data_1DY3 # _entry.id 1DY3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1DY3 PDBE EBI-4524 WWPDB D_1290004524 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1HKA _pdbx_database_related.content_type unspecified _pdbx_database_related.details '6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DY3 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-01-21 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Stammers, D.K.' 1 'Achari, A.' 2 'Somers, D.O.' 3 'Bryant, P.K.' 4 'Rosemond, J.' 5 'Scott, D.L.' 6 'Champness, J.N.' 7 # _citation.id primary _citation.title ;2.0A X-Ray Structure of the Ternary Complex of 7,8-Dihydro-6-Hydroxymethylpterinpyrophosphokinase from Escherichia Coli with ATP and a Substrate Analogue ; _citation.journal_abbrev 'FEBS Lett.' _citation.journal_volume 456 _citation.page_first 49 _citation.page_last ? _citation.year 1999 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10452528 _citation.pdbx_database_id_DOI '10.1016/S0014-5793(99)00860-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Stammers, D.K.' 1 primary 'Achari, A.' 2 primary 'Somers, D.O.' 3 primary 'Bryant, P.K.' 4 primary 'Rosemond, J.' 5 primary 'Scott, D.L.' 6 primary 'Champness, J.N.' 7 # _cell.entry_id 1DY3 _cell.length_a 40.960 _cell.length_b 69.010 _cell.length_c 115.490 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DY3 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ? 17966.535 1 2.7.6.3 ? ? ? 2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 3 non-polymer syn '7,8-DIHYDRO-6-HYDROXYMETHYL-7-METHYL-7-[2-PHENYLETHYL]-PTERIN' 313.354 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 5 water nat water 18.015 141 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PPPK, HPPK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQ GRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW ; _entity_poly.pdbx_seq_one_letter_code_can ;TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQ GRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 VAL n 1 3 ALA n 1 4 TYR n 1 5 ILE n 1 6 ALA n 1 7 ILE n 1 8 GLY n 1 9 SER n 1 10 ASN n 1 11 LEU n 1 12 ALA n 1 13 SER n 1 14 PRO n 1 15 LEU n 1 16 GLU n 1 17 GLN n 1 18 VAL n 1 19 ASN n 1 20 ALA n 1 21 ALA n 1 22 LEU n 1 23 LYS n 1 24 ALA n 1 25 LEU n 1 26 GLY n 1 27 ASP n 1 28 ILE n 1 29 PRO n 1 30 GLU n 1 31 SER n 1 32 HIS n 1 33 ILE n 1 34 LEU n 1 35 THR n 1 36 VAL n 1 37 SER n 1 38 SER n 1 39 PHE n 1 40 TYR n 1 41 ARG n 1 42 THR n 1 43 PRO n 1 44 PRO n 1 45 LEU n 1 46 GLY n 1 47 PRO n 1 48 GLN n 1 49 ASP n 1 50 GLN n 1 51 PRO n 1 52 ASP n 1 53 TYR n 1 54 LEU n 1 55 ASN n 1 56 ALA n 1 57 ALA n 1 58 VAL n 1 59 ALA n 1 60 LEU n 1 61 GLU n 1 62 THR n 1 63 SER n 1 64 LEU n 1 65 ALA n 1 66 PRO n 1 67 GLU n 1 68 GLU n 1 69 LEU n 1 70 LEU n 1 71 ASN n 1 72 HIS n 1 73 THR n 1 74 GLN n 1 75 ARG n 1 76 ILE n 1 77 GLU n 1 78 LEU n 1 79 GLN n 1 80 GLN n 1 81 GLY n 1 82 ARG n 1 83 VAL n 1 84 ARG n 1 85 LYS n 1 86 ALA n 1 87 GLU n 1 88 ARG n 1 89 TRP n 1 90 GLY n 1 91 PRO n 1 92 ARG n 1 93 THR n 1 94 LEU n 1 95 ASP n 1 96 LEU n 1 97 ASP n 1 98 ILE n 1 99 MET n 1 100 LEU n 1 101 PHE n 1 102 GLY n 1 103 ASN n 1 104 GLU n 1 105 VAL n 1 106 ILE n 1 107 ASN n 1 108 THR n 1 109 GLU n 1 110 ARG n 1 111 LEU n 1 112 THR n 1 113 VAL n 1 114 PRO n 1 115 HIS n 1 116 TYR n 1 117 ASP n 1 118 MET n 1 119 LYS n 1 120 ASN n 1 121 ARG n 1 122 GLY n 1 123 PHE n 1 124 MET n 1 125 LEU n 1 126 TRP n 1 127 PRO n 1 128 LEU n 1 129 PHE n 1 130 GLU n 1 131 ILE n 1 132 ALA n 1 133 PRO n 1 134 GLU n 1 135 LEU n 1 136 VAL n 1 137 PHE n 1 138 PRO n 1 139 ASP n 1 140 GLY n 1 141 GLU n 1 142 MET n 1 143 LEU n 1 144 ARG n 1 145 GLN n 1 146 ILE n 1 147 LEU n 1 148 HIS n 1 149 THR n 1 150 ARG n 1 151 ALA n 1 152 PHE n 1 153 ASP n 1 154 LYS n 1 155 LEU n 1 156 ASN n 1 157 LYS n 1 158 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location CYTOPLASM _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HPPK_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P26281 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DY3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 158 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26281 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 158 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 158 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 87Y non-polymer . '7,8-DIHYDRO-6-HYDROXYMETHYL-7-METHYL-7-[2-PHENYLETHYL]-PTERIN' ;2-AMINO-6-HYDROXYMETHYL-7-METHYL-7-PHENETHYL-7,8-DIHYDRO-3H-PTERIDIN-4-ONE; 7,8-DIHYDRO-6-HYDROXYMETHYL-7-METHYL-7-[2-PHENYLETHYL]-PTERIN ; 'C16 H19 N5 O2' 313.354 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1DY3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_percent_sol 45.84 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.60 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 5.60' # _diffrn.id 1 _diffrn.ambient_temp 290.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type R-AXIS _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'NI FILTER' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1DY3 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.000 _reflns.d_resolution_high 2.000 _reflns.number_obs 10879 _reflns.number_all ? _reflns.percent_possible_obs 94.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.05000 _reflns.pdbx_netI_over_sigmaI 20.5000 _reflns.B_iso_Wilson_estimate 15.3 _reflns.pdbx_redundancy 4.400 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 92.8 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.10200 _reflns_shell.meanI_over_sigI_obs 10.600 _reflns_shell.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1DY3 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 10829 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs 94.9 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.165 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 19.7 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIR _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1267 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.number_atoms_solvent 141 _refine_hist.number_atoms_total 1464 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.013 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.03 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.027 ? ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1DY3 _struct.title 'Ternary complex of 7,8-dihydro-6-hydroxymethylpterinpyrophosphokinase from Escherichia coli with ATP and a substrate analogue.' _struct.pdbx_descriptor PROTEIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DY3 _struct_keywords.pdbx_keywords PYROPHOSPHORYLASE _struct_keywords.text 'PYROPHOSPHORYLASE, DE NOVO FOLATE BIOSYNTHESIS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 13 ? ASP A 27 ? SER A 13 ASP A 27 1 ? 15 HELX_P HELX_P2 2 ALA A 65 ? GLN A 80 ? ALA A 65 GLN A 80 1 ? 16 HELX_P HELX_P3 3 ASP A 117 ? ASN A 120 ? ASP A 117 ASN A 120 5 ? 4 HELX_P HELX_P4 4 ARG A 121 ? ALA A 132 ? ARG A 121 ALA A 132 1 ? 12 HELX_P HELX_P5 5 MET A 142 ? ALA A 151 ? MET A 142 ALA A 151 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 202 A HOH 2141 1_555 ? ? ? ? ? ? ? 2.587 ? metalc2 metalc ? ? D MG . MG ? ? ? 1_555 C 87Y . O16 ? ? A MG 202 A 87Y 201 1_555 ? ? ? ? ? ? ? 2.630 ? metalc3 metalc ? ? D MG . MG ? ? ? 1_555 A ASP 95 OD2 ? ? A MG 202 A ASP 95 1_555 ? ? ? ? ? ? ? 2.502 ? metalc4 metalc ? ? D MG . MG ? ? ? 1_555 A ASP 97 OD2 ? ? A MG 202 A ASP 97 1_555 ? ? ? ? ? ? ? 2.444 ? metalc5 metalc ? ? D MG . MG ? ? ? 1_555 B ATP . O1G ? ? A MG 202 A ATP 200 1_555 ? ? ? ? ? ? ? 2.602 ? metalc6 metalc ? ? D MG . MG ? ? ? 1_555 B ATP . O2B ? ? A MG 202 A ATP 200 1_555 ? ? ? ? ? ? ? 2.422 ? metalc7 metalc ? ? E MG . MG ? ? ? 1_555 A ASP 97 OD1 ? ? A MG 203 A ASP 97 1_555 ? ? ? ? ? ? ? 2.326 ? metalc8 metalc ? ? E MG . MG ? ? ? 1_555 B ATP . O2B ? ? A MG 203 A ATP 200 1_555 ? ? ? ? ? ? ? 2.360 ? metalc9 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 203 A HOH 2068 1_555 ? ? ? ? ? ? ? 2.418 ? metalc10 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 203 A HOH 2136 1_555 ? ? ? ? ? ? ? 2.537 ? metalc11 metalc ? ? E MG . MG ? ? ? 1_555 B ATP . O1A ? ? A MG 203 A ATP 200 1_555 ? ? ? ? ? ? ? 2.452 ? metalc12 metalc ? ? E MG . MG ? ? ? 1_555 A ASP 95 OD1 ? ? A MG 203 A ASP 95 1_555 ? ? ? ? ? ? ? 2.405 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 113 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 113 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 114 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 114 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.22 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? A1 ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A1 1 2 ? anti-parallel A1 2 3 ? anti-parallel A1 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 31 ? VAL A 36 ? SER A 31 VAL A 36 A 2 TYR A 53 ? THR A 62 ? TYR A 53 THR A 62 A 3 VAL A 2 ? SER A 9 ? VAL A 2 SER A 9 A 4 ASP A 95 ? PHE A 101 ? ASP A 95 PHE A 101 A1 1 SER A 31 ? VAL A 36 ? SER A 31 VAL A 36 A1 2 TYR A 53 ? THR A 62 ? TYR A 53 THR A 62 A1 3 TYR A 40 ? THR A 42 ? TYR A 40 THR A 42 A1 4 ASN A 156 ? LYS A 157 ? ASN A 156 LYS A 157 B 1 ILE A 106 ? ASN A 107 ? ILE A 106 ASN A 107 B 2 THR A 112 ? VAL A 113 ? THR A 112 VAL A 113 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 34 ? N LEU A 34 O ALA A 59 ? O ALA A 59 A 2 3 N LEU A 60 ? N LEU A 60 O ALA A 3 ? O ALA A 3 A 3 4 N GLY A 8 ? N GLY A 8 O ASP A 95 ? O ASP A 95 A1 1 2 N LEU A 34 ? N LEU A 34 O ALA A 59 ? O ALA A 59 A1 2 3 N ASN A 55 ? N ASN A 55 O TYR A 40 ? O TYR A 40 A1 3 4 N ARG A 41 ? N ARG A 41 O ASN A 156 ? O ASN A 156 B 1 2 N ILE A 106 ? N ILE A 106 O VAL A 113 ? O VAL A 113 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 202' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 203' AC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE ATP A 200' AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 87Y A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 95 ? ASP A 95 . ? 1_555 ? 2 AC1 6 ASP A 97 ? ASP A 97 . ? 1_555 ? 3 AC1 6 ATP B . ? ATP A 200 . ? 1_555 ? 4 AC1 6 87Y C . ? 87Y A 201 . ? 1_555 ? 5 AC1 6 MG E . ? MG A 203 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 2141 . ? 1_555 ? 7 AC2 6 ASP A 95 ? ASP A 95 . ? 1_555 ? 8 AC2 6 ASP A 97 ? ASP A 97 . ? 1_555 ? 9 AC2 6 ATP B . ? ATP A 200 . ? 1_555 ? 10 AC2 6 MG D . ? MG A 202 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 2068 . ? 1_555 ? 12 AC2 6 HOH F . ? HOH A 2136 . ? 1_555 ? 13 AC3 23 ARG A 82 ? ARG A 82 . ? 1_555 ? 14 AC3 23 ARG A 84 ? ARG A 84 . ? 1_555 ? 15 AC3 23 ALA A 86 ? ALA A 86 . ? 1_555 ? 16 AC3 23 GLU A 87 ? GLU A 87 . ? 1_555 ? 17 AC3 23 ARG A 88 ? ARG A 88 . ? 1_555 ? 18 AC3 23 TRP A 89 ? TRP A 89 . ? 1_555 ? 19 AC3 23 ARG A 92 ? ARG A 92 . ? 1_555 ? 20 AC3 23 ASP A 95 ? ASP A 95 . ? 1_555 ? 21 AC3 23 ASP A 97 ? ASP A 97 . ? 1_555 ? 22 AC3 23 ILE A 98 ? ILE A 98 . ? 1_555 ? 23 AC3 23 ARG A 110 ? ARG A 110 . ? 1_555 ? 24 AC3 23 LEU A 111 ? LEU A 111 . ? 1_555 ? 25 AC3 23 THR A 112 ? THR A 112 . ? 1_555 ? 26 AC3 23 HIS A 115 ? HIS A 115 . ? 1_555 ? 27 AC3 23 TYR A 116 ? TYR A 116 . ? 1_555 ? 28 AC3 23 ARG A 121 ? ARG A 121 . ? 1_555 ? 29 AC3 23 87Y C . ? 87Y A 201 . ? 1_555 ? 30 AC3 23 MG D . ? MG A 202 . ? 1_555 ? 31 AC3 23 MG E . ? MG A 203 . ? 1_555 ? 32 AC3 23 HOH F . ? HOH A 2136 . ? 1_555 ? 33 AC3 23 HOH F . ? HOH A 2138 . ? 1_555 ? 34 AC3 23 HOH F . ? HOH A 2139 . ? 1_555 ? 35 AC3 23 HOH F . ? HOH A 2140 . ? 1_555 ? 36 AC4 13 THR A 42 ? THR A 42 . ? 1_555 ? 37 AC4 13 PRO A 43 ? PRO A 43 . ? 1_555 ? 38 AC4 13 LEU A 45 ? LEU A 45 . ? 1_555 ? 39 AC4 13 TYR A 53 ? TYR A 53 . ? 1_555 ? 40 AC4 13 ASN A 55 ? ASN A 55 . ? 1_555 ? 41 AC4 13 TRP A 89 ? TRP A 89 . ? 1_555 ? 42 AC4 13 ARG A 92 ? ARG A 92 . ? 1_555 ? 43 AC4 13 PHE A 123 ? PHE A 123 . ? 1_555 ? 44 AC4 13 ATP B . ? ATP A 200 . ? 1_555 ? 45 AC4 13 MG D . ? MG A 202 . ? 1_555 ? 46 AC4 13 HOH F . ? HOH A 2084 . ? 1_555 ? 47 AC4 13 HOH F . ? HOH A 2103 . ? 1_555 ? 48 AC4 13 HOH F . ? HOH A 2141 . ? 1_555 ? # _database_PDB_matrix.entry_id 1DY3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DY3 _atom_sites.fract_transf_matrix[1][1] 0.024414 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014503 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008659 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 MET 99 99 99 MET MET A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 PHE 137 137 137 PHE PHE A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 TRP 158 158 158 TRP TRP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ATP 1 200 200 ATP ATP A . C 3 87Y 1 201 201 87Y 87Y A . D 4 MG 1 202 202 MG MG A . E 4 MG 1 203 203 MG MG A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . F 5 HOH 95 2095 2095 HOH HOH A . F 5 HOH 96 2096 2096 HOH HOH A . F 5 HOH 97 2097 2097 HOH HOH A . F 5 HOH 98 2098 2098 HOH HOH A . F 5 HOH 99 2099 2099 HOH HOH A . F 5 HOH 100 2100 2100 HOH HOH A . F 5 HOH 101 2101 2101 HOH HOH A . F 5 HOH 102 2102 2102 HOH HOH A . F 5 HOH 103 2103 2103 HOH HOH A . F 5 HOH 104 2104 2104 HOH HOH A . F 5 HOH 105 2105 2105 HOH HOH A . F 5 HOH 106 2106 2106 HOH HOH A . F 5 HOH 107 2107 2107 HOH HOH A . F 5 HOH 108 2108 2108 HOH HOH A . F 5 HOH 109 2109 2109 HOH HOH A . F 5 HOH 110 2110 2110 HOH HOH A . F 5 HOH 111 2111 2111 HOH HOH A . F 5 HOH 112 2112 2112 HOH HOH A . F 5 HOH 113 2113 2113 HOH HOH A . F 5 HOH 114 2114 2114 HOH HOH A . F 5 HOH 115 2115 2115 HOH HOH A . F 5 HOH 116 2116 2116 HOH HOH A . F 5 HOH 117 2117 2117 HOH HOH A . F 5 HOH 118 2118 2118 HOH HOH A . F 5 HOH 119 2119 2119 HOH HOH A . F 5 HOH 120 2120 2120 HOH HOH A . F 5 HOH 121 2121 2121 HOH HOH A . F 5 HOH 122 2122 2122 HOH HOH A . F 5 HOH 123 2123 2123 HOH HOH A . F 5 HOH 124 2124 2124 HOH HOH A . F 5 HOH 125 2125 2125 HOH HOH A . F 5 HOH 126 2126 2126 HOH HOH A . F 5 HOH 127 2127 2127 HOH HOH A . F 5 HOH 128 2128 2128 HOH HOH A . F 5 HOH 129 2129 2129 HOH HOH A . F 5 HOH 130 2130 2130 HOH HOH A . F 5 HOH 131 2131 2131 HOH HOH A . F 5 HOH 132 2132 2132 HOH HOH A . F 5 HOH 133 2133 2133 HOH HOH A . F 5 HOH 134 2134 2134 HOH HOH A . F 5 HOH 135 2135 2135 HOH HOH A . F 5 HOH 136 2136 2136 HOH HOH A . F 5 HOH 137 2137 2137 HOH HOH A . F 5 HOH 138 2138 2138 HOH HOH A . F 5 HOH 139 2139 2139 HOH HOH A . F 5 HOH 140 2140 2140 HOH HOH A . F 5 HOH 141 2141 2141 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? F HOH . ? A HOH 2141 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O16 ? C 87Y . ? A 87Y 201 ? 1_555 68.6 ? 2 O ? F HOH . ? A HOH 2141 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 88.1 ? 3 O16 ? C 87Y . ? A 87Y 201 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 98.9 ? 4 O ? F HOH . ? A HOH 2141 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 OD2 ? A ASP 97 ? A ASP 97 ? 1_555 104.1 ? 5 O16 ? C 87Y . ? A 87Y 201 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 OD2 ? A ASP 97 ? A ASP 97 ? 1_555 160.3 ? 6 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 OD2 ? A ASP 97 ? A ASP 97 ? 1_555 99.1 ? 7 O ? F HOH . ? A HOH 2141 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O1G ? B ATP . ? A ATP 200 ? 1_555 104.2 ? 8 O16 ? C 87Y . ? A 87Y 201 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O1G ? B ATP . ? A ATP 200 ? 1_555 76.2 ? 9 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O1G ? B ATP . ? A ATP 200 ? 1_555 163.6 ? 10 OD2 ? A ASP 97 ? A ASP 97 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O1G ? B ATP . ? A ATP 200 ? 1_555 88.6 ? 11 O ? F HOH . ? A HOH 2141 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O2B ? B ATP . ? A ATP 200 ? 1_555 154.9 ? 12 O16 ? C 87Y . ? A 87Y 201 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O2B ? B ATP . ? A ATP 200 ? 1_555 87.8 ? 13 OD2 ? A ASP 95 ? A ASP 95 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O2B ? B ATP . ? A ATP 200 ? 1_555 87.2 ? 14 OD2 ? A ASP 97 ? A ASP 97 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O2B ? B ATP . ? A ATP 200 ? 1_555 101.0 ? 15 O1G ? B ATP . ? A ATP 200 ? 1_555 MG ? D MG . ? A MG 202 ? 1_555 O2B ? B ATP . ? A ATP 200 ? 1_555 77.0 ? 16 OD1 ? A ASP 97 ? A ASP 97 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O2B ? B ATP . ? A ATP 200 ? 1_555 105.1 ? 17 OD1 ? A ASP 97 ? A ASP 97 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 2068 ? 1_555 88.4 ? 18 O2B ? B ATP . ? A ATP 200 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 2068 ? 1_555 166.0 ? 19 OD1 ? A ASP 97 ? A ASP 97 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 2136 ? 1_555 92.7 ? 20 O2B ? B ATP . ? A ATP 200 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 2136 ? 1_555 83.3 ? 21 O ? F HOH . ? A HOH 2068 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O ? F HOH . ? A HOH 2136 ? 1_555 99.7 ? 22 OD1 ? A ASP 97 ? A ASP 97 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O1A ? B ATP . ? A ATP 200 ? 1_555 176.6 ? 23 O2B ? B ATP . ? A ATP 200 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O1A ? B ATP . ? A ATP 200 ? 1_555 78.2 ? 24 O ? F HOH . ? A HOH 2068 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O1A ? B ATP . ? A ATP 200 ? 1_555 88.3 ? 25 O ? F HOH . ? A HOH 2136 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 O1A ? B ATP . ? A ATP 200 ? 1_555 87.2 ? 26 OD1 ? A ASP 97 ? A ASP 97 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 92.9 ? 27 O2B ? B ATP . ? A ATP 200 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 86.8 ? 28 O ? F HOH . ? A HOH 2068 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 89.2 ? 29 O ? F HOH . ? A HOH 2136 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 169.6 ? 30 O1A ? B ATP . ? A ATP 200 ? 1_555 MG ? E MG . ? A MG 203 ? 1_555 OD1 ? A ASP 95 ? A ASP 95 ? 1_555 87.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-18 2 'Structure model' 1 1 2011-05-07 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement . ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ; SHEET DETERMINATION METHOD: THERE IS A BIFURCATED SHEETS IN THIS STRUCTURE. THIS IS REPRESENTED BY TWO SHEETS WHICH HAVE ONE OR MORE IDENTICAL STRANDS. SHEETS A AND A1 REPRESENT ONE BIFURCATED SHEET. ; # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A ASP 27 ? ? CB A ASP 27 ? ? CG A ASP 27 ? ? 136.53 113.40 23.13 2.20 N 2 1 NE A ARG 75 ? ? CZ A ARG 75 ? ? NH1 A ARG 75 ? ? 123.39 120.30 3.09 0.50 N 3 1 CD A ARG 82 ? ? NE A ARG 82 ? ? CZ A ARG 82 ? ? 133.76 123.60 10.16 1.40 N 4 1 NE A ARG 84 ? ? CZ A ARG 84 ? ? NH2 A ARG 84 ? ? 124.37 120.30 4.07 0.50 N 5 1 N A ARG 88 ? ? CA A ARG 88 ? ? C A ARG 88 ? ? 130.49 111.00 19.49 2.70 N 6 1 NE A ARG 110 ? ? CZ A ARG 110 ? ? NH2 A ARG 110 ? ? 123.44 120.30 3.14 0.50 N 7 1 CD A ARG 144 ? ? NE A ARG 144 ? ? CZ A ARG 144 ? ? 157.56 123.60 33.96 1.40 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 10 ? ? -140.87 16.32 2 1 SER A 13 ? ? 59.65 79.30 3 1 TRP A 89 ? ? -100.98 41.03 4 1 ALA A 132 ? ? -151.39 69.68 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 3 '7,8-DIHYDRO-6-HYDROXYMETHYL-7-METHYL-7-[2-PHENYLETHYL]-PTERIN' 87Y 4 'MAGNESIUM ION' MG 5 water HOH #