A 85 ? ? 172.60 30.56 236 17 LYS A 86 ? ? -143.63 28.32 237 17 SER A 88 ? ? -159.29 69.36 238 17 THR A 93 ? ? 51.04 -153.01 239 18 ASP A 3 ? ? 165.44 -31.01 240 18 TYR A 6 ? ? 39.70 88.09 241 18 GLU A 10 ? ? -50.50 -70.30 242 18 HIS A 15 ? ? -92.17 -117.47 243 18 HIS A 17 ? ? -101.68 -74.80 244 18 SER A 18 ? ? -166.72 -43.44 245 18 SER A 20 ? ? -163.29 105.31 246 18 HIS A 26 ? ? 164.96 75.57 247 18 HIS A 27 ? ? 29.75 43.69 248 18 PRO A 40 ? ? -69.36 88.36 249 18 HIS A 63 ? ? -44.38 -76.93 250 18 SER A 64 ? ? 174.77 158.60 251 18 SER A 85 ? ? 177.67 46.39 252 18 LYS A 86 ? ? -151.53 -66.67 253 18 LYS A 89 ? ? -165.98 97.83 254 18 MET A 91 ? ? -120.01 -54.92 255 18 GLU A 92 ? ? 70.94 141.71 256 19 ASP A 3 ? ? 55.56 -157.84 257 19 VAL A 4 ? ? -83.82 -120.73 258 19 HIS A 15 ? ? -91.48 -132.68 259 19 SER A 18 ? ? -80.73 48.20 260 19 LYS A 19 ? ? -158.48 -28.77 261 19 SER A 20 ? ? -148.12 57.12 262 19 THR A 21 ? ? -58.62 97.19 263 19 HIS A 26 ? ? 71.83 79.72 264 19 HIS A 27 ? ? 33.17 37.06 265 19 LEU A 36 ? ? -49.35 -78.52 266 19 HIS A 63 ? ? -49.61 155.53 267 19 GLU A 78 ? ? -126.26 -167.42 268 19 LYS A 86 ? ? -134.27 -33.13 269 19 SER A 88 ? ? -163.41 88.18 270 19 LYS A 89 ? ? -153.30 89.95 271 20 VAL A 4 ? ? -116.90 -134.66 272 20 TYR A 6 ? ? 58.32 109.20 273 20 LYS A 19 ? ? 178.28 -19.18 274 20 SER A 20 ? ? -145.78 36.72 275 20 THR A 21 ? ? -51.20 96.13 276 20 HIS A 26 ? ? 87.38 68.26 277 20 HIS A 27 ? ? 34.24 38.37 278 20 GLU A 37 ? ? -77.90 24.49 279 20 HIS A 63 ? ? 56.51 140.29 280 20 ASP A 82 ? ? -170.80 -57.89 281 20 ARG A 84 ? ? -142.70 40.40 282 20 LYS A 89 ? ? -157.44 65.63 283 21 TYR A 6 ? ? -35.90 103.36 284 21 HIS A 15 ? ? -103.93 -121.02 285 21 SER A 18 ? ? 78.93 -63.35 286 21 HIS A 26 ? ? 72.53 77.46 287 21 HIS A 27 ? ? 30.21 51.91 288 21 HIS A 63 ? ? -45.09 154.46 289 21 HIS A 80 ? ? -44.01 150.00 290 21 ASP A 83 ? ? -103.87 48.16 291 21 SER A 85 ? ? -119.21 50.14 292 21 LYS A 86 ? ? -152.05 -46.28 293 21 LEU A 87 ? ? -59.36 173.14 294 21 SER A 88 ? ? 65.64 99.89 295 21 THR A 93 ? ? -140.57 -57.92 296 22 LYS A 2 ? ? -169.18 90.88 297 22 VAL A 4 ? ? -130.29 -138.37 298 22 TYR A 6 ? ? 40.42 90.27 299 22 LYS A 13 ? ? -80.96 35.55 300 22 LYS A 19 ? ? -176.84 -34.99 301 22 SER A 20 ? ? -150.30 54.52 302 22 THR A 21 ? ? -53.80 83.59 303 22 HIS A 26 ? ? 72.60 73.64 304 22 HIS A 27 ? ? 31.16 52.16 305 22 HIS A 63 ? ? -48.39 155.29 306 22 HIS A 80 ? ? -49.18 159.34 307 22 ASP A 83 ? ? -105.55 46.07 308 22 LYS A 86 ? ? -163.98 47.31 309 22 LEU A 87 ? ? -164.07 58.71 310 22 SER A 88 ? ? -161.21 110.79 311 22 LYS A 89 ? ? 64.68 80.98 312 22 MET A 91 ? ? -136.65 -57.37 313 22 GLU A 92 ? ? 69.52 143.83 314 23 LYS A 2 ? ? -175.47 -48.38 315 23 VAL A 4 ? ? -122.30 -137.19 316 23 LYS A 5 ? ? -132.21 -32.45 317 23 TYR A 6 ? ? 48.28 88.47 318 23 ASN A 16 ? ? -140.78 12.80 319 23 LYS A 19 ? ? -175.87 -36.87 320 23 SER A 20 ? ? -158.46 66.44 321 23 THR A 21 ? ? -61.93 85.79 322 23 HIS A 26 ? ? 74.31 71.48 323 23 HIS A 27 ? ? 32.28 46.18 324 23 HIS A 63 ? ? 54.96 174.77 325 23 ASP A 83 ? ? -93.01 40.60 326 23 LYS A 86 ? ? -151.21 32.88 327 23 SER A 88 ? ? -172.41 -57.07 328 23 GLU A 92 ? ? -173.75 -62.12 329 23 THR A 93 ? ? 49.51 -160.10 330 24 VAL A 4 ? ? -124.30 -137.04 331 24 HIS A 15 ? ? -82.36 -116.69 332 24 HIS A 17 ? ? -117.03 -85.25 333 24 SER A 18 ? ? -177.29 63.04 334 24 LYS A 19 ? ? -175.05 -32.09 335 24 SER A 20 ? ? -148.25 51.20 336 24 THR A 21 ? ? -47.16 101.85 337 24 HIS A 26 ? ? 76.71 78.15 338 24 HIS A 27 ? ? 27.29 55.11 339 24 HIS A 80 ? ? -43.16 153.04 340 24 LYS A 86 ? ? -100.25 -70.60 341 24 SER A 88 ? ? 61.42 81.73 342 25 TYR A 6 ? ? -36.15 92.65 343 25 HIS A 15 ? ? -89.65 -127.35 344 25 HIS A 17 ? ? -130.87 -42.80 345 25 SER A 18 ? ? 173.77 -63.95 346 25 LYS A 19 ? ? -93.86 43.62 347 25 SER A 20 ? ? 175.59 101.59 348 25 HIS A 26 ? ? 81.15 83.39 349 25 HIS A 27 ? ? 28.85 50.78 350 25 LEU A 32 ? ? -87.62 40.70 351 25 GLU A 37 ? ? -90.40 32.34 352 25 GLU A 43 ? ? -137.27 -36.91 353 25 HIS A 63 ? ? 53.57 150.41 354 25 PHE A 74 ? ? -134.84 -38.43 355 25 HIS A 80 ? ? -53.91 106.51 356 25 ASP A 82 ? ? 158.77 -30.38 357 25 LYS A 86 ? ? -97.64 36.28 358 25 LEU A 87 ? ? -136.37 -66.36 359 25 SER A 88 ? ? -140.78 -54.45 360 25 LYS A 89 ? ? 60.63 90.49 361 25 GLU A 92 ? ? -172.34 131.27 362 26 LYS A 2 ? ? -135.29 -71.10 363 26 VAL A 4 ? ? -143.28 -142.56 364 26 TYR A 6 ? ? 42.92 106.42 365 26 HIS A 26 ? ? 36.55 73.89 366 26 HIS A 27 ? ? 29.60 46.63 367 26 GLU A 37 ? ? -78.25 20.16 368 26 HIS A 63 ? ? 58.24 171.51 369 26 ASP A 82 ? ? -151.46 -51.89 370 26 LYS A 89 ? ? 71.43 124.46 371 26 PRO A 90 ? ? -67.38 -179.20 372 26 GLU A 92 ? ? 73.95 -57.77 373 27 VAL A 4 ? ? -121.81 -133.50 374 27 LYS A 19 ? ? -160.28 26.84 375 27 SER A 20 ? ? -174.55 122.06 376 27 HIS A 26 ? ? 74.32 73.25 377 27 HIS A 27 ? ? 31.64 49.87 378 27 GLU A 37 ? ? -98.28 30.85 379 27 ASP A 83 ? ? -94.91 44.07 380 27 LYS A 86 ? ? -145.03 -42.66 381 27 SER A 88 ? ? -177.35 88.89 382 27 GLU A 92 ? ? -176.32 65.92 383 28 LYS A 2 ? ? -158.35 -65.28 384 28 VAL A 4 ? ? -130.91 -128.76 385 28 TYR A 6 ? ? 37.20 92.31 386 28 ASN A 16 ? ? -142.71 14.09 387 28 LYS A 19 ? ? -179.23 -34.98 388 28 SER A 20 ? ? -155.43 54.64 389 28 THR A 21 ? ? -56.04 82.21 390 28 HIS A 26 ? ? 59.51 74.64 391 28 HIS A 27 ? ? 34.02 36.70 392 28 HIS A 63 ? ? 56.29 152.94 393 28 LYS A 86 ? ? -151.40 50.65 394 28 SER A 88 ? ? 65.08 -76.38 395 28 MET A 91 ? ? 62.55 160.13 396 29 TYR A 6 ? ? 46.39 95.01 397 29 SER A 20 ? ? -154.37 35.50 398 29 THR A 21 ? ? -46.87 87.36 399 29 HIS A 26 ? ? 69.26 -169.02 400 29 HIS A 27 ? ? -66.25 32.84 401 29 LEU A 36 ? ? -49.12 -72.57 402 29 LYS A 86 ? ? -148.94 -40.01 403 29 LEU A 87 ? ? -59.32 93.22 404 29 SER A 88 ? ? -165.81 42.62 405 30 LYS A 2 ? ? -92.23 49.75 406 30 VAL A 4 ? ? -132.23 -134.89 407 30 SER A 18 ? ? -69.20 74.56 408 30 LYS A 19 ? ? -173.99 -43.13 409 30 SER A 20 ? ? -151.73 88.49 410 30 HIS A 27 ? ? 34.08 43.22 411 30 ASP A 83 ? ? -87.83 36.29 412 30 SER A 85 ? ? -155.28 8.00 413 30 SER A 88 ? ? 64.61 -74.37 414 30 THR A 93 ? ? 45.43 72.18 415 31 LYS A 2 ? ? -128.63 -69.52 416 31 VAL A 4 ? ? -129.52 -134.16 417 31 LYS A 5 ? ? -138.21 -41.12 418 31 TYR A 6 ? ? 54.11 102.49 419 31 HIS A 15 ? ? -123.65 -131.23 420 31 ASN A 16 ? ? 78.60 -10.01 421 31 SER A 18 ? ? -68.10 72.41 422 31 LYS A 19 ? ? -160.20 -44.27 423 31 SER A 20 ? ? -156.41 57.73 424 31 THR A 21 ? ? -51.84 93.82 425 31 HIS A 26 ? ? 70.01 66.97 426 31 HIS A 27 ? ? 30.84 52.51 427 31 GLU A 43 ? ? 178.63 -55.90 428 31 HIS A 63 ? ? -48.47 150.80 429 31 ASP A 82 ? ? -168.65 -48.14 430 31 ARG A 84 ? ? -156.59 35.81 431 31 LYS A 89 ? ? -159.61 83.08 432 31 MET A 91 ? ? -172.34 55.44 433 32 LYS A 2 ? ? 73.84 -67.34 434 32 VAL A 4 ? ? -131.41 -133.24 435 32 LYS A 5 ? ? -131.01 -53.25 436 32 TYR A 6 ? ? 53.69 95.37 437 32 ASN A 16 ? ? -115.50 71.49 438 32 SER A 18 ? ? -75.97 27.54 439 32 LYS A 19 ? ? -159.19 29.58 440 32 SER A 20 ? ? 168.58 132.33 441 32 HIS A 26 ? ? 62.80 87.23 442 32 HIS A 27 ? ? 30.42 41.83 443 32 GLU A 43 ? ? -132.47 -41.56 444 32 ASP A 82 ? ? -170.73 -43.58 445 32 LYS A 86 ? ? -94.69 -69.68 446 32 LEU A 87 ? ? 73.16 -66.49 447 32 MET A 91 ? ? 65.40 172.45 448 33 VAL A 4 ? ? -126.89 -137.21 449 33 TYR A 6 ? ? -62.58 88.27 450 33 HIS A 15 ? ? -126.91 -139.92 451 33 SER A 18 ? ? -174.76 -44.67 452 33 SER A 20 ? ? 178.35 102.39 453 33 HIS A 26 ? ? 66.66 78.51 454 33 HIS A 27 ? ? 33.41 45.30 455 33 LEU A 32 ? ? -86.74 35.04 456 33 LEU A 36 ? ? -43.61 -80.09 457 33 GLU A 43 ? ? -142.17 -40.75 458 33 HIS A 63 ? ? -47.00 159.91 459 33 PHE A 74 ? ? -135.38 -31.65 460 33 ASP A 83 ? ? -93.16 33.11 461 33 LYS A 86 ? ? -104.48 41.10 462 33 SER A 88 ? ? 62.56 89.62 463 33 GLU A 92 ? ? -166.08 51.42 464 33 THR A 93 ? ? 70.30 147.48 465 34 VAL A 4 ? ? -112.81 -133.83 466 34 HIS A 15 ? ? -89.75 -121.81 467 34 LYS A 19 ? ? -173.44 -33.04 468 34 SER A 20 ? ? -152.27 61.89 469 34 THR A 21 ? ? -58.19 95.37 470 34 HIS A 26 ? ? 73.26 -169.07 471 34 ASP A 82 ? ? -164.26 -52.93 472 34 SER A 85 ? ? -152.71 38.04 473 34 LYS A 86 ? ? -151.89 43.85 474 35 LYS A 5 ? ? -86.23 49.95 475 35 TYR A 6 ? ? 2.40 95.31 476 35 HIS A 15 ? ? -95.85 -122.91 477 35 ASN A 16 ? ? 77.58 -10.93 478 35 LYS A 19 ? ? -156.66 -36.64 479 35 SER A 20 ? ? -151.23 61.29 480 35 THR A 21 ? ? -54.43 94.14 481 35 HIS A 26 ? ? 158.15 85.30 482 35 HIS A 27 ? ? 31.97 34.65 483 35 LEU A 36 ? ? -49.85 -74.68 484 35 PRO A 40 ? ? -69.99 95.44 485 35 GLU A 43 ? ? -137.93 -39.12 486 35 HIS A 80 ? ? -49.06 158.32 487 36 ASP A 3 ? ? 64.61 -178.26 488 36 TYR A 6 ? ? -0.09 99.99 489 36 HIS A 15 ? ? -88.85 -126.70 490 36 ASN A 16 ? ? 75.28 -10.51 491 36 LYS A 19 ? ? -169.07 -37.82 492 36 SER A 20 ? ? -155.03 57.89 493 36 THR A 21 ? ? -58.81 85.95 494 36 HIS A 26 ? ? 45.95 70.39 495 36 HIS A 27 ? ? 30.22 48.60 496 36 HIS A 63 ? ? -49.80 159.86 497 36 ASP A 82 ? ? -148.40 -61.87 498 36 MET A 91 ? ? -121.39 -60.15 499 36 GLU A 92 ? ? 70.07 171.23 500 37 LYS A 2 ? ? 68.23 163.90 501 37 TYR A 6 ? ? 21.81 91.71 502 37 LYS A 13 ? ? -78.97 27.31 503 37 HIS A 15 ? ? -89.72 46.11 504 37 ASN A 16 ? ? -119.52 72.82 505 37 LYS A 19 ? ? -107.37 -70.72 506 37 SER A 20 ? ? -39.98 114.24 507 37 HIS A 26 ? ? 62.91 79.05 508 37 HIS A 27 ? ? 34.59 34.28 509 37 GLU A 43 ? ? -130.18 -36.41 510 37 ASN A 57 ? ? -123.67 -68.10 511 37 HIS A 63 ? ? -53.53 -80.72 512 37 SER A 64 ? ? 167.99 171.47 513 37 ASP A 82 ? ? -165.69 -56.63 514 37 LYS A 86 ? ? -141.04 -64.02 515 37 LEU A 87 ? ? 45.16 72.62 516 37 LYS A 89 ? ? -161.05 97.58 517 38 VAL A 4 ? ? -132.25 -124.93 518 38 TYR A 6 ? ? 38.38 79.24 519 38 ASN A 16 ? ? -99.53 50.73 520 38 LYS A 19 ? ? -171.51 -23.87 521 38 SER A 20 ? ? -142.99 26.86 522 38 THR A 21 ? ? -40.08 94.32 523 38 HIS A 26 ? ? 54.16 81.11 524 38 HIS A 27 ? ? 30.99 41.66 525 38 SER A 85 ? ? -166.32 37.61 526 38 LYS A 86 ? ? -149.55 53.38 527 38 THR A 93 ? ? 47.25 -159.48 528 39 LYS A 2 ? ? -154.00 77.09 529 39 VAL A 4 ? ? -129.30 -135.84 530 39 TYR A 6 ? ? 53.88 99.55 531 39 ASN A 16 ? ? -160.18 32.06 532 39 LYS A 19 ? ? -93.53 32.59 533 39 SER A 20 ? ? 163.88 85.91 534 39 THR A 21 ? ? -108.01 78.92 535 39 HIS A 26 ? ? 73.30 78.43 536 39 HIS A 27 ? ? 27.04 54.35 537 39 HIS A 39 ? ? -49.13 162.79 538 39 HIS A 80 ? ? -46.82 161.06 539 39 SER A 88 ? ? -64.54 94.96 540 39 LYS A 89 ? ? -169.77 116.37 541 39 GLU A 92 ? ? 62.27 101.39 542 40 LYS A 2 ? ? 60.16 -178.51 543 40 ASP A 3 ? ? -160.56 -169.15 544 40 TYR A 6 ? ? -28.17 91.87 545 40 ASN A 16 ? ? -148.40 25.26 546 40 SER A 18 ? ? 176.73 -29.27 547 40 SER A 20 ? ? -165.85 60.86 548 40 THR A 21 ? ? -53.97 91.32 549 40 HIS A 26 ? ? 159.03 83.49 550 40 HIS A 27 ? ? 29.48 47.55 551 40 HIS A 63 ? ? -39.07 146.46 552 40 ARG A 84 ? ? -152.39 -37.71 553 40 SER A 85 ? ? -143.44 -44.05 554 40 LYS A 89 ? ? 149.94 -48.57 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 2 CA ? A ASP 1 ? 'WRONG HAND' . 2 3 CA ? A ASP 1 ? 'WRONG HAND' . 3 11 CA ? A ASP 1 ? 'WRONG HAND' . 4 12 CA ? A ASP 1 ? 'WRONG HAND' . 5 14 CA ? A ASP 1 ? 'WRONG HAND' . 6 20 CA ? A ASP 1 ? 'WRONG HAND' . 7 22 CA ? A ASP 1 ? 'WRONG HAND' . 8 25 CA ? A ASP 1 ? 'WRONG HAND' . 9 26 CA ? A ASP 1 ? 'WRONG HAND' . 10 32 CA ? A ASP 1 ? 'WRONG HAND' . 11 33 CA ? A ASP 1 ? 'WRONG HAND' . 12 35 CA ? A ASP 1 ? 'WRONG HAND' . 13 39 CA ? A ASP 1 ? 'WRONG HAND' . 14 40 CA ? A ASP 1 ? 'WRONG HAND' . # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 TYR A 7 ? ? 0.067 'SIDE CHAIN' 2 29 TYR A 30 ? ? 0.087 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1DO9 _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 'PH 7, 2-3 MM PROTEIN, 1MM PHOSPHATE BUFFER' ? 2 'PH 7, 2-3 MM PROTEIN, 1MM PHOSPHATE BUFFER' ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 3D_15N-SEPARATED_NOESY 1 3 1 '2D TOCSY' 1 4 1 3D_15N-SEPARATED_TOCSY 1 # _pdbx_nmr_refine.entry_id 1DO9 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' DYANA '1.5 MODIFIED FOR USING PSEUDOCONTACT SHIFTS AS CONSTRAINTS' GUENTERT 1 refinement Amber 4.0 KOLLMAN 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HEM CHA C N N 123 HEM CHB C N N 124 HEM CHC C N N 125 HEM CHD C N N 126 HEM C1A C Y N 127 HEM C2A C Y N 128 HEM C3A C Y N 129 HEM C4A C Y N 130 HEM CMA C N N 131 HEM CAA C N N 132 HEM CBA C N N 133 HEM CGA C N N 134 HEM O1A O N N 135 HEM O2A O N N 136 HEM C1B C N N 137 HEM C2B C N N 138 HEM C3B C N N 139 HEM C4B C N N 140 HEM CMB C N N 141 HEM CAB C N N 142 HEM CBB C N N 143 HEM C1C C Y N 144 HEM C2C C Y N 145 HEM C3C C Y N 146 HEM C4C C Y N 147 HEM CMC C N N 148 HEM CAC C N N 149 HEM CBC C N N 150 HEM C1D C N N 151 HEM C2D C N N 152 HEM C3D C N N 153 HEM C4D C N N 154 HEM CMD C N N 155 HEM CAD C N N 156 HEM CBD C N N 157 HEM CGD C N N 158 HEM O1D O N N 159 HEM O2D O N N 160 HEM NA N Y N 161 HEM NB N N N 162 HEM NC N Y N 163 HEM ND N N N 164 HEM FE FE N N 165 HEM HHB H N N 166 HEM HHC H N N 167 HEM HHD H N N 168 HEM HMA H N N 169 HEM HMAA H N N 170 HEM HMAB H N N 171 HEM HAA H N N 172 HEM HAAA H N N 173 HEM HBA H N N 174 HEM HBAA H N N 175 HEM HMB H N N 176 HEM HMBA H N N 177 HEM HMBB H N N 178 HEM HAB H N N 179 HEM HBB H N N 180 HEM HBBA H N N 181 HEM HMC H N N 182 HEM HMCA H N N 183 HEM HMCB H N N 184 HEM HAC H N N 185 HEM HBC H N N 186 HEM HBCA H N N 187 HEM HMD H N N 188 HEM HMDA H N N 189 HEM HMDB H N N 190 HEM HAD H N N 191 HEM HADA H N N 192 HEM HBD H N N 193 HEM HBDA H N N 194 HEM H2A H N N 195 HEM H2D H N N 196 HEM HHA H N N 197 HIS N N N N 198 HIS CA C N S 199 HIS C C N N 200 HIS O O N N 201 HIS CB C N N 202 HIS CG C Y N 203 HIS ND1 N Y N 204 HIS CD2 C Y N 205 HIS CE1 C Y N 206 HIS NE2 N Y N 207 HIS OXT O N N 208 HIS H H N N 209 HIS H2 H N N 210 HIS HA H N N 211 HIS HB2 H N N 212 HIS HB3 H N N 213 HIS HD1 H N N 214 HIS HD2 H N N 215 HIS HE1 H N N 216 HIS HE2 H N N 217 HIS HXT H N N 218 ILE N N N N 219 ILE CA C N S 220 ILE C C N N 221 ILE O O N N 222 ILE CB C N S 223 ILE CG1 C N N 224 ILE CG2 C N N 225 ILE CD1 C N N 226 ILE OXT O N N 227 ILE H H N N 228 ILE H2 H N N 229 ILE HA H N N 230 ILE HB H N N 231 ILE HG12 H N N 232 ILE HG13 H N N 233 ILE HG21 H N N 234 ILE HG22 H N N 235 ILE HG23 H N N 236 ILE HD11 H N N 237 ILE HD12 H N N 238 ILE HD13 H N N 239 ILE HXT H N N 240 LEU N N N N 241 LEU CA C N S 242 LEU C C N N 243 LEU O O N N 244 LEU CB C N N 245 LEU CG C N N 246 LEU CD1 C N N 247 LEU CD2 C N N 248 LEU OXT O N N 249 LEU H H N N 250 LEU H2 H N N 251 LEU HA H N N 252 LEU HB2 H N N 253 LEU HB3 H N N 254 LEU HG H N N 255 LEU HD11 H N N 256 LEU HD12 H N N 257 LEU HD13 H N N 258 LEU HD21 H N N 259 LEU HD22 H N N 260 LEU HD23 H N N 261 LEU HXT H N N 262 LYS N N N N 263 LYS CA C N S 264 LYS C C N N 265 LYS O O N N 266 LYS CB C N N 267 LYS CG C N N 268 LYS CD C N N 269 LYS CE C N N 270 LYS NZ N N N 271 LYS OXT O N N 272 LYS H H N N 273 LYS H2 H N N 274 LYS HA H N N 275 LYS HB2 H N N 276 LYS HB3 H N N 277 LYS HG2 H N N 278 LYS HG3 H N N 279 LYS HD2 H N N 280 LYS HD3 H N N 281 LYS HE2 H N N 282 LYS HE3 H N N 283 LYS HZ1 H N N 284 LYS HZ2 H N N 285 LYS HZ3 H N N 286 LYS HXT H N N 287 MET N N N N 288 MET CA C N S 289 MET C C N N 290 MET O O N N 291 MET CB C N N 292 MET CG C N N 293 MET SD S N N 294 MET CE C N N 295 MET OXT O N N 296 MET H H N N 297 MET H2 H N N 298 MET HA H N N 299 MET HB2 H N N 300 MET HB3 H N N 301 MET HG2 H N N 302 MET HG3 H N N 303 MET HE1 H N N 304 MET HE2 H N N 305 MET HE3 H N N 306 MET HXT H N N 307 PHE N N N N 308 PHE CA C N S 309 PHE C C N N 310 PHE O O N N 311 PHE CB C N N 312 PHE CG C Y N 313 PHE CD1 C Y N 314 PHE CD2 C Y N 315 PHE CE1 C Y N 316 PHE CE2 C Y N 317 PHE CZ C Y N 318 PHE OXT O N N 319 PHE H H N N 320 PHE H2 H N N 321 PHE HA H N N 322 PHE HB2 H N N 323 PHE HB3 H N N 324 PHE HD1 H N N 325 PHE HD2 H N N 326 PHE HE1 H N N 327 PHE HE2 H N N 328 PHE HZ H N N 329 PHE HXT H N N 330 PRO N N N N 331 PRO CA C N S 332 PRO C C N N 333 PRO O O N N 334 PRO CB C N N 335 PRO CG C N N 336 PRO CD C N N 337 PRO OXT O N N 338 PRO H H N N 339 PRO HA H N N 340 PRO HB2 H N N 341 PRO HB3 H N N 342 PRO HG2 H N N 343 PRO HG3 H N N 344 PRO HD2 H N N 345 PRO HD3 H N N 346 PRO HXT H N N 347 SER N N N N 348 SER CA C N S 349 SER C C N N 350 SER O O N N 351 SER CB C N N 352 SER OG O N N 353 SER OXT O N N 354 SER H H N N 355 SER H2 H N N 356 SER HA H N N 357 SER HB2 H N N 358 SER HB3 H N N 359 SER HG H N N 360 SER HXT H N N 361 THR N N N N 362 THR CA C N S 363 THR C C N N 364 THR O O N N 365 THR CB C N R 366 THR OG1 O N N 367 THR CG2 C N N 368 THR OXT O N N 369 THR H H N N 370 THR H2 H N N 371 THR HA H N N 372 THR HB H N N 373 THR HG1 H N N 374 THR HG21 H N N 375 THR HG22 H N N 376 THR HG23 H N N 377 THR HXT H N N 378 TRP N N N N 379 TRP CA C N S 380 TRP C C N N 381 TRP O O N N 382 TRP CB C N N 383 TRP CG C Y N 384 TRP CD1 C Y N 385 TRP CD2 C Y N 386 TRP NE1 N Y N 387 TRP CE2 C Y N 388 TRP CE3 C Y N 389 TRP CZ2 C Y N 390 TRP CZ3 C Y N 391 TRP CH2 C Y N 392 TRP OXT O N N 393 TRP H H N N 394 TRP H2 H N N 395 TRP HA H N N 396 TRP HB2 H N N 397 TRP HB3 H N N 398 TRP HD1 H N N 399 TRP HE1 H N N 400 TRP HE3 H N N 401 TRP HZ2 H N N 402 TRP HZ3 H N N 403 TRP HH2 H N N 404 TRP HXT H N N 405 TYR N N N N 406 TYR CA C N S 407 TYR C C N N 408 TYR O O N N 409 TYR CB C N N 410 TYR CG C Y N 411 TYR CD1 C Y N 412 TYR CD2 C Y N 413 TYR CE1 C Y N 414 TYR CE2 C Y N 415 TYR CZ C Y N 416 TYR OH O N N 417 TYR OXT O N N 418 TYR H H N N 419 TYR H2 H N N 420 TYR HA H N N 421 TYR HB2 H N N 422 TYR HB3 H N N 423 TYR HD1 H N N 424 TYR HD2 H N N 425 TYR HE1 H N N 426 TYR HE2 H N N 427 TYR HH H N N 428 TYR HXT H N N 429 VAL N N N N 430 VAL CA C N S 431 VAL C C N N 432 VAL O O N N 433 VAL CB C N N 434 VAL CG1 C N N 435 VAL CG2 C N N 436 VAL OXT O N N 437 VAL H H N N 438 VAL H2 H N N 439 VAL HA H N N 440 VAL HB H N N 441 VAL HG11 H N N 442 VAL HG12 H N N 443 VAL HG13 H N N 444 VAL HG21 H N N 445 VAL HG22 H N N 446 VAL HG23 H N N 447 VAL HXT H N N 448 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HEM CHA C1A sing N N 116 HEM CHA C4D doub N N 117 HEM CHA HHA sing N N 118 HEM CHB C4A sing N N 119 HEM CHB C1B doub N N 120 HEM CHB HHB sing N N 121 HEM CHC C4B sing N N 122 HEM CHC C1C doub N N 123 HEM CHC HHC sing N N 124 HEM CHD C4C doub N N 125 HEM CHD C1D sing N N 126 HEM CHD HHD sing N N 127 HEM C1A C2A doub Y N 128 HEM C1A NA sing Y N 129 HEM C2A C3A sing Y N 130 HEM C2A CAA sing N N 131 HEM C3A C4A doub Y N 132 HEM C3A CMA sing N N 133 HEM C4A NA sing Y N 134 HEM CMA HMA sing N N 135 HEM CMA HMAA sing N N 136 HEM CMA HMAB sing N N 137 HEM CAA CBA sing N N 138 HEM CAA HAA sing N N 139 HEM CAA HAAA sing N N 140 HEM CBA CGA sing N N 141 HEM CBA HBA sing N N 142 HEM CBA HBAA sing N N 143 HEM CGA O1A doub N N 144 HEM CGA O2A sing N N 145 HEM C1B C2B sing N N 146 HEM C1B NB sing N N 147 HEM C2B C3B doub N N 148 HEM C2B CMB sing N N 149 HEM C3B C4B sing N N 150 HEM C3B CAB sing N N 151 HEM C4B NB doub N N 152 HEM CMB HMB sing N N 153 HEM CMB HMBA sing N N 154 HEM CMB HMBB sing N N 155 HEM CAB CBB doub N N 156 HEM CAB HAB sing N N 157 HEM CBB HBB sing N N 158 HEM CBB HBBA sing N N 159 HEM C1C C2C sing Y N 160 HEM C1C NC sing Y N 161 HEM C2C C3C doub Y N 162 HEM C2C CMC sing N N 163 HEM C3C C4C sing Y N 164 HEM C3C CAC sing N N 165 HEM C4C NC sing Y N 166 HEM CMC HMC sing N N 167 HEM CMC HMCA sing N N 168 HEM CMC HMCB sing N N 169 HEM CAC CBC doub N N 170 HEM CAC HAC sing N N 171 HEM CBC HBC sing N N 172 HEM CBC HBCA sing N N 173 HEM C1D C2D sing N N 174 HEM C1D ND doub N N 175 HEM C2D C3D doub N N 176 HEM C2D CMD sing N N 177 HEM C3D C4D sing N N 178 HEM C3D CAD sing N N 179 HEM C4D ND sing N N 180 HEM CMD HMD sing N N 181 HEM CMD HMDA sing N N 182 HEM CMD HMDB sing N N 183 HEM CAD CBD sing N N 184 HEM CAD HAD sing N N 185 HEM CAD HADA sing N N 186 HEM CBD CGD sing N N 187 HEM CBD HBD sing N N 188 HEM CBD HBDA sing N N 189 HEM CGD O1D doub N N 190 HEM CGD O2D sing N N 191 HEM O2A H2A sing N N 192 HEM O2D H2D sing N N 193 HEM FE NA sing N N 194 HEM FE NB sing N N 195 HEM FE NC sing N N 196 HEM FE ND sing N N 197 HIS N CA sing N N 198 HIS N H sing N N 199 HIS N H2 sing N N 200 HIS CA C sing N N 201 HIS CA CB sing N N 202 HIS CA HA sing N N 203 HIS C O doub N N 204 HIS C OXT sing N N 205 HIS CB CG sing N N 206 HIS CB HB2 sing N N 207 HIS CB HB3 sing N N 208 HIS CG ND1 sing Y N 209 HIS CG CD2 doub Y N 210 HIS ND1 CE1 doub Y N 211 HIS ND1 HD1 sing N N 212 HIS CD2 NE2 sing Y N 213 HIS CD2 HD2 sing N N 214 HIS CE1 NE2 sing Y N 215 HIS CE1 HE1 sing N N 216 HIS NE2 HE2 sing N N 217 HIS OXT HXT sing N N 218 ILE N CA sing N N 219 ILE N H sing N N 220 ILE N H2 sing N N 221 ILE CA C sing N N 222 ILE CA CB sing N N 223 ILE CA HA sing N N 224 ILE C O doub N N 225 ILE C OXT sing N N 226 ILE CB CG1 sing N N 227 ILE CB CG2 sing N N 228 ILE CB HB sing N N 229 ILE CG1 CD1 sing N N 230 ILE CG1 HG12 sing N N 231 ILE CG1 HG13 sing N N 232 ILE CG2 HG21 sing N N 233 ILE CG2 HG22 sing N N 234 ILE CG2 HG23 sing N N 235 ILE CD1 HD11 sing N N 236 ILE CD1 HD12 sing N N 237 ILE CD1 HD13 sing N N 238 ILE OXT HXT sing N N 239 LEU N CA sing N N 240 LEU N H sing N N 241 LEU N H2 sing N N 242 LEU CA C sing N N 243 LEU CA CB sing N N 244 LEU CA HA sing N N 245 LEU C O doub N N 246 LEU C OXT sing N N 247 LEU CB CG sing N N 248 LEU CB HB2 sing N N 249 LEU CB HB3 sing N N 250 LEU CG CD1 sing N N 251 LEU CG CD2 sing N N 252 LEU CG HG sing N N 253 LEU CD1 HD11 sing N N 254 LEU CD1 HD12 sing N N 255 LEU CD1 HD13 sing N N 256 LEU CD2 HD21 sing N N 257 LEU CD2 HD22 sing N N 258 LEU CD2 HD23 sing N N 259 LEU OXT HXT sing N N 260 LYS N CA sing N N 261 LYS N H sing N N 262 LYS N H2 sing N N 263 LYS CA C sing N N 264 LYS CA CB sing N N 265 LYS CA HA sing N N 266 LYS C O doub N N 267 LYS C OXT sing N N 268 LYS CB CG sing N N 269 LYS CB HB2 sing N N 270 LYS CB HB3 sing N N 271 LYS CG CD sing N N 272 LYS CG HG2 sing N N 273 LYS CG HG3 sing N N 274 LYS CD CE sing N N 275 LYS CD HD2 sing N N 276 LYS CD HD3 sing N N 277 LYS CE NZ sing N N 278 LYS CE HE2 sing N N 279 LYS CE HE3 sing N N 280 LYS NZ HZ1 sing N N 281 LYS NZ HZ2 sing N N 282 LYS NZ HZ3 sing N N 283 LYS OXT HXT sing N N 284 MET N CA sing N N 285 MET N H sing N N 286 MET N H2 sing N N 287 MET CA C sing N N 288 MET CA CB sing N N 289 MET CA HA sing N N 290 MET C O doub N N 291 MET C OXT sing N N 292 MET CB CG sing N N 293 MET CB HB2 sing N N 294 MET CB HB3 sing N N 295 MET CG SD sing N N 296 MET CG HG2 sing N N 297 MET CG HG3 sing N N 298 MET SD CE sing N N 299 MET CE HE1 sing N N 300 MET CE HE2 sing N N 301 MET CE HE3 sing N N 302 MET OXT HXT sing N N 303 PHE N CA sing N N 304 PHE N H sing N N 305 PHE N H2 sing N N 306 PHE CA C sing N N 307 PHE CA CB sing N N 308 PHE CA HA sing N N 309 PHE C O doub N N 310 PHE C OXT sing N N 311 PHE CB CG sing N N 312 PHE CB HB2 sing N N 313 PHE CB HB3 sing N N 314 PHE CG CD1 doub Y N 315 PHE CG CD2 sing Y N 316 PHE CD1 CE1 sing Y N 317 PHE CD1 HD1 sing N N 318 PHE CD2 CE2 doub Y N 319 PHE CD2 HD2 sing N N 320 PHE CE1 CZ doub Y N 321 PHE CE1 HE1 sing N N 322 PHE CE2 CZ sing Y N 323 PHE CE2 HE2 sing N N 324 PHE CZ HZ sing N N 325 PHE OXT HXT sing N N 326 PRO N CA sing N N 327 PRO N CD sing N N 328 PRO N H sing N N 329 PRO CA C sing N N 330 PRO CA CB sing N N 331 PRO CA HA sing N N 332 PRO C O doub N N 333 PRO C OXT sing N N 334 PRO CB CG sing N N 335 PRO CB HB2 sing N N 336 PRO CB HB3 sing N N 337 PRO CG CD sing N N 338 PRO CG HG2 sing N N 339 PRO CG HG3 sing N N 340 PRO CD HD2 sing N N 341 PRO CD HD3 sing N N 342 PRO OXT HXT sing N N 343 SER N CA sing N N 344 SER N H sing N N 345 SER N H2 sing N N 346 SER CA C sing N N 347 SER CA CB sing N N 348 SER CA HA sing N N 349 SER C O doub N N 350 SER C OXT sing N N 351 SER CB OG sing N N 352 SER CB HB2 sing N N 353 SER CB HB3 sing N N 354 SER OG HG sing N N 355 SER OXT HXT sing N N 356 THR N CA sing N N 357 THR N H sing N N 358 THR N H2 sing N N 359 THR CA C sing N N 360 THR CA CB sing N N 361 THR CA HA sing N N 362 THR C O doub N N 363 THR C OXT sing N N 364 THR CB OG1 sing N N 365 THR CB CG2 sing N N 366 THR CB HB sing N N 367 THR OG1 HG1 sing N N 368 THR CG2 HG21 sing N N 369 THR CG2 HG22 sing N N 370 THR CG2 HG23 sing N N 371 THR OXT HXT sing N N 372 TRP N CA sing N N 373 TRP N H sing N N 374 TRP N H2 sing N N 375 TRP CA C sing N N 376 TRP CA CB sing N N 377 TRP CA HA sing N N 378 TRP C O doub N N 379 TRP C OXT sing N N 380 TRP CB CG sing N N 381 TRP CB HB2 sing N N 382 TRP CB HB3 sing N N 383 TRP CG CD1 doub Y N 384 TRP CG CD2 sing Y N 385 TRP CD1 NE1 sing Y N 386 TRP CD1 HD1 sing N N 387 TRP CD2 CE2 doub Y N 388 TRP CD2 CE3 sing Y N 389 TRP NE1 CE2 sing Y N 390 TRP NE1 HE1 sing N N 391 TRP CE2 CZ2 sing Y N 392 TRP CE3 CZ3 doub Y N 393 TRP CE3 HE3 sing N N 394 TRP CZ2 CH2 doub Y N 395 TRP CZ2 HZ2 sing N N 396 TRP CZ3 CH2 sing Y N 397 TRP CZ3 HZ3 sing N N 398 TRP CH2 HH2 sing N N 399 TRP OXT HXT sing N N 400 TYR N CA sing N N 401 TYR N H sing N N 402 TYR N H2 sing N N 403 TYR CA C sing N N 404 TYR CA CB sing N N 405 TYR CA HA sing N N 406 TYR C O doub N N 407 TYR C OXT sing N N 408 TYR CB CG sing N N 409 TYR CB HB2 sing N N 410 TYR CB HB3 sing N N 411 TYR CG CD1 doub Y N 412 TYR CG CD2 sing Y N 413 TYR CD1 CE1 sing Y N 414 TYR CD1 HD1 sing N N 415 TYR CD2 CE2 doub Y N 416 TYR CD2 HD2 sing N N 417 TYR CE1 CZ doub Y N 418 TYR CE1 HE1 sing N N 419 TYR CE2 CZ sing Y N 420 TYR CE2 HE2 sing N N 421 TYR CZ OH sing N N 422 TYR OH HH sing N N 423 TYR OXT HXT sing N N 424 VAL N CA sing N N 425 VAL N H sing N N 426 VAL N H2 sing N N 427 VAL CA C sing N N 428 VAL CA CB sing N N 429 VAL CA HA sing N N 430 VAL C O doub N N 431 VAL C OXT sing N N 432 VAL CB CG1 sing N N 433 VAL CB CG2 sing N N 434 VAL CB HB sing N N 435 VAL CG1 HG11 sing N N 436 VAL CG1 HG12 sing N N 437 VAL CG1 HG13 sing N N 438 VAL CG2 HG21 sing N N 439 VAL CG2 HG22 sing N N 440 VAL CG2 HG23 sing N N 441 VAL OXT HXT sing N N 442 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 600 ? 2 AVANCE Bruker 800 ? # _atom_sites.entry_id 1DO9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_