data_1DR9 # _entry.id 1DR9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DR9 pdb_00001dr9 10.2210/pdb1dr9/pdb RCSB RCSB010314 ? ? WWPDB D_1000010314 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DR9 _pdbx_database_status.recvd_initial_deposition_date 2000-01-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ikemizu, S.' 1 'Jones, E.Y.' 2 'Stuart, D.I.' 3 'Davis, S.J.' 4 # _citation.id primary _citation.title 'Structure and dimerization of a soluble form of B7-1.' _citation.journal_abbrev Immunity _citation.journal_volume 12 _citation.page_first 51 _citation.page_last 60 _citation.year 2000 _citation.journal_id_ASTM IUNIEH _citation.country US _citation.journal_id_ISSN 1074-7613 _citation.journal_id_CSD 2048 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10661405 _citation.pdbx_database_id_DOI '10.1016/S1074-7613(00)80158-2' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ikemizu, S.' 1 ? primary 'Gilbert, R.J.' 2 ? primary 'Fennelly, J.A.' 3 ? primary 'Collins, A.V.' 4 ? primary 'Harlos, K.' 5 ? primary 'Jones, E.Y.' 6 ? primary 'Stuart, D.I.' 7 ? primary 'Davis, S.J.' 8 ? # _cell.entry_id 1DR9 _cell.length_a 57.280 _cell.length_b 57.280 _cell.length_c 298.930 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DR9 _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'T LYMPHOCYTE ACTIVATION ANTIGEN' 22993.123 1 ? ? 'EXTRACELLULAR REGION' ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'B7-1 (CD80)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTY ECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPE TELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTAK ; _entity_poly.pdbx_seq_one_letter_code_can ;VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTY ECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPE TELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 ILE n 1 3 HIS n 1 4 VAL n 1 5 THR n 1 6 LYS n 1 7 GLU n 1 8 VAL n 1 9 LYS n 1 10 GLU n 1 11 VAL n 1 12 ALA n 1 13 THR n 1 14 LEU n 1 15 SER n 1 16 CYS n 1 17 GLY n 1 18 HIS n 1 19 ASN n 1 20 VAL n 1 21 SER n 1 22 VAL n 1 23 GLU n 1 24 GLU n 1 25 LEU n 1 26 ALA n 1 27 GLN n 1 28 THR n 1 29 ARG n 1 30 ILE n 1 31 TYR n 1 32 TRP n 1 33 GLN n 1 34 LYS n 1 35 GLU n 1 36 LYS n 1 37 LYS n 1 38 MET n 1 39 VAL n 1 40 LEU n 1 41 THR n 1 42 MET n 1 43 MET n 1 44 SER n 1 45 GLY n 1 46 ASP n 1 47 MET n 1 48 ASN n 1 49 ILE n 1 50 TRP n 1 51 PRO n 1 52 GLU n 1 53 TYR n 1 54 LYS n 1 55 ASN n 1 56 ARG n 1 57 THR n 1 58 ILE n 1 59 PHE n 1 60 ASP n 1 61 ILE n 1 62 THR n 1 63 ASN n 1 64 ASN n 1 65 LEU n 1 66 SER n 1 67 ILE n 1 68 VAL n 1 69 ILE n 1 70 LEU n 1 71 ALA n 1 72 LEU n 1 73 ARG n 1 74 PRO n 1 75 SER n 1 76 ASP n 1 77 GLU n 1 78 GLY n 1 79 THR n 1 80 TYR n 1 81 GLU n 1 82 CYS n 1 83 VAL n 1 84 VAL n 1 85 LEU n 1 86 LYS n 1 87 TYR n 1 88 GLU n 1 89 LYS n 1 90 ASP n 1 91 ALA n 1 92 PHE n 1 93 LYS n 1 94 ARG n 1 95 GLU n 1 96 HIS n 1 97 LEU n 1 98 ALA n 1 99 GLU n 1 100 VAL n 1 101 THR n 1 102 LEU n 1 103 SER n 1 104 VAL n 1 105 LYS n 1 106 ALA n 1 107 ASP n 1 108 PHE n 1 109 PRO n 1 110 THR n 1 111 PRO n 1 112 SER n 1 113 ILE n 1 114 SER n 1 115 ASP n 1 116 PHE n 1 117 GLU n 1 118 ILE n 1 119 PRO n 1 120 THR n 1 121 SER n 1 122 ASN n 1 123 ILE n 1 124 ARG n 1 125 ARG n 1 126 ILE n 1 127 ILE n 1 128 CYS n 1 129 SER n 1 130 THR n 1 131 SER n 1 132 GLY n 1 133 GLY n 1 134 PHE n 1 135 PRO n 1 136 GLU n 1 137 PRO n 1 138 HIS n 1 139 LEU n 1 140 SER n 1 141 TRP n 1 142 LEU n 1 143 GLU n 1 144 ASN n 1 145 GLY n 1 146 GLU n 1 147 GLU n 1 148 LEU n 1 149 ASN n 1 150 ALA n 1 151 ILE n 1 152 ASN n 1 153 THR n 1 154 THR n 1 155 VAL n 1 156 SER n 1 157 GLN n 1 158 ASP n 1 159 PRO n 1 160 GLU n 1 161 THR n 1 162 GLU n 1 163 LEU n 1 164 TYR n 1 165 ALA n 1 166 VAL n 1 167 SER n 1 168 SER n 1 169 LYS n 1 170 LEU n 1 171 ASP n 1 172 PHE n 1 173 ASN n 1 174 MET n 1 175 THR n 1 176 THR n 1 177 ASN n 1 178 HIS n 1 179 SER n 1 180 PHE n 1 181 MET n 1 182 CYS n 1 183 LEU n 1 184 ILE n 1 185 LYS n 1 186 TYR n 1 187 GLY n 1 188 HIS n 1 189 LEU n 1 190 ARG n 1 191 VAL n 1 192 ASN n 1 193 GLN n 1 194 THR n 1 195 PHE n 1 196 ASN n 1 197 TRP n 1 198 ASN n 1 199 THR n 1 200 ALA n 1 201 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene CHO _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CD80_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P33681 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DR9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 201 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P33681 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 234 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 201 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1DR9 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 200 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P33681 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 234 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 200 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1DR9 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.67 _exptl_crystal.density_percent_sol 53.85 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details 'PEG400, Na Hepes, CaCl2, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 20K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1998-11-24 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1DR9 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 20 _reflns.d_resolution_high 3.0 _reflns.number_obs 5204 _reflns.number_all 105456 _reflns.percent_possible_obs 96.5 _reflns.pdbx_Rmerge_I_obs 0.114 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 24 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy .195 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.1 _reflns_shell.percent_possible_all 88.9 _reflns_shell.Rmerge_I_obs 0.48 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 283 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1DR9 _refine.ls_number_reflns_obs 5204 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 253290.04 _refine.pdbx_data_cutoff_low_absF 0.00 _refine.ls_d_res_low 19.55 _refine.ls_d_res_high 3.00 _refine.ls_percent_reflns_obs 96.5 _refine.ls_R_factor_obs 0.238 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.238 _refine.ls_R_factor_R_free 0.28 _refine.ls_R_factor_R_free_error 0.016 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.6 _refine.ls_number_reflns_R_free 289 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 41.1 _refine.aniso_B[1][1] 11.91 _refine.aniso_B[2][2] 11.91 _refine.aniso_B[3][3] -23.83 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.289 _refine.solvent_model_param_bsol 10 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1DR9 _refine_analyze.Luzzati_coordinate_error_obs 0.34 _refine_analyze.Luzzati_sigma_a_obs 0.36 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.42 _refine_analyze.Luzzati_sigma_a_free 0.45 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1603 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1645 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 19.55 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 26.7 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.73 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.64 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.76 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.27 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.48 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 3.00 _refine_ls_shell.d_res_low 3.19 _refine_ls_shell.number_reflns_R_work 745 _refine_ls_shell.R_factor_R_work 0.291 _refine_ls_shell.percent_reflns_obs 92.1 _refine_ls_shell.R_factor_R_free 0.365 _refine_ls_shell.R_factor_R_free_error 0.049 _refine_ls_shell.percent_reflns_R_free 7.0 _refine_ls_shell.number_reflns_R_free 56 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PAR PROTEIN.TOP 'X-RAY DIFFRACTION' 2 CARBOHYDRATE.PAR CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1DR9 _struct.title 'CRYSTAL STRUCTURE OF A SOLUBLE FORM OF B7-1 (CD80)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DR9 _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'IG SUPERFAMILY, IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 23 ? THR A 28 ? GLU A 23 THR A 28 1 ? 6 HELX_P HELX_P2 2 TRP A 50 ? ASN A 55 ? TRP A 50 ASN A 55 1 ? 6 HELX_P HELX_P3 3 ARG A 73 ? GLU A 77 ? ARG A 73 GLU A 77 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 82 SG ? ? A CYS 16 A CYS 82 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 128 SG ? ? ? 1_555 A CYS 182 SG ? ? A CYS 128 A CYS 182 1_555 ? ? ? ? ? ? ? 2.036 ? ? covale1 covale one ? A ASN 152 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 152 A NAG 1001 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation covale2 covale one ? A ASN 173 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 173 A NAG 1003 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation covale3 covale one ? A ASN 192 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 192 A NAG 1002 1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 134 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 134 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 135 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 135 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.34 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 3 ? C ? 4 ? D ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel D 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 3 ? GLU A 7 ? HIS A 3 GLU A 7 A 2 LYS A 93 ? LYS A 105 ? LYS A 93 LYS A 105 A 3 GLY A 78 ? LYS A 86 ? GLY A 78 LYS A 86 A 4 ARG A 29 ? LYS A 34 ? ARG A 29 LYS A 34 A 5 LYS A 37 ? MET A 43 ? LYS A 37 MET A 43 A 6 ASP A 46 ? ILE A 49 ? ASP A 46 ILE A 49 B 1 ALA A 12 ? LEU A 14 ? ALA A 12 LEU A 14 B 2 SER A 66 ? ILE A 69 ? SER A 66 ILE A 69 B 3 THR A 57 ? ASP A 60 ? THR A 57 ASP A 60 C 1 SER A 112 ? GLU A 117 ? SER A 112 GLU A 117 C 2 ILE A 123 ? GLY A 133 ? ILE A 123 GLY A 133 C 3 TYR A 164 ? ASN A 173 ? TYR A 164 ASN A 173 C 4 ASN A 152 ? GLN A 157 ? ASN A 152 GLN A 157 D 1 GLU A 147 ? LEU A 148 ? GLU A 147 LEU A 148 D 2 PRO A 137 ? GLU A 143 ? PRO A 137 GLU A 143 D 3 HIS A 178 ? TYR A 186 ? HIS A 178 TYR A 186 D 4 VAL A 191 ? TRP A 197 ? VAL A 191 TRP A 197 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 4 ? N VAL A 4 O THR A 101 ? O THR A 101 A 2 3 N LEU A 102 ? N LEU A 102 O GLY A 78 ? O GLY A 78 A 3 4 N LEU A 85 ? N LEU A 85 O ARG A 29 ? O ARG A 29 A 4 5 N LYS A 34 ? N LYS A 34 O LYS A 37 ? O LYS A 37 A 5 6 O MET A 43 ? O MET A 43 N ASP A 46 ? N ASP A 46 B 1 2 N LEU A 14 ? N LEU A 14 O ILE A 67 ? O ILE A 67 B 2 3 N VAL A 68 ? N VAL A 68 O ILE A 58 ? O ILE A 58 C 1 2 O PHE A 116 ? O PHE A 116 N ARG A 125 ? N ARG A 125 C 2 3 N GLY A 132 ? N GLY A 132 O TYR A 164 ? O TYR A 164 C 3 4 N LYS A 169 ? N LYS A 169 O ASN A 152 ? O ASN A 152 D 1 2 N LEU A 148 ? N LEU A 148 O TRP A 141 ? O TRP A 141 D 2 3 N LEU A 142 ? N LEU A 142 O MET A 181 ? O MET A 181 D 3 4 N ILE A 184 ? N ILE A 184 O VAL A 191 ? O VAL A 191 # _database_PDB_matrix.entry_id 1DR9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DR9 _atom_sites.fract_transf_matrix[1][1] 0.017458 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017458 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003345 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 PRO 135 135 135 PRO CPR A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 TRP 141 141 141 TRP TRP A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 MET 174 174 174 MET MET A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 PHE 180 180 180 PHE PHE A . n A 1 181 MET 181 181 181 MET MET A . n A 1 182 CYS 182 182 182 CYS CYS A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 GLN 193 193 193 GLN GLN A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 PHE 195 195 195 PHE PHE A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 TRP 197 197 197 TRP TRP A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 LYS 201 201 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 1001 1 NAG NAG A . C 2 NAG 1 1002 2 NAG NAG A . D 2 NAG 1 1003 3 NAG NAG A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ASN 152 A ASN 152 ? ASN 'GLYCOSYLATION SITE' 2 A ASN 192 A ASN 192 ? ASN 'GLYCOSYLATION SITE' 3 A ASN 173 A ASN 173 ? ASN 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-01-10 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-31 5 'Structure model' 1 4 2020-07-29 6 'Structure model' 1 5 2021-11-03 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Experimental preparation' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Structure summary' 8 6 'Structure model' 'Database references' 9 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 5 'Structure model' chem_comp 3 5 'Structure model' entity 4 5 'Structure model' pdbx_chem_comp_identifier 5 5 'Structure model' pdbx_entity_nonpoly 6 5 'Structure model' struct_conn 7 5 'Structure model' struct_site 8 5 'Structure model' struct_site_gen 9 6 'Structure model' chem_comp 10 6 'Structure model' database_2 11 6 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.temp' 2 5 'Structure model' '_chem_comp.name' 3 5 'Structure model' '_chem_comp.type' 4 5 'Structure model' '_entity.pdbx_description' 5 5 'Structure model' '_pdbx_entity_nonpoly.name' 6 5 'Structure model' '_struct_conn.pdbx_dist_value' 7 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 8 5 'Structure model' '_struct_conn.pdbx_role' 9 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 10 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 6 'Structure model' '_chem_comp.pdbx_synonyms' 14 6 'Structure model' '_database_2.pdbx_DOI' 15 6 'Structure model' '_database_2.pdbx_database_accession' 16 6 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 SOLVE phasing . ? 3 CNS refinement 0.9 ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 9 ? ? 79.27 -13.44 2 1 LYS A 36 ? ? 69.97 -28.90 3 1 VAL A 39 ? ? -123.78 -63.75 4 1 MET A 42 ? ? -110.04 55.94 5 1 MET A 43 ? ? -57.56 98.23 6 1 SER A 44 ? ? 34.14 72.40 7 1 ASN A 48 ? ? -162.05 105.43 8 1 ASN A 63 ? ? -100.26 68.29 9 1 LYS A 89 ? ? -21.45 112.98 10 1 ASP A 90 ? ? 108.58 -24.64 11 1 ALA A 106 ? ? -140.72 53.23 12 1 THR A 120 ? ? -165.89 117.46 13 1 ASN A 122 ? ? 80.89 -20.65 14 1 PRO A 135 ? ? -74.17 -164.10 15 1 GLU A 160 ? ? -75.22 -74.93 16 1 LEU A 189 ? ? -101.65 -167.83 17 1 ARG A 190 ? ? 179.66 137.09 18 1 THR A 199 ? ? -50.88 -103.53 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id LYS _pdbx_unobs_or_zero_occ_residues.auth_seq_id 201 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id LYS _pdbx_unobs_or_zero_occ_residues.label_seq_id 201 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 2-acetamido-2-deoxy-beta-D-glucopyranose _pdbx_entity_nonpoly.comp_id NAG #