data_1DTM # _entry.id 1DTM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.291 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1DTM RCSB RCSB010356 WWPDB D_1000010356 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1irc _pdbx_database_related.details 'H93G metaquomyoglobin with imidazole bound as a proximal ligand.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DTM _pdbx_database_status.recvd_initial_deposition_date 2000-01-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barrick, D.' 1 'Dahlquist, F.W.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Trans-substitution of the proximal hydrogen bond in myoglobin: I. Structural consequences of hydrogen bond deletion.' Proteins 39 278 290 2000 PSFGEY US 0887-3585 0867 ? 10813811 '10.1002/(SICI)1097-0134(20000601)39:4<278::AID-PROT20>3.0.CO;2-T' 1 ;Trans-substitution of the proximal hydrogen bond in myoglobin: II. Energetics, functional consequences, and implications for hemoglobin allostery ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Barrick, D.' 1 primary 'Dahlquist, F.W.' 2 1 'Barrick, D.' 3 # _cell.entry_id 1DTM _cell.length_a 40.276 _cell.length_b 48.892 _cell.length_c 78.935 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1DTM _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RECOMBINANT SPERM WHALE MYOGLOBIN VARIANT H93G' 17153.857 1 ? H93G ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? 3 non-polymer syn 4-METHYLIMIDAZOLE 82.104 1 ? ? ? ? 4 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSGATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_seq_one_letter_code_can ;VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKG HHEAELKPLAQSGATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LEU n 1 3 SER n 1 4 GLU n 1 5 GLY n 1 6 GLU n 1 7 TRP n 1 8 GLN n 1 9 LEU n 1 10 VAL n 1 11 LEU n 1 12 HIS n 1 13 VAL n 1 14 TRP n 1 15 ALA n 1 16 LYS n 1 17 VAL n 1 18 GLU n 1 19 ALA n 1 20 ASP n 1 21 VAL n 1 22 ALA n 1 23 GLY n 1 24 HIS n 1 25 GLY n 1 26 GLN n 1 27 ASP n 1 28 ILE n 1 29 LEU n 1 30 ILE n 1 31 ARG n 1 32 LEU n 1 33 PHE n 1 34 LYS n 1 35 SER n 1 36 HIS n 1 37 PRO n 1 38 GLU n 1 39 THR n 1 40 LEU n 1 41 GLU n 1 42 LYS n 1 43 PHE n 1 44 ASP n 1 45 ARG n 1 46 PHE n 1 47 LYS n 1 48 HIS n 1 49 LEU n 1 50 LYS n 1 51 THR n 1 52 GLU n 1 53 ALA n 1 54 GLU n 1 55 MET n 1 56 LYS n 1 57 ALA n 1 58 SER n 1 59 GLU n 1 60 ASP n 1 61 LEU n 1 62 LYS n 1 63 LYS n 1 64 HIS n 1 65 GLY n 1 66 VAL n 1 67 THR n 1 68 VAL n 1 69 LEU n 1 70 THR n 1 71 ALA n 1 72 LEU n 1 73 GLY n 1 74 ALA n 1 75 ILE n 1 76 LEU n 1 77 LYS n 1 78 LYS n 1 79 LYS n 1 80 GLY n 1 81 HIS n 1 82 HIS n 1 83 GLU n 1 84 ALA n 1 85 GLU n 1 86 LEU n 1 87 LYS n 1 88 PRO n 1 89 LEU n 1 90 ALA n 1 91 GLN n 1 92 SER n 1 93 GLY n 1 94 ALA n 1 95 THR n 1 96 LYS n 1 97 HIS n 1 98 LYS n 1 99 ILE n 1 100 PRO n 1 101 ILE n 1 102 LYS n 1 103 TYR n 1 104 LEU n 1 105 GLU n 1 106 PHE n 1 107 ILE n 1 108 SER n 1 109 GLU n 1 110 ALA n 1 111 ILE n 1 112 ILE n 1 113 HIS n 1 114 VAL n 1 115 LEU n 1 116 HIS n 1 117 SER n 1 118 ARG n 1 119 HIS n 1 120 PRO n 1 121 GLY n 1 122 ASP n 1 123 PHE n 1 124 GLY n 1 125 ALA n 1 126 ASP n 1 127 ALA n 1 128 GLN n 1 129 GLY n 1 130 ALA n 1 131 MET n 1 132 ASN n 1 133 LYS n 1 134 ALA n 1 135 LEU n 1 136 GLU n 1 137 LEU n 1 138 PHE n 1 139 ARG n 1 140 LYS n 1 141 ASP n 1 142 ILE n 1 143 ALA n 1 144 ALA n 1 145 LYS n 1 146 TYR n 1 147 LYS n 1 148 GLU n 1 149 LEU n 1 150 GLY n 1 151 TYR n 1 152 GLN n 1 153 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'sperm whale' _entity_src_gen.gene_src_genus Physeter _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Physeter catodon' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9755 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PMB413B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 3 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;4-methylimidazole from Aldrich Chemical Company (Cat # 19,988-5). 4-methylimidazole substituted for imidazole by extensive buffer exchange using spin-columns equilibrated with 0.1 M 4-methylimidazole. ; # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYG_PHYCA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02185 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DTM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 153 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02185 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 153 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 153 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1DTM _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 93 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02185 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 93 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 93 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4MZ non-polymer . 4-METHYLIMIDAZOLE ? 'C4 H6 N2' 82.104 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1DTM _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_percent_sol 45.69 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details 'Room temperature' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '35 % PEG 8000, 0.3-0.35 M NaOAc, 0.1 M PIPES, and 0.1 % dioxane, 0.1 M 4-methylimidazole, pH 6.5, VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type SDMS _diffrn_detector.pdbx_collection_date 1994-07-29 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.54 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1DTM _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.13 _reflns.number_obs 7356 _reflns.number_all 7356 _reflns.percent_possible_obs 78.9 _reflns.pdbx_Rmerge_I_obs 0.0360000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.54 _reflns.B_iso_Wilson_estimate 23.3 _reflns.pdbx_redundancy 2.63 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.13 _reflns_shell.d_res_low 2.298 _reflns_shell.percent_possible_all 49 _reflns_shell.Rmerge_I_obs 0.1410000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 1.51 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 853 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1DTM _refine.ls_number_reflns_obs 7356 _refine.ls_number_reflns_all 7356 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.13 _refine.ls_percent_reflns_obs 79 _refine.ls_R_factor_obs 0.1750000 _refine.ls_R_factor_all 0.1750000 _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details '4-methyl imidazole built into an omit map in the proximal pocket after extensive all-atom refinement of the protein and heme' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ;Bond length rmsd 0.02 angstroms, Bond angle 3.0 degrees, B-correlation 6 square angstroms, Trigonal planarity 0.02, Planar groups 0.02 ; _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1176 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1240 _refine_hist.d_res_high 2.13 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_angle_deg 2.9 ? ? ? 'X-RAY DIFFRACTION' ? t_bond_d 0.019 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1DTM _struct.title 'CRYSTAL STRUCTURE OF THE SPERM-WHALE MYOGLOBIN MUTANT H93G COMPLEXED WITH 4-METHYLIMIDAZOLE, METAQUO FORM' _struct.pdbx_descriptor 'MYOGLOBIN MUTANT (H93G) COMPLEXED WITH PROTOPORPHYRIN IX AND 4-METHYLIMIDAZOLE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DTM _struct_keywords.pdbx_keywords 'OXYGEN STORAGE/TRANSPORT' _struct_keywords.text 'Heme protein, Myoglobin, ligand-substitution, OXYGEN STORAGE-TRANSPORT COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? GLU A 18 ? SER A 3 GLU A 18 1 ? 16 HELX_P HELX_P2 2 ASP A 20 ? HIS A 36 ? ASP A 20 HIS A 36 1 ? 17 HELX_P HELX_P3 3 PRO A 37 ? PHE A 43 ? PRO A 37 PHE A 43 5 ? 7 HELX_P HELX_P4 4 THR A 51 ? SER A 58 ? THR A 51 SER A 58 1 ? 8 HELX_P HELX_P5 5 SER A 58 ? LYS A 77 ? SER A 58 LYS A 77 1 ? 20 HELX_P HELX_P6 6 HIS A 82 ? LYS A 96 ? HIS A 82 LYS A 96 1 ? 15 HELX_P HELX_P7 7 PRO A 100 ? HIS A 119 ? PRO A 100 HIS A 119 1 ? 20 HELX_P HELX_P8 8 PRO A 120 ? PHE A 123 ? PRO A 120 PHE A 123 5 ? 4 HELX_P HELX_P9 9 GLY A 124 ? LEU A 149 ? GLY A 124 LEU A 149 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B HEM . FE ? ? ? 1_555 C 4MZ . NE2 ? ? A HEM 154 A 4MZ 155 1_555 ? ? ? ? ? ? ? 1.961 ? metalc2 metalc ? ? B HEM . FE ? ? ? 1_555 D HOH . O ? ? A HEM 154 A HOH 156 1_555 ? ? ? ? ? ? ? 2.720 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HEM A 154' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE 4MZ A 155' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 PHE A 43 ? PHE A 43 . ? 1_555 ? 2 AC1 10 VAL A 68 ? VAL A 68 . ? 1_555 ? 3 AC1 10 LEU A 89 ? LEU A 89 . ? 1_555 ? 4 AC1 10 SER A 92 ? SER A 92 . ? 1_555 ? 5 AC1 10 HIS A 97 ? HIS A 97 . ? 1_555 ? 6 AC1 10 ILE A 99 ? ILE A 99 . ? 1_555 ? 7 AC1 10 TYR A 103 ? TYR A 103 . ? 1_555 ? 8 AC1 10 4MZ C . ? 4MZ A 155 . ? 1_555 ? 9 AC1 10 HOH D . ? HOH A 156 . ? 1_555 ? 10 AC1 10 HOH D . ? HOH A 166 . ? 1_555 ? 11 AC2 4 LEU A 89 ? LEU A 89 . ? 1_555 ? 12 AC2 4 SER A 92 ? SER A 92 . ? 1_555 ? 13 AC2 4 HIS A 97 ? HIS A 97 . ? 1_555 ? 14 AC2 4 HEM B . ? HEM A 154 . ? 1_555 ? # _database_PDB_matrix.entry_id 1DTM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DTM _atom_sites.fract_transf_matrix[1][1] 0.024829 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020453 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012669 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 LYS 47 47 47 LYS ALA A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU ALA A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLU 83 83 83 GLU ALA A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLY 153 153 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 154 0 HEM HEM A . C 3 4MZ 1 155 0 4MZ 4IM A . D 4 HOH 1 156 0 HOH WAT A . D 4 HOH 2 157 0 HOH WAT A . D 4 HOH 3 158 0 HOH WAT A . D 4 HOH 4 159 0 HOH WAT A . D 4 HOH 5 160 0 HOH WAT A . D 4 HOH 6 161 0 HOH WAT A . D 4 HOH 7 162 0 HOH WAT A . D 4 HOH 8 163 0 HOH WAT A . D 4 HOH 9 164 0 HOH WAT A . D 4 HOH 10 165 0 HOH WAT A . D 4 HOH 11 166 0 HOH WAT A . D 4 HOH 12 167 0 HOH WAT A . D 4 HOH 13 168 0 HOH WAT A . D 4 HOH 14 169 0 HOH WAT A . D 4 HOH 15 170 0 HOH WAT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? C 4MZ . ? A 4MZ 155 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NA ? B HEM . ? A HEM 154 ? 1_555 81.0 ? 2 NE2 ? C 4MZ . ? A 4MZ 155 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NB ? B HEM . ? A HEM 154 ? 1_555 87.3 ? 3 NA ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NB ? B HEM . ? A HEM 154 ? 1_555 88.8 ? 4 NE2 ? C 4MZ . ? A 4MZ 155 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NC ? B HEM . ? A HEM 154 ? 1_555 98.3 ? 5 NA ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NC ? B HEM . ? A HEM 154 ? 1_555 172.8 ? 6 NB ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 NC ? B HEM . ? A HEM 154 ? 1_555 84.1 ? 7 NE2 ? C 4MZ . ? A 4MZ 155 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 ND ? B HEM . ? A HEM 154 ? 1_555 90.9 ? 8 NA ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 ND ? B HEM . ? A HEM 154 ? 1_555 87.3 ? 9 NB ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 ND ? B HEM . ? A HEM 154 ? 1_555 175.9 ? 10 NC ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 ND ? B HEM . ? A HEM 154 ? 1_555 99.9 ? 11 NE2 ? C 4MZ . ? A 4MZ 155 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 156 ? 1_555 165.3 ? 12 NA ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 156 ? 1_555 112.0 ? 13 NB ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 156 ? 1_555 86.2 ? 14 NC ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 156 ? 1_555 68.0 ? 15 ND ? B HEM . ? A HEM 154 ? 1_555 FE ? B HEM . ? A HEM 154 ? 1_555 O ? D HOH . ? A HOH 156 ? 1_555 96.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-02-07 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-02-01 5 'Structure model' 1 4 2018-03-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 5 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category struct_ref_seq_dif # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 5 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal TNT refinement . ? 1 SDMS 'data reduction' . ? 2 SDMS 'data scaling' . ? 3 TNT phasing . ? 4 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.332 1.252 0.080 0.011 N 2 1 CD A GLU 18 ? ? OE2 A GLU 18 ? ? 1.336 1.252 0.084 0.011 N 3 1 CD A GLU 38 ? ? OE2 A GLU 38 ? ? 1.333 1.252 0.081 0.011 N 4 1 CG A HIS 64 ? ? CD2 A HIS 64 ? ? 1.412 1.354 0.058 0.009 N 5 1 CD A GLU 148 ? ? OE2 A GLU 148 ? ? 1.343 1.252 0.091 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 20 ? ? CG A ASP 20 ? ? OD2 A ASP 20 ? ? 112.32 118.30 -5.98 0.90 N 2 1 CD A ARG 31 ? ? NE A ARG 31 ? ? CZ A ARG 31 ? ? 133.33 123.60 9.73 1.40 N 3 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 124.81 120.30 4.51 0.50 N 4 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH2 A ARG 31 ? ? 117.21 120.30 -3.09 0.50 N 5 1 C A HIS 36 ? ? N A PRO 37 ? ? CD A PRO 37 ? ? 115.69 128.40 -12.71 2.10 Y 6 1 CB A HIS 64 ? ? CA A HIS 64 ? ? C A HIS 64 ? ? 123.73 110.40 13.33 2.00 N 7 1 CB A GLN 91 ? ? CA A GLN 91 ? ? C A GLN 91 ? ? 94.31 110.40 -16.09 2.00 N 8 1 CB A ASP 122 ? ? CG A ASP 122 ? ? OD2 A ASP 122 ? ? 111.10 118.30 -7.20 0.90 N 9 1 CB A ASP 141 ? ? CG A ASP 141 ? ? OD1 A ASP 141 ? ? 125.15 118.30 6.85 0.90 N 10 1 CB A ASP 141 ? ? CG A ASP 141 ? ? OD2 A ASP 141 ? ? 112.66 118.30 -5.64 0.90 N 11 1 CB A TYR 146 ? ? CG A TYR 146 ? ? CD1 A TYR 146 ? ? 117.05 121.00 -3.95 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 36 ? ? -150.74 76.43 2 1 HIS A 81 ? ? -99.35 57.78 3 1 LYS A 96 ? ? -92.06 -69.26 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 34 ? CD ? A LYS 34 CD 2 1 Y 1 A LYS 34 ? CE ? A LYS 34 CE 3 1 Y 1 A LYS 34 ? NZ ? A LYS 34 NZ 4 1 Y 1 A GLU 41 ? CD ? A GLU 41 CD 5 1 Y 1 A GLU 41 ? OE1 ? A GLU 41 OE1 6 1 Y 1 A GLU 41 ? OE2 ? A GLU 41 OE2 7 1 Y 1 A LYS 47 ? CG ? A LYS 47 CG 8 1 Y 1 A LYS 47 ? CD ? A LYS 47 CD 9 1 Y 1 A LYS 47 ? CE ? A LYS 47 CE 10 1 Y 1 A LYS 47 ? NZ ? A LYS 47 NZ 11 1 Y 1 A GLU 59 ? CG ? A GLU 59 CG 12 1 Y 1 A GLU 59 ? CD ? A GLU 59 CD 13 1 Y 1 A GLU 59 ? OE1 ? A GLU 59 OE1 14 1 Y 1 A GLU 59 ? OE2 ? A GLU 59 OE2 15 1 Y 1 A LYS 62 ? CE ? A LYS 62 CE 16 1 Y 1 A LYS 62 ? NZ ? A LYS 62 NZ 17 1 Y 1 A LYS 78 ? CD ? A LYS 78 CD 18 1 Y 1 A LYS 78 ? CE ? A LYS 78 CE 19 1 Y 1 A LYS 78 ? NZ ? A LYS 78 NZ 20 1 Y 1 A LYS 79 ? CE ? A LYS 79 CE 21 1 Y 1 A LYS 79 ? NZ ? A LYS 79 NZ 22 1 Y 1 A GLU 83 ? CG ? A GLU 83 CG 23 1 Y 1 A GLU 83 ? CD ? A GLU 83 CD 24 1 Y 1 A GLU 83 ? OE1 ? A GLU 83 OE1 25 1 Y 1 A GLU 83 ? OE2 ? A GLU 83 OE2 26 1 Y 1 A LYS 98 ? CE ? A LYS 98 CE 27 1 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 28 1 Y 1 A LYS 145 ? CE ? A LYS 145 CE 29 1 Y 1 A LYS 145 ? NZ ? A LYS 145 NZ 30 1 Y 1 A LYS 147 ? NZ ? A LYS 147 NZ # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 153 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 153 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 4-METHYLIMIDAZOLE 4MZ 4 water HOH #