data_1DZY # _entry.id 1DZY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.302 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1DZY PDBE EBI-4702 WWPDB D_1290004702 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1FUA unspecified 'L-FUCULOSE 1-PHOSPHATE ALDOLASE CRYSTAL FORM T' PDB 2FUA unspecified 'L-FUCULOSE 1-PHOSPHATE ALDOLASE CRYSTAL FORM T WITH COBALT' PDB 3FUA unspecified 'L-FUCULOSE 1-PHOSPHATE ALDOLASE CRYSTAL FORM K' PDB 4FUA unspecified 'L-FUCULOSE 1-PHOSPHATE ALDOLASE COMPLEX WITH PGH' PDB 1DZU unspecified 'L-FUCULOSE-1-PHOSPHATE ALDOLASE FROM ESCHERICHIA COLI MUTANT T26A' PDB 1DZV unspecified 'L-FUCULOSE-1-PHOSPHATE ALDOLASE FROM ESCHERICHIA COLI MUTANT Y113F/Y209F' PDB 1DZW unspecified 'L-FUCULOSE-1-PHOSPHATE ALDOLASE FROM ESCHERICHIA COLI MUTANT F131A' PDB 1DZX unspecified 'L-FUCULOSE-1-PHOSPHATE ALDOLASE FROM ESCHERICHIA COLI MUTANT R212A' PDB 1DZZ unspecified 'L-FUCULOSE-1-PHOSPHATE ALDOLASE FROM ESCHERICHIA COLI MUTANT Y113F' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DZY _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-03-07 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Joerger, A.C.' 1 ? 'Schulz, G.E.' 2 ? # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Catalytic Action of Fuculose 1-Phosphate Aldolase (Class II) as Derived from Structure-Directed Mutagenesis' Biochemistry 39 6033 ? 2000 BICHAW US 0006-2960 0033 ? 10821675 10.1021/BI9927686 1 'Catalytic Mechanism of the Metal-Dependent Fuculose Aldolase from Escherichia Coli as Derived from the Structure' J.Mol.Biol. 259 458 ? 1996 JMOBAK UK 0022-2836 0070 ? 8676381 10.1006/JMBI.1996.0332 2 'The Spatial Structure of the Class II L-Fuculose-1-Phosphate Aldolase from Escherichia Coli' J.Mol.Biol. 231 549 ? 1993 JMOBAK UK 0022-2836 0070 ? 8515438 10.1006/JMBI.1993.1307 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Joerger, A.C.' 1 ? primary 'Gosse, C.' 2 ? primary 'Fessner, W.-D.' 3 ? primary 'Schulz, G.E.' 4 ? 1 'Dreyer, M.K.' 5 ? 1 'Schulz, G.E.' 6 ? 2 'Dreyer, M.K.' 7 ? 2 'Schulz, G.E.' 8 ? # _cell.entry_id 1DZY _cell.length_a 93.800 _cell.length_b 93.800 _cell.length_c 42.900 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DZY _symmetry.space_group_name_H-M 'P 4 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 90 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'L-FUCULOSE-1-PHOSPHATE ALDOLASE' 23747.283 1 4.1.2.17 YES ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn BETA-MERCAPTOETHANOL 78.133 1 ? ? ? ? 4 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 5 water nat water 18.015 99 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDGNGKHEEGKLPSSEWRFHMAA YQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGGNSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIAC EVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIAE ; _entity_poly.pdbx_seq_one_letter_code_can ;MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDGNGKHEEGKLPSSEWRFHMAA YQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGGNSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIAC EVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIAE ; _entity_poly.pdbx_strand_id P _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ARG n 1 4 ASN n 1 5 LYS n 1 6 LEU n 1 7 ALA n 1 8 ARG n 1 9 GLN n 1 10 ILE n 1 11 ILE n 1 12 ASP n 1 13 THR n 1 14 CYS n 1 15 LEU n 1 16 GLU n 1 17 MET n 1 18 THR n 1 19 ARG n 1 20 LEU n 1 21 GLY n 1 22 LEU n 1 23 ASN n 1 24 GLN n 1 25 GLY n 1 26 THR n 1 27 ALA n 1 28 GLY n 1 29 ASN n 1 30 VAL n 1 31 SER n 1 32 VAL n 1 33 ARG n 1 34 TYR n 1 35 GLN n 1 36 ASP n 1 37 GLY n 1 38 MET n 1 39 LEU n 1 40 ILE n 1 41 THR n 1 42 PRO n 1 43 THR n 1 44 GLY n 1 45 ILE n 1 46 PRO n 1 47 TYR n 1 48 GLU n 1 49 LYS n 1 50 LEU n 1 51 THR n 1 52 GLU n 1 53 SER n 1 54 HIS n 1 55 ILE n 1 56 VAL n 1 57 PHE n 1 58 ILE n 1 59 ASP n 1 60 GLY n 1 61 ASN n 1 62 GLY n 1 63 LYS n 1 64 HIS n 1 65 GLU n 1 66 GLU n 1 67 GLY n 1 68 LYS n 1 69 LEU n 1 70 PRO n 1 71 SER n 1 72 SER n 1 73 GLU n 1 74 TRP n 1 75 ARG n 1 76 PHE n 1 77 HIS n 1 78 MET n 1 79 ALA n 1 80 ALA n 1 81 TYR n 1 82 GLN n 1 83 SER n 1 84 ARG n 1 85 PRO n 1 86 ASP n 1 87 ALA n 1 88 ASN n 1 89 ALA n 1 90 VAL n 1 91 VAL n 1 92 HIS n 1 93 ASN n 1 94 HIS n 1 95 ALA n 1 96 VAL n 1 97 HIS n 1 98 CYS n 1 99 THR n 1 100 ALA n 1 101 VAL n 1 102 SER n 1 103 ILE n 1 104 LEU n 1 105 ASN n 1 106 ARG n 1 107 SER n 1 108 ILE n 1 109 PRO n 1 110 ALA n 1 111 ILE n 1 112 HIS n 1 113 TYR n 1 114 MET n 1 115 ILE n 1 116 ALA n 1 117 ALA n 1 118 ALA n 1 119 GLY n 1 120 GLY n 1 121 ASN n 1 122 SER n 1 123 ILE n 1 124 PRO n 1 125 CYS n 1 126 ALA n 1 127 PRO n 1 128 TYR n 1 129 ALA n 1 130 THR n 1 131 PHE n 1 132 GLY n 1 133 THR n 1 134 ARG n 1 135 GLU n 1 136 LEU n 1 137 SER n 1 138 GLU n 1 139 HIS n 1 140 VAL n 1 141 ALA n 1 142 LEU n 1 143 ALA n 1 144 LEU n 1 145 LYS n 1 146 ASN n 1 147 ARG n 1 148 LYS n 1 149 ALA n 1 150 THR n 1 151 LEU n 1 152 LEU n 1 153 GLN n 1 154 HIS n 1 155 HIS n 1 156 GLY n 1 157 LEU n 1 158 ILE n 1 159 ALA n 1 160 CYS n 1 161 GLU n 1 162 VAL n 1 163 ASN n 1 164 LEU n 1 165 GLU n 1 166 LYS n 1 167 ALA n 1 168 LEU n 1 169 TRP n 1 170 LEU n 1 171 ALA n 1 172 HIS n 1 173 GLU n 1 174 VAL n 1 175 GLU n 1 176 VAL n 1 177 LEU n 1 178 ALA n 1 179 GLN n 1 180 LEU n 1 181 TYR n 1 182 LEU n 1 183 THR n 1 184 THR n 1 185 LEU n 1 186 ALA n 1 187 ILE n 1 188 THR n 1 189 ASP n 1 190 PRO n 1 191 VAL n 1 192 PRO n 1 193 VAL n 1 194 LEU n 1 195 SER n 1 196 ASP n 1 197 GLU n 1 198 GLU n 1 199 ILE n 1 200 ALA n 1 201 VAL n 1 202 VAL n 1 203 LEU n 1 204 GLU n 1 205 LYS n 1 206 PHE n 1 207 LYS n 1 208 THR n 1 209 TYR n 1 210 GLY n 1 211 LEU n 1 212 ARG n 1 213 ILE n 1 214 ALA n 1 215 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'JM 105' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PKKFA2-E214A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'E214A SUBSTITUTION PERFORMED WITH KUNKEL METHOD USING M13MP19' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FUCA_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P0AB87 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DZY _struct_ref_seq.pdbx_strand_id P _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 215 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AB87 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 215 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 215 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1DZY _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id P _struct_ref_seq_dif.seq_num 214 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P0AB87 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 214 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 214 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BME non-polymer . BETA-MERCAPTOETHANOL ? 'C2 H6 O S' 78.133 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1DZY _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.0 _exptl_crystal.density_percent_sol 38 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.00 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;CRYSTALS GROWN FROM AMMONIUM SULFATE AT PH 8.0, VAPOUR DIFFUSION, HANGING DROP, CONDITIONS CLOSE TO THE ONES REPORTED FOR THE WILD-TYPE, SEE PDB ID 1FUA FOR FURTHER DETAILS ; # _diffrn.id 1 _diffrn.ambient_temp 293.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'SIEMENS X-1000 CCD' _diffrn_detector.pdbx_collection_date 1996-12-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'SIEMENS XP-18H' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1DZY _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 10.000 _reflns.d_resolution_high 2.440 _reflns.number_obs 6829 _reflns.number_all ? _reflns.percent_possible_obs 92.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.08700 _reflns.pdbx_netI_over_sigmaI 8.2000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.100 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.44 _reflns_shell.d_res_low 2.52 _reflns_shell.percent_possible_all 85.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.21000 _reflns_shell.meanI_over_sigI_obs 3.300 _reflns_shell.pdbx_redundancy 2.30 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1DZY _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 6829 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.0 _refine.ls_d_res_high 2.44 _refine.ls_percent_reflns_obs 92 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.149 _refine.ls_R_factor_R_free 0.226 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 6.0 _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 17.3 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1593 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 99 _refine_hist.number_atoms_total 1707 _refine_hist.d_res_high 2.44 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.013 0.02 ? ? 'X-RAY DIFFRACTION' ? p_angle_d 0.04 0.04 ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d 0.04 0.05 ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1DZY _struct.title 'L-Fuculose-1-Phosphate Aldolase from Escherichia coli Mutant E214A' _struct.pdbx_descriptor 'L-FUCULOSE-1-PHOSPHATE ALDOLASE (E.C.4.1.2.17)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DZY _struct_keywords.pdbx_keywords 'LYASE (ALDEHYDE)' _struct_keywords.text ;LYASE (ALDEHYDE), ALDOLASE (CLASS II), BACTERIAL L-FUCOSE METABOLISM, CLEAVAGE OF L-FUCULOSE-1-PHOSPHATE TO DIHYDROXYACETONEPHOSPHATE AND L-LACTALDEHYDE, MUTANT STRUCTURE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 2 ? LEU A 20 ? GLU P 2 LEU P 20 1 ? 19 HELX_P HELX_P2 2 PRO A 46 ? LEU A 50 ? PRO P 46 LEU P 50 5 ? 5 HELX_P HELX_P3 3 THR A 51 ? ILE A 55 ? THR P 51 ILE P 55 5 ? 5 HELX_P HELX_P4 4 TRP A 74 ? ARG A 84 ? TRP P 74 ARG P 84 1 ? 11 HELX_P HELX_P5 5 ALA A 95 ? LEU A 104 ? ALA P 95 LEU P 104 1 ? 10 HELX_P HELX_P6 6 HIS A 112 ? GLY A 119 ? HIS P 112 GLY P 119 5 ? 8 HELX_P HELX_P7 7 THR A 133 ? LYS A 145 ? THR P 133 LYS P 145 1 ? 13 HELX_P HELX_P8 8 ASN A 163 ? ALA A 186 ? ASN P 163 ALA P 186 1 ? 24 HELX_P HELX_P9 9 SER A 195 ? PHE A 206 ? SER P 195 PHE P 206 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A CYS 14 SG ? ? ? 1_555 D BME . S2 ? ? P CYS 14 P BME 314 1_555 ? ? ? ? ? ? ? 1.965 ? metalc1 metalc ? ? E ZN . ZN ? ? ? 1_555 A GLU 73 OE2 ? ? P ZN 999 P GLU 73 1_555 ? ? ? ? ? ? ? 2.195 ? metalc2 metalc ? ? E ZN . ZN ? ? ? 1_555 A HIS 92 NE2 ? ? P ZN 999 P HIS 92 1_555 ? ? ? ? ? ? ? 2.043 ? metalc3 metalc ? ? E ZN . ZN ? ? ? 1_555 A HIS 94 NE2 ? ? P ZN 999 P HIS 94 1_555 ? ? ? ? ? ? ? 2.034 ? metalc4 metalc ? ? E ZN . ZN ? ? ? 1_555 A HIS 155 NE2 ? ? P ZN 999 P HIS 155 1_555 ? ? ? ? ? ? ? 2.271 ? metalc5 metalc ? ? E ZN . ZN ? ? ? 1_555 A GLU 73 OE1 ? ? P ZN 999 P GLU 73 1_555 ? ? ? ? ? ? ? 2.150 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASP _struct_mon_prot_cis.label_seq_id 189 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASP _struct_mon_prot_cis.auth_seq_id 189 _struct_mon_prot_cis.auth_asym_id P _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 190 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 190 _struct_mon_prot_cis.pdbx_auth_asym_id_2 P _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.64 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 56 ? ILE A 58 ? VAL P 56 ILE P 58 A 2 GLY A 37 ? ILE A 40 ? GLY P 37 ILE P 40 A 3 ASN A 29 ? TYR A 34 ? ASN P 29 TYR P 34 A 4 ALA A 89 ? ASN A 93 ? ALA P 89 ASN P 93 A 5 GLY A 156 ? GLU A 161 ? GLY P 156 GLU P 161 A 6 ALA A 149 ? LEU A 152 ? ALA P 149 LEU P 152 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 56 ? O VAL P 56 N ILE A 40 ? N ILE P 40 A 2 3 O GLY A 37 ? O GLY P 37 N TYR A 34 ? N TYR P 34 A 3 4 O ASN A 29 ? O ASN P 29 N HIS A 92 ? N HIS P 92 A 4 5 O ALA A 89 ? O ALA P 89 N GLU A 161 ? N GLU P 161 A 5 6 O GLY A 156 ? O GLY P 156 N LEU A 152 ? N LEU P 152 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN P 999' AC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 P 300' AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 P 301' AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE BME P 314' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 73 ? GLU P 73 . ? 1_555 ? 2 AC1 4 HIS A 92 ? HIS P 92 . ? 1_555 ? 3 AC1 4 HIS A 94 ? HIS P 94 . ? 1_555 ? 4 AC1 4 HIS A 155 ? HIS P 155 . ? 1_555 ? 5 AC2 8 ASN A 29 ? ASN P 29 . ? 1_555 ? 6 AC2 8 THR A 43 ? THR P 43 . ? 1_555 ? 7 AC2 8 SER A 71 ? SER P 71 . ? 1_555 ? 8 AC2 8 SER A 72 ? SER P 72 . ? 1_555 ? 9 AC2 8 HOH F . ? HOH P 2095 . ? 1_555 ? 10 AC2 8 HOH F . ? HOH P 2096 . ? 1_555 ? 11 AC2 8 HOH F . ? HOH P 2097 . ? 1_555 ? 12 AC2 8 HOH F . ? HOH P 2098 . ? 1_555 ? 13 AC3 5 HIS A 64 ? HIS P 64 . ? 1_555 ? 14 AC3 5 GLY A 67 ? GLY P 67 . ? 1_555 ? 15 AC3 5 TRP A 74 ? TRP P 74 . ? 1_555 ? 16 AC3 5 ARG A 75 ? ARG P 75 . ? 1_555 ? 17 AC3 5 HOH F . ? HOH P 2099 . ? 1_555 ? 18 AC4 5 CYS A 14 ? CYS P 14 . ? 1_555 ? 19 AC4 5 GLY A 28 ? GLY P 28 . ? 1_555 ? 20 AC4 5 THR A 41 ? THR P 41 . ? 1_555 ? 21 AC4 5 HOH F . ? HOH P 2015 . ? 1_555 ? 22 AC4 5 HOH F . ? HOH P 2097 . ? 1_555 ? # _database_PDB_matrix.entry_id 1DZY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1DZY _atom_sites.fract_transf_matrix[1][1] 0.010661 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010661 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023310 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET P . n A 1 2 GLU 2 2 2 GLU GLU P . n A 1 3 ARG 3 3 3 ARG ARG P . n A 1 4 ASN 4 4 4 ASN ASN P . n A 1 5 LYS 5 5 5 LYS LYS P . n A 1 6 LEU 6 6 6 LEU LEU P . n A 1 7 ALA 7 7 7 ALA ALA P . n A 1 8 ARG 8 8 8 ARG ARG P . n A 1 9 GLN 9 9 9 GLN GLN P . n A 1 10 ILE 10 10 10 ILE ILE P . n A 1 11 ILE 11 11 11 ILE ILE P . n A 1 12 ASP 12 12 12 ASP ASP P . n A 1 13 THR 13 13 13 THR THR P . n A 1 14 CYS 14 14 14 CYS CYS P . n A 1 15 LEU 15 15 15 LEU LEU P . n A 1 16 GLU 16 16 16 GLU GLU P . n A 1 17 MET 17 17 17 MET MET P . n A 1 18 THR 18 18 18 THR THR P . n A 1 19 ARG 19 19 19 ARG ARG P . n A 1 20 LEU 20 20 20 LEU LEU P . n A 1 21 GLY 21 21 21 GLY GLY P . n A 1 22 LEU 22 22 22 LEU LEU P . n A 1 23 ASN 23 23 23 ASN ASN P . n A 1 24 GLN 24 24 24 GLN GLN P . n A 1 25 GLY 25 25 25 GLY GLY P . n A 1 26 THR 26 26 26 THR THR P . n A 1 27 ALA 27 27 27 ALA ALA P . n A 1 28 GLY 28 28 28 GLY GLY P . n A 1 29 ASN 29 29 29 ASN ASN P . n A 1 30 VAL 30 30 30 VAL VAL P . n A 1 31 SER 31 31 31 SER SER P . n A 1 32 VAL 32 32 32 VAL VAL P . n A 1 33 ARG 33 33 33 ARG ARG P . n A 1 34 TYR 34 34 34 TYR TYR P . n A 1 35 GLN 35 35 35 GLN GLN P . n A 1 36 ASP 36 36 36 ASP ASP P . n A 1 37 GLY 37 37 37 GLY GLY P . n A 1 38 MET 38 38 38 MET MET P . n A 1 39 LEU 39 39 39 LEU LEU P . n A 1 40 ILE 40 40 40 ILE ILE P . n A 1 41 THR 41 41 41 THR THR P . n A 1 42 PRO 42 42 42 PRO PRO P . n A 1 43 THR 43 43 43 THR THR P . n A 1 44 GLY 44 44 44 GLY GLY P . n A 1 45 ILE 45 45 45 ILE ILE P . n A 1 46 PRO 46 46 46 PRO PRO P . n A 1 47 TYR 47 47 47 TYR TYR P . n A 1 48 GLU 48 48 48 GLU GLU P . n A 1 49 LYS 49 49 49 LYS LYS P . n A 1 50 LEU 50 50 50 LEU LEU P . n A 1 51 THR 51 51 51 THR THR P . n A 1 52 GLU 52 52 52 GLU GLU P . n A 1 53 SER 53 53 53 SER SER P . n A 1 54 HIS 54 54 54 HIS HIS P . n A 1 55 ILE 55 55 55 ILE ILE P . n A 1 56 VAL 56 56 56 VAL VAL P . n A 1 57 PHE 57 57 57 PHE PHE P . n A 1 58 ILE 58 58 58 ILE ILE P . n A 1 59 ASP 59 59 59 ASP ASP P . n A 1 60 GLY 60 60 60 GLY GLY P . n A 1 61 ASN 61 61 61 ASN ASN P . n A 1 62 GLY 62 62 62 GLY GLY P . n A 1 63 LYS 63 63 63 LYS LYS P . n A 1 64 HIS 64 64 64 HIS HIS P . n A 1 65 GLU 65 65 65 GLU GLU P . n A 1 66 GLU 66 66 66 GLU GLU P . n A 1 67 GLY 67 67 67 GLY GLY P . n A 1 68 LYS 68 68 68 LYS LYS P . n A 1 69 LEU 69 69 69 LEU LEU P . n A 1 70 PRO 70 70 70 PRO PRO P . n A 1 71 SER 71 71 71 SER SER P . n A 1 72 SER 72 72 72 SER SER P . n A 1 73 GLU 73 73 73 GLU GLU P . n A 1 74 TRP 74 74 74 TRP TRP P . n A 1 75 ARG 75 75 75 ARG ARG P . n A 1 76 PHE 76 76 76 PHE PHE P . n A 1 77 HIS 77 77 77 HIS HIS P . n A 1 78 MET 78 78 78 MET MET P . n A 1 79 ALA 79 79 79 ALA ALA P . n A 1 80 ALA 80 80 80 ALA ALA P . n A 1 81 TYR 81 81 81 TYR TYR P . n A 1 82 GLN 82 82 82 GLN GLN P . n A 1 83 SER 83 83 83 SER SER P . n A 1 84 ARG 84 84 84 ARG ARG P . n A 1 85 PRO 85 85 85 PRO PRO P . n A 1 86 ASP 86 86 86 ASP ASP P . n A 1 87 ALA 87 87 87 ALA ALA P . n A 1 88 ASN 88 88 88 ASN ASN P . n A 1 89 ALA 89 89 89 ALA ALA P . n A 1 90 VAL 90 90 90 VAL VAL P . n A 1 91 VAL 91 91 91 VAL VAL P . n A 1 92 HIS 92 92 92 HIS HIS P . n A 1 93 ASN 93 93 93 ASN ASN P . n A 1 94 HIS 94 94 94 HIS HIS P . n A 1 95 ALA 95 95 95 ALA ALA P . n A 1 96 VAL 96 96 96 VAL VAL P . n A 1 97 HIS 97 97 97 HIS HIS P . n A 1 98 CYS 98 98 98 CYS CYS P . n A 1 99 THR 99 99 99 THR THR P . n A 1 100 ALA 100 100 100 ALA ALA P . n A 1 101 VAL 101 101 101 VAL VAL P . n A 1 102 SER 102 102 102 SER SER P . n A 1 103 ILE 103 103 103 ILE ILE P . n A 1 104 LEU 104 104 104 LEU LEU P . n A 1 105 ASN 105 105 105 ASN ASN P . n A 1 106 ARG 106 106 106 ARG ARG P . n A 1 107 SER 107 107 107 SER SER P . n A 1 108 ILE 108 108 108 ILE ILE P . n A 1 109 PRO 109 109 109 PRO PRO P . n A 1 110 ALA 110 110 110 ALA ALA P . n A 1 111 ILE 111 111 111 ILE ILE P . n A 1 112 HIS 112 112 112 HIS HIS P . n A 1 113 TYR 113 113 113 TYR TYR P . n A 1 114 MET 114 114 114 MET MET P . n A 1 115 ILE 115 115 115 ILE ILE P . n A 1 116 ALA 116 116 116 ALA ALA P . n A 1 117 ALA 117 117 117 ALA ALA P . n A 1 118 ALA 118 118 118 ALA ALA P . n A 1 119 GLY 119 119 119 GLY GLY P . n A 1 120 GLY 120 120 120 GLY GLY P . n A 1 121 ASN 121 121 121 ASN ASN P . n A 1 122 SER 122 122 122 SER SER P . n A 1 123 ILE 123 123 123 ILE ILE P . n A 1 124 PRO 124 124 124 PRO PRO P . n A 1 125 CYS 125 125 125 CYS CYS P . n A 1 126 ALA 126 126 126 ALA ALA P . n A 1 127 PRO 127 127 127 PRO PRO P . n A 1 128 TYR 128 128 128 TYR TYR P . n A 1 129 ALA 129 129 129 ALA ALA P . n A 1 130 THR 130 130 130 THR THR P . n A 1 131 PHE 131 131 131 PHE PHE P . n A 1 132 GLY 132 132 132 GLY GLY P . n A 1 133 THR 133 133 133 THR THR P . n A 1 134 ARG 134 134 134 ARG ARG P . n A 1 135 GLU 135 135 135 GLU GLU P . n A 1 136 LEU 136 136 136 LEU LEU P . n A 1 137 SER 137 137 137 SER SER P . n A 1 138 GLU 138 138 138 GLU GLU P . n A 1 139 HIS 139 139 139 HIS HIS P . n A 1 140 VAL 140 140 140 VAL VAL P . n A 1 141 ALA 141 141 141 ALA ALA P . n A 1 142 LEU 142 142 142 LEU LEU P . n A 1 143 ALA 143 143 143 ALA ALA P . n A 1 144 LEU 144 144 144 LEU LEU P . n A 1 145 LYS 145 145 145 LYS LYS P . n A 1 146 ASN 146 146 146 ASN ASN P . n A 1 147 ARG 147 147 147 ARG ARG P . n A 1 148 LYS 148 148 148 LYS LYS P . n A 1 149 ALA 149 149 149 ALA ALA P . n A 1 150 THR 150 150 150 THR THR P . n A 1 151 LEU 151 151 151 LEU LEU P . n A 1 152 LEU 152 152 152 LEU LEU P . n A 1 153 GLN 153 153 153 GLN GLN P . n A 1 154 HIS 154 154 154 HIS HIS P . n A 1 155 HIS 155 155 155 HIS HIS P . n A 1 156 GLY 156 156 156 GLY GLY P . n A 1 157 LEU 157 157 157 LEU LEU P . n A 1 158 ILE 158 158 158 ILE ILE P . n A 1 159 ALA 159 159 159 ALA ALA P . n A 1 160 CYS 160 160 160 CYS CYS P . n A 1 161 GLU 161 161 161 GLU GLU P . n A 1 162 VAL 162 162 162 VAL VAL P . n A 1 163 ASN 163 163 163 ASN ASN P . n A 1 164 LEU 164 164 164 LEU LEU P . n A 1 165 GLU 165 165 165 GLU GLU P . n A 1 166 LYS 166 166 166 LYS LYS P . n A 1 167 ALA 167 167 167 ALA ALA P . n A 1 168 LEU 168 168 168 LEU LEU P . n A 1 169 TRP 169 169 169 TRP TRP P . n A 1 170 LEU 170 170 170 LEU LEU P . n A 1 171 ALA 171 171 171 ALA ALA P . n A 1 172 HIS 172 172 172 HIS HIS P . n A 1 173 GLU 173 173 173 GLU GLU P . n A 1 174 VAL 174 174 174 VAL VAL P . n A 1 175 GLU 175 175 175 GLU GLU P . n A 1 176 VAL 176 176 176 VAL VAL P . n A 1 177 LEU 177 177 177 LEU LEU P . n A 1 178 ALA 178 178 178 ALA ALA P . n A 1 179 GLN 179 179 179 GLN GLN P . n A 1 180 LEU 180 180 180 LEU LEU P . n A 1 181 TYR 181 181 181 TYR TYR P . n A 1 182 LEU 182 182 182 LEU LEU P . n A 1 183 THR 183 183 183 THR THR P . n A 1 184 THR 184 184 184 THR THR P . n A 1 185 LEU 185 185 185 LEU LEU P . n A 1 186 ALA 186 186 186 ALA ALA P . n A 1 187 ILE 187 187 187 ILE ILE P . n A 1 188 THR 188 188 188 THR THR P . n A 1 189 ASP 189 189 189 ASP ASP P . n A 1 190 PRO 190 190 190 PRO PRO P . n A 1 191 VAL 191 191 191 VAL VAL P . n A 1 192 PRO 192 192 192 PRO PRO P . n A 1 193 VAL 193 193 193 VAL VAL P . n A 1 194 LEU 194 194 194 LEU LEU P . n A 1 195 SER 195 195 195 SER SER P . n A 1 196 ASP 196 196 196 ASP ASP P . n A 1 197 GLU 197 197 197 GLU GLU P . n A 1 198 GLU 198 198 198 GLU GLU P . n A 1 199 ILE 199 199 199 ILE ILE P . n A 1 200 ALA 200 200 200 ALA ALA P . n A 1 201 VAL 201 201 201 VAL VAL P . n A 1 202 VAL 202 202 202 VAL VAL P . n A 1 203 LEU 203 203 203 LEU LEU P . n A 1 204 GLU 204 204 204 GLU GLU P . n A 1 205 LYS 205 205 205 LYS LYS P . n A 1 206 PHE 206 206 206 PHE PHE P . n A 1 207 LYS 207 207 ? ? ? P . n A 1 208 THR 208 208 ? ? ? P . n A 1 209 TYR 209 209 ? ? ? P . n A 1 210 GLY 210 210 ? ? ? P . n A 1 211 LEU 211 211 ? ? ? P . n A 1 212 ARG 212 212 ? ? ? P . n A 1 213 ILE 213 213 ? ? ? P . n A 1 214 ALA 214 214 ? ? ? P . n A 1 215 GLU 215 215 ? ? ? P . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 300 300 SO4 SO4 P . C 2 SO4 1 301 301 SO4 SO4 P . D 3 BME 1 314 314 BME BME P . E 4 ZN 1 999 999 ZN ZN P . F 5 HOH 1 2001 2001 HOH HOH P . F 5 HOH 2 2002 2002 HOH HOH P . F 5 HOH 3 2003 2003 HOH HOH P . F 5 HOH 4 2004 2004 HOH HOH P . F 5 HOH 5 2005 2005 HOH HOH P . F 5 HOH 6 2006 2006 HOH HOH P . F 5 HOH 7 2007 2007 HOH HOH P . F 5 HOH 8 2008 2008 HOH HOH P . F 5 HOH 9 2009 2009 HOH HOH P . F 5 HOH 10 2010 2010 HOH HOH P . F 5 HOH 11 2011 2011 HOH HOH P . F 5 HOH 12 2012 2012 HOH HOH P . F 5 HOH 13 2013 2013 HOH HOH P . F 5 HOH 14 2014 2014 HOH HOH P . F 5 HOH 15 2015 2015 HOH HOH P . F 5 HOH 16 2016 2016 HOH HOH P . F 5 HOH 17 2017 2017 HOH HOH P . F 5 HOH 18 2018 2018 HOH HOH P . F 5 HOH 19 2019 2019 HOH HOH P . F 5 HOH 20 2020 2020 HOH HOH P . F 5 HOH 21 2021 2021 HOH HOH P . F 5 HOH 22 2022 2022 HOH HOH P . F 5 HOH 23 2023 2023 HOH HOH P . F 5 HOH 24 2024 2024 HOH HOH P . F 5 HOH 25 2025 2025 HOH HOH P . F 5 HOH 26 2026 2026 HOH HOH P . F 5 HOH 27 2027 2027 HOH HOH P . F 5 HOH 28 2028 2028 HOH HOH P . F 5 HOH 29 2029 2029 HOH HOH P . F 5 HOH 30 2030 2030 HOH HOH P . F 5 HOH 31 2031 2031 HOH HOH P . F 5 HOH 32 2032 2032 HOH HOH P . F 5 HOH 33 2033 2033 HOH HOH P . F 5 HOH 34 2034 2034 HOH HOH P . F 5 HOH 35 2035 2035 HOH HOH P . F 5 HOH 36 2036 2036 HOH HOH P . F 5 HOH 37 2037 2037 HOH HOH P . F 5 HOH 38 2038 2038 HOH HOH P . F 5 HOH 39 2039 2039 HOH HOH P . F 5 HOH 40 2040 2040 HOH HOH P . F 5 HOH 41 2041 2041 HOH HOH P . F 5 HOH 42 2042 2042 HOH HOH P . F 5 HOH 43 2043 2043 HOH HOH P . F 5 HOH 44 2044 2044 HOH HOH P . F 5 HOH 45 2045 2045 HOH HOH P . F 5 HOH 46 2046 2046 HOH HOH P . F 5 HOH 47 2047 2047 HOH HOH P . F 5 HOH 48 2048 2048 HOH HOH P . F 5 HOH 49 2049 2049 HOH HOH P . F 5 HOH 50 2050 2050 HOH HOH P . F 5 HOH 51 2051 2051 HOH HOH P . F 5 HOH 52 2052 2052 HOH HOH P . F 5 HOH 53 2053 2053 HOH HOH P . F 5 HOH 54 2054 2054 HOH HOH P . F 5 HOH 55 2055 2055 HOH HOH P . F 5 HOH 56 2056 2056 HOH HOH P . F 5 HOH 57 2057 2057 HOH HOH P . F 5 HOH 58 2058 2058 HOH HOH P . F 5 HOH 59 2059 2059 HOH HOH P . F 5 HOH 60 2060 2060 HOH HOH P . F 5 HOH 61 2061 2061 HOH HOH P . F 5 HOH 62 2062 2062 HOH HOH P . F 5 HOH 63 2063 2063 HOH HOH P . F 5 HOH 64 2064 2064 HOH HOH P . F 5 HOH 65 2065 2065 HOH HOH P . F 5 HOH 66 2066 2066 HOH HOH P . F 5 HOH 67 2067 2067 HOH HOH P . F 5 HOH 68 2068 2068 HOH HOH P . F 5 HOH 69 2069 2069 HOH HOH P . F 5 HOH 70 2070 2070 HOH HOH P . F 5 HOH 71 2071 2071 HOH HOH P . F 5 HOH 72 2072 2072 HOH HOH P . F 5 HOH 73 2073 2073 HOH HOH P . F 5 HOH 74 2074 2074 HOH HOH P . F 5 HOH 75 2075 2075 HOH HOH P . F 5 HOH 76 2076 2076 HOH HOH P . F 5 HOH 77 2077 2077 HOH HOH P . F 5 HOH 78 2078 2078 HOH HOH P . F 5 HOH 79 2079 2079 HOH HOH P . F 5 HOH 80 2080 2080 HOH HOH P . F 5 HOH 81 2081 2081 HOH HOH P . F 5 HOH 82 2082 2082 HOH HOH P . F 5 HOH 83 2083 2083 HOH HOH P . F 5 HOH 84 2084 2084 HOH HOH P . F 5 HOH 85 2085 2085 HOH HOH P . F 5 HOH 86 2086 2086 HOH HOH P . F 5 HOH 87 2087 2087 HOH HOH P . F 5 HOH 88 2088 2088 HOH HOH P . F 5 HOH 89 2089 2089 HOH HOH P . F 5 HOH 90 2090 2090 HOH HOH P . F 5 HOH 91 2091 2091 HOH HOH P . F 5 HOH 92 2092 2092 HOH HOH P . F 5 HOH 93 2093 2093 HOH HOH P . F 5 HOH 94 2094 2094 HOH HOH P . F 5 HOH 95 2095 2095 HOH HOH P . F 5 HOH 96 2096 2096 HOH HOH P . F 5 HOH 97 2097 2097 HOH HOH P . F 5 HOH 98 2098 2098 HOH HOH P . F 5 HOH 99 2099 2099 HOH HOH P . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -y+1/2,x+1/2,z 0.0000000000 -1.0000000000 0.0000000000 46.9000000000 1.0000000000 0.0000000000 0.0000000000 46.9000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 4_455 y-1/2,-x+1/2,z 0.0000000000 1.0000000000 0.0000000000 -46.9000000000 -1.0000000000 0.0000000000 0.0000000000 46.9000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 2_565 -x,-y+1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 93.8000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 73 ? P GLU 73 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 NE2 ? A HIS 92 ? P HIS 92 ? 1_555 106.8 ? 2 OE2 ? A GLU 73 ? P GLU 73 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 NE2 ? A HIS 94 ? P HIS 94 ? 1_555 143.2 ? 3 NE2 ? A HIS 92 ? P HIS 92 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 NE2 ? A HIS 94 ? P HIS 94 ? 1_555 109.5 ? 4 OE2 ? A GLU 73 ? P GLU 73 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 NE2 ? A HIS 155 ? P HIS 155 ? 1_555 76.6 ? 5 NE2 ? A HIS 92 ? P HIS 92 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 NE2 ? A HIS 155 ? P HIS 155 ? 1_555 103.5 ? 6 NE2 ? A HIS 94 ? P HIS 94 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 NE2 ? A HIS 155 ? P HIS 155 ? 1_555 100.3 ? 7 OE2 ? A GLU 73 ? P GLU 73 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 OE1 ? A GLU 73 ? P GLU 73 ? 1_555 59.5 ? 8 NE2 ? A HIS 92 ? P HIS 92 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 OE1 ? A GLU 73 ? P GLU 73 ? 1_555 89.1 ? 9 NE2 ? A HIS 94 ? P HIS 94 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 OE1 ? A GLU 73 ? P GLU 73 ? 1_555 114.9 ? 10 NE2 ? A HIS 155 ? P HIS 155 ? 1_555 ZN ? E ZN . ? P ZN 999 ? 1_555 OE1 ? A GLU 73 ? P GLU 73 ? 1_555 136.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-06-02 2 'Structure model' 1 1 2011-05-07 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-01-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Experimental preparation' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 4 'Structure model' exptl_crystal_grow 3 4 'Structure model' pdbx_database_proc 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' struct_biol # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_y_n' 2 4 'Structure model' '_exptl_crystal_grow.method' 3 4 'Structure model' '_pdbx_database_status.recvd_author_approval' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement . ? 1 ? ? ? ? XDS 'data reduction' . ? 2 ? ? ? ? # _pdbx_entry_details.entry_id 1DZY _pdbx_entry_details.compound_details 'CHAIN P ENGINEERED MUTATION GLU214ALA' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;PHE: THE 9 C-TERMINAL RESIDUES (LYS 207 - GLU 215) WERE NOT SEEN IN THE DENSITY MAPS ; # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE P ARG 19 ? ? CZ P ARG 19 ? ? NH2 P ARG 19 ? ? 125.15 120.30 4.85 0.50 N 2 1 CB P ASP 36 ? ? CG P ASP 36 ? ? OD1 P ASP 36 ? ? 124.26 118.30 5.96 0.90 N 3 1 CB P TYR 47 ? ? CG P TYR 47 ? ? CD2 P TYR 47 ? ? 117.30 121.00 -3.70 0.60 N 4 1 NE P ARG 75 ? ? CZ P ARG 75 ? ? NH1 P ARG 75 ? ? 115.81 120.30 -4.49 0.50 N 5 1 NE P ARG 84 ? ? CZ P ARG 84 ? ? NH1 P ARG 84 ? ? 117.24 120.30 -3.06 0.50 N 6 1 CD P ARG 134 ? ? NE P ARG 134 ? ? CZ P ARG 134 ? ? 135.67 123.60 12.07 1.40 N 7 1 NE P ARG 134 ? ? CZ P ARG 134 ? ? NH1 P ARG 134 ? ? 125.14 120.30 4.84 0.50 N 8 1 NE P ARG 134 ? ? CZ P ARG 134 ? ? NH2 P ARG 134 ? ? 116.57 120.30 -3.73 0.50 N 9 1 CA P LEU 157 ? ? CB P LEU 157 ? ? CG P LEU 157 ? ? 132.34 115.30 17.04 2.30 N 10 1 CA P CYS 160 ? ? CB P CYS 160 ? A SG P CYS 160 ? A 122.36 114.20 8.16 1.10 N 11 1 N P ALA 167 ? ? CA P ALA 167 ? ? CB P ALA 167 ? ? 118.64 110.10 8.54 1.40 N 12 1 CB P ASP 189 ? ? CG P ASP 189 ? ? OD1 P ASP 189 ? ? 124.64 118.30 6.34 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR P 26 ? ? 11.49 74.13 2 1 GLN P 35 ? ? 38.72 -127.93 3 1 ILE P 45 ? ? -31.00 118.54 4 1 GLU P 65 ? ? -49.47 155.55 5 1 ALA P 95 ? ? -36.88 134.00 6 1 HIS P 155 ? ? -149.06 -69.23 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 P LYS 207 ? A LYS 207 2 1 Y 1 P THR 208 ? A THR 208 3 1 Y 1 P TYR 209 ? A TYR 209 4 1 Y 1 P GLY 210 ? A GLY 210 5 1 Y 1 P LEU 211 ? A LEU 211 6 1 Y 1 P ARG 212 ? A ARG 212 7 1 Y 1 P ILE 213 ? A ILE 213 8 1 Y 1 P ALA 214 ? A ALA 214 9 1 Y 1 P GLU 215 ? A GLU 215 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 BETA-MERCAPTOETHANOL BME 4 'ZINC ION' ZN 5 water HOH #